FGFR1/KLB targeting agonistic antigen-binding proteins and conjugates thereof with GLP-1R agonistic peptides

12054551 ยท 2024-08-06

Assignee

Inventors

Cpc classification

International classification

Abstract

Provided herein are FGFR1/KLB targeting agonistic antigen-binding proteins, or fragments thereof, having improved physico-chemical properties. Also provided herein are conjugates comprising an FGFR1/KLB targeting agonistic antigen-binding protein, or a fragment thereof, and at least one GLP-1R agonistic peptide. Further provided are pharmaceutical compositions comprising the antibody (or fragment thereof), or the conjugate provided herein, and the use of the antibody (or fragment thereof), or the use of the conjugate in medicine.

Claims

1. An antigen binding protein which binds ?-klotho and/or a complex comprising ?-klotho and FGFR1c, wherein the antigen binding protein comprises i. a heavy chain CDR1 comprising NARVGVS (SEQ ID NO: 4), a heavy chain CDR2 comprising HIFSNDEKSYSTSLKS (SEQ ID NO: 7), a heavy chain CDR3 comprising SVVTGGYYYEGMDV (SEQ ID NO: 9), a light chain CDR 1 comprising GGSNIGSESVH (SEQ ID NO: 12), a light chain CDR2 comprising SESDRPS (SEQ ID NO: 15), and a light chain CDR3 comprising QVWEGESDHVV (SEQ ID NO: 20), ii. a heavy chain CDR1 comprising NARVGVS (SEQ ID NO: 4), a heavy chain CDR2 comprising HIFSNDEKSYSTSLKS (SEQ ID NO: 7), a heavy chain CDR3 comprising SVVTGGYYYEGMDV (SEQ ID NO: 9), a light chain CDR 1 comprising GGSNIGSESVH (SEQ ID NO: 12), a light chain CDR2 comprising SASDRPS (SEQ ID NO:16), and a light chain CDR3 comprising QVWEGESDHVV (SEQ ID NO: 20), or iii. a heavy chain CDR1 comprising NARVGVS (SEQ ID NO: 4), a heavy chain CDR2 comprising HIFSNDEKSYSTSLKS (SEQ ID NO: 7), a heavy chain CDR3 comprising SVVTGGYYYEGMDV (SEQ ID NO: 9), a light chain CDR1 comprising GGSNIGSESVH (SEQ ID NO: 12), a light chain CDR2 comprising EESDRPS (SEQ ID NO: 17), and a light chain CDR3 comprising QVWEGESDHVV (SEQ ID NO: 20).

2. The antigen binding protein of claim 1, comprising a) a heavy chain variable region comprising an amino acid sequence of TABLE-US-00038 (SEQIDNO:30) QVTLKESGPVLVKPTETLTLTCTVSGFSLNNARVGVSWIRQPPGKALEW LAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCA RSVVTGGYYYEGMDVWGQGTTVTVSS, and a light chain variable region comprising an amino acid sequence of TABLE-US-00039 (SEQIDNO:34) SYVLTQPPSVSVAPGQTARITCGGSNIGSESVHWYQQKPGQAPVLVVYS ESDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWEGESDHVV FGGGTKLTVL, b) a heavy chain variable region comprising an amino acid sequence of TABLE-US-00040 (SEQIDNO:31) QVTLKESGPVLVKPTETLTLTCTVSGFSLNNARVGVSWIRQPPGKALEW LAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCA RSVVTGGYYYEGMDVWGQGTTVTVSS, and a light chain variable region comprising an amino acid sequence of TABLE-US-00041 (SEQIDNO:35) SYVLTQPPSVSVAPGQTARITCGGSNIGSESVHWYQQKPGQAPVLVVYSA SDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWEGESDHVVFG GGTKLTVL, or c) a heavy chain variable region comprising an amino acid sequence of TABLE-US-00042 (SEQIDNO:32) QVTLKESGPVLVKPTETLTLTCTVSGFSLNNARVGVSWIRQPPGKALEWL AHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARS VVTGGYYYEGMDVWGQGTTVTVSS, and a light chain variable region comprising an amino acid sequence of TABLE-US-00043 (SEQIDNO:36) SYVLTQPPSVSVAPGQTARITCGGSNIGSESVHWYQQKPGQAPVLVVYEE SDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWEGESDHVVFG GGTKLTVL.

3. The antigen-binding protein of claim 1, wherein the antigen-binding protein activates the cell-surface receptor complex comprising ?-Klotho and FGFR1c.

4. The antigen-binding protein of claim 1, wherein the antigen-binding protein is an antibody, or an antigen-binding fragment thereof.

5. The antigen binding protein of claim 4, wherein the antibody is a bivalent antigen-binding fragment thereof.

6. A conjugate comprising the antigen binding protein of claim 1, wherein the antigen binding protein is conjugated to at least one GLP-1R agonistic peptide, wherein the at least one GLP-1R agonistic peptide comprises or consists of the amino acid sequence: TABLE-US-00044 (SEQIDNO:83) GHGEGTFTSDLSKQLEEEAVQLFIEWLKAGGPKKIRYS.

7. The conjugate of claim 6, wherein the antigen binding protein is an antibody or antigen binding fragment thereof, and/or wherein the antigen binding protein is conjugated to one, two, three, four, or more GLP-1R agonistic peptides.

8. The conjugate of claim 7, wherein each heavy chain variable region and/or each light chain variable region is conjugated to at least one GLP-1R agonistic peptide.

9. The conjugate of claim 6, wherein the antigen binding protein is conjugated to the at least one GLP-1R agonistic peptide via a linker, wherein optionally the linker peptide has a length of at least 2 amino acids.

10. A pharmaceutical composition comprising the antigen-binding protein of claim 1 or a conjugate comprising the antigen binding protein conjugated to at least one GLP-1R agonistic peptide, and a pharmaceutically acceptable carrier and/or excipient.

11. The antigen binding protein of claim 1, wherein a) the heavy chain comprising an amino acid sequence of SEQ ID NO: 38, and the light chain of comprising an amino acid sequence of SEQ ID NO: 45, b) the heavy chain comprising an amino acid sequence of SEQ ID NO: 39, and the light chain comprising an amino acid sequence of SEQ ID NO: 46, c) the heavy chain comprising an amino acid sequence of SEQ ID NO: 40, and the light chain comprising an amino acid sequence of SEQ ID NO: 47, d) the heavy chain comprising an amino acid sequence of SEQ ID NO: 41, and the light chain comprising an amino acid sequence of SEQ ID NO: 48, e) the heavy chain comprising an amino acid sequence of SEQ ID NO: 42, and the light chain comprising an amino acid sequence of SEQ ID NO: 49, or f) the heavy chain comprising an amino acid sequence of SEQ ID NO: 43, and the light chain comprising an amino acid sequence of SEQ ID NO: 50.

12. The antigen binding protein of claim 1, wherein the antigen binding protein comprises a heavy chain CDR1 comprising NARVGVS (SEQ ID NO: 4), a heavy chain CDR2 comprising HIFSNDEKSYSTSLKS (SEQ ID NO: 7), a heavy chain CDR3 comprising SVVTGGYYYEGMDV (SEQ ID NO: 9), a light chain CDR1 comprising GGSNIGSESVH (SEQ ID NO: 12), a light chain CDR2 comprising SASDRPS (SEQ ID NO:16), and a light chain CDR3 comprising QVWEGESDHVV (SEQ ID NO: 20).

13. The antigen binding protein of claim 1, comprising a) a heavy chain CDR1 comprising TABLE-US-00045 (SEQIDNO:4) NARVGVS, b) a heavy chain CDR2 comprising TABLE-US-00046 (SEQIDNO:7) HIFSNDEKSYSTSLKS, c) a heavy chain CDR3 comprising TABLE-US-00047 (SEQIDNO:9) SVVTGGYYYEGMDV, d) a light chain CDR1 comprising TABLE-US-00048 (SEQIDNO:12) GGSNIGSESVH, e) a light chain CDR2 comprising TABLE-US-00049 (SEQIDNO:15) SESDRPS, and f) a light chain CDR3 comprising TABLE-US-00050 (SEQIDNO:20) QVWEGESDHVV,

14. The antigen binding protein of claim 1, comprising a) a heavy chain CDR1 comprising TABLE-US-00051 (SEQIDNO:4) NARVGVS, b) a heavy chain CDR2 comprising TABLE-US-00052 (SEQIDNO:7) HIFSNDEKSYSTSLKS, c) a heavy chain CDR3 comprising TABLE-US-00053 (SEQIDNO:9) SVVTGGYYYEGMDV, d) a light chain CDR1 comprising TABLE-US-00054 (SEQIDNO:12) GGSNIGSESVH, e) a light chain CDR2 comprising EESDRPS (SEQ ID NO: 17) and f) a light chain CDR3 comprising TABLE-US-00055 (SEQIDNO:20) QVWEGESDHVV.

Description

DESCRIPTION OF THE FIGURES

(1) FIG. 1 Amino acid sequence of the anti FGFR1c/KLB monoclonal antibody 16H7 as disclosed in WO 2011/071783 with CDRs of light and heavy chain by Kabat underlined (amino acid sequence of the heavy chain: SEQ ID NO: 1; amino acid sequence of the light chain: SEQ ID NO: 2).

(2) FIG. 2 In vitro data showing reduced activity and affinity of 16H7 after thermal stress at 40? C. for 28 days at pH 6. (A) EC50 values and Emax values (B) measured via a Luciferase gene reporter assay (data are mean?SEM, n=6-10; * P<0.05 vs. day 0). (C) Off-rates of the interaction of mAb 16H7 with human KLB assessed via SPR interaction analysis on a CM5 chip and a Biacore 8K (data are mean?SD, n=3; * P<0.05 vs. day 0). (D) Representative dose-response curves from Luciferase gene reporter assay.

(3) FIG. 3 Crystal structure of 16H7 Fab, the identified problematic amino acids are highlighted.

(4) FIG. 4 Impact of mutating the CDRs of the monoclonal antibody 16H7 on recombinant expression and biological activity. Single point mutations were introduced into the CDRs of 16H7 light and heavy chain and antibodies recombinantly expressed in suspension-adapted HEK293-F cells. (A) Cell supernatants containing expressed antibody constructs were harvested by centrifugation seven days after transfection and antibody expression was quantified by bio-layer interferometry (BLI) using Protein A biosensors. Shown are relative expression values versus 16H7 wild type. The cellular activity of single point mutated 16H7 variants was measured via Luciferase gene reporter assay, shown are EC50 (B) and Emax (C) values normalized to 16H7 wild type.

(5) FIG. 5 Analysis of cellular and binding activities of 16H7 variants with multiple mutations in the light and heavy chain. Cellular activity of monoclonal antibodies was analyzed with a Luciferase gene reporter assay assessing FGF21-like signaling, shown are mean EC50 values (A) and mean Emax values (B) (mean?SEM, n=3-7). Binding of the antibodies to human KLB was assessed via SPR, shown are rate constants for dissociation (koff) (C) and determined affinities (KD) (D) (mean?SEM, n=3).

(6) FIG. 6 Analysis of cellular activity via Luciferase gene reporter assay of optimized 16H7 variants with multiple mutations after thermal stressing. The listed antibodies were adjusted to 1 mg/mL with buffer at pH values of 5, 6, and 8 exchanged by dialysis and incubated for up to 21 days at 40? C. in an incubator. Control samples were kept at ?80? C. and samples after stress were also frozen to ?80? C. before further analyses. Subsequently biological activity of samples was analyzed with a Luciferase gene reporter assay assessing FGF21-like signaling. Shown are mean EC50 values?SEM, n=3-4.

(7) FIG. 7 Binding analysis of 16H7 and stabilized 16H7 variants to human KLB via SPR on a Biacore 8K instrument (GE Healthcare). For interaction analysis mAbs were captured via an anti-human Fc antibody immobilized on a series S CM5 sensor chip (human antibody capture kit, GE Healthcare). Human KLB (R&D Systems), diluted into HBS-EP+ buffer with 10% non-specific binding reducer (GE Healthcare), was injected in a 1:2 dilution series from 0.78 nmol/L to 12.5 nmol/L at a flow rate of 60 ?L/min. Binding kinetics data were evaluated with a 1:1 binding model using the Biacore 8K Evaluation Software version 1.1.1.7442 (GE Healthcare). Exemplary sensorgrams for the interaction of human KLB with (A) 16H7 wild type, (B) Ab0331, (C) Ab0335, (D) Ab0351, (E) Ab0428, (F) Ab0429, and (G) Ab0430.

(8) FIG. 8 Binding analysis of 16H7 and stabilized 16H7 variants to monkey KLB via SPR on a Biacore 8K instrument (GE Healthcare). For interaction analysis mAbs were captured via an anti-human Fc antibody immobilized on a series S CM5 sensor chip (human antibody capture kit, GE Healthcare). Cynomolgus monkey (Macaca fascicularis) KLB (R&D Systems), diluted into HBS-EP+ buffer with 10% non-specific binding reducer (GE Healthcare), was injected in a 1:2 dilution series from 0.78 nmol/L to 12.5 nmol/L at a flow rate of 60 ?L/min. Binding kinetics data were evaluated with a 1:1 binding model using the Biacore 8K Evaluation Software version 1.1.1.7442 (GE Healthcare). Exemplary sensorgrams for the interaction of monkey KLB with (A) 16H7 wild type, (B) Ab0331, (C) Ab0335, (D) Ab0351, (E) Ab0428, (F) Ab0429, and (G) Ab0430.

(9) FIG. 9 Cellular activity of 16H7 and optimized variants in primary human visceral and subcutaneous adipocytes was analyzed via In-Cell Western PERK. (A) Dose-response curves of ERK phosphorylation after a 5 minute stimulation with FGF21, 16H7, or variants in primary human visceral adipocytes and (B) subcutaneous adipocytes. Calculated EC50 values are shown as EC50 values mean?SEM, n=7 (C).

(10) FIG. 10 Analysis of cellular activity of 16H7 with various Fc backbones assessed via Luciferase gene reporter assay. Shown are EC50 values mean?SEM, n=10.

(11) FIG. 11 Analysis of cellular activity of the monoclonal antibody 16H7, its monovalent Fab fragment (antigen-binding fragment) and human FGF21 assessed via Luciferase gene reporter assay. Shown are exemplary dose-response curves, values are mean?SEM, n=4. In this cellular assay 16H7-Fab is inactive, the full monoclonal and bivalent antibody is necessary to show FGF21-like activity.

(12) FIG. 12 Pharmacokinetic analysis of anti-FGFR1c/KLB agonistic antibodies in transgenic humanized FcRn mice. (A) 0.3 mg/kg of antibodies in PBS solution with human IgG4 Fc backbone (Ab0314, Ab0331, Ab0335, Ab0351) or (B) with human IgG1 Fc backbone (Ab0428, Ab0429, Ab0430) were administered intravenously (IV) into female Tg32-h-FcRn mice and plasma concentration in circulation assessed over time. Shown are mean?SD plasma concentration values.

(13) FIG. 13 PK analysis of 16H7 at different dose levels in Cynomolgus monkeys. Plasma concentrations and pharmacokinetic parameters of 16H7 were investigated after single intravenous (IV) administration of 0.1, 0.3, and 1 mg/kg in PBS solution to female Cynomolgus monkeys. Shown are mean?SD plasma concentration values.

(14) FIG. 14 PK analysis of 16H7 variants in Cynomolgus monkeys. Plasma concentrations and pharmacokinetic parameters of 16H7 variants were investigated after single intravenous (IV) administration of 3 mg/kg in PBS solution to female Cynomolgus monkeys. (A) Mean?SD plasma concentration values of Ab0331, (B) Ab0335, and (C) Ab0429.

(15) FIG. 15 Body weight reduction in Cynomolgus monkeys after 3 subcutaneous administrations of 16H7 (Obs BW=observed body weight, Pred. BW=predicted body weight, Conc=concentration of 16H7 in circulation).

(16) FIG. 16 Effect on daily food intake of 16H7 at 1 mg/kg, Ab0335 at 1 mg/kg (low dose) and Ab0335 at 3 mg/kg (high dose) in cynomolgus monkeys (at day 80 DEXA scans were conducted and the strong reduction in food intake is due to the procedures.

(17) FIG. 17 Effect on daily total energy intake of 16H7 at 1 mg/kg, Ab0335 at 1 mg/kg (low dose) and Ab0335 at 3 mg/kg (high dose) in cynomolgus monkeys (at day 80 DEXA scans were conducted and the strong reduction in total energy intake is due to the procedures).

(18) FIG. 18 Effect on body weight and relative body weight change of 16H7 at 1 mg/kg, Ab0335 at 1 mg/kg (low dose) and Ab0335 at 3 mg/kg (high dose) in cynomolgus monkeys (at day 80 DEXA scans were conducted and the strong reduction in body weight/rel. body weight change is due to the procedures).

(19) FIG. 19 Effect on plasma triglyceride levels of 16H7 at 1 mg/kg, Ab0335 at 1 mg/kg (low dose) and Ab0335 at 3 mg/kg (high dose) in cynomolgus monkeys.

(20) FIG. 20 Exemplary fusion antibody (designated Fu0077, Table A4): Fu0077 comprises the GLP-peptide designated P014 (Table A3) as GLP-peptide compound which is fused to the N-terminal end of each light chain and each heavy chain of the antibody compound designated Ab0001 (Table A1) via a linker peptide. Ab0001 comprises the light chain of the antibody 16H7 (see FIG. 1) and the heavy chain of 16H7 in which the IgG2 backbone was replaced with the IgG1 LALA backbone (Table A2). The sequence of the GLP-peptide is underlined and italicized. The sequence of the linker peptide is indicated in bold. The sequence of the IgG1 LALA backbone in the heavy chain is italicized. Fu0077 comprises two heavy and two light chains. However, only one is depicted (Sequence of the light chain: see SEQ ID NO: 67, sequence of the heavy chain: see SEQ ID NO:68). Fu0077 therefore displays four GLP-peptide moieties per fusion molecule.

(21) FIG. 21 Schematic drawing of GLP-1 anti-FGFR1/KLB monoclonal antibody fusion proteins. GLP-1 receptor agonistic peptide sequences were cloned to the N-terminus of heavy and/or light chain to generate fusion proteins with dual agonism. The antibody fusion proteins display either two or four GLP-peptide compounds.

(22) FIG. 22 The figure shows the result of analyzing the cellular FGF21-like activity of 16H7 and GLP-1-16H7 fusion proteins under usage of an in vitro Luciferase gene reporter assay with HEK293 cells overexpressing human FGFR1c+KLB. (A) Exemplary dose-response curves from Luciferase gene reporter assay after stimulation with 16H7 or GLP-1-16H7 fusion proteins for 5 h. (B) Mean EC50 values and Emax values (C) measured via Luciferase gene reporter assay (mean?SEM, n=25-136).

(23) FIG. 23 FIG. 23A shows mean EC50 values of cellular FGF21-like activity measured via Luciferase gene reporter assay of GLP-1-16H7 fusion proteins with GLP-1 receptor agonist fused either to the N-terminus of the light or heavy chain of 16H7 or both (mean?SEM, n=34-37). (B) Schematic drawing showing the location of the GLP-1 part at the respective N-termini.

(24) FIG. 24 shows the influence of varying the Fc part of the GLP-1-mAb fusion proteins on FGF21-like activity measured via a Luciferase reporter gene assay. (A) Shown are mean EC50 values (mean?SEM, n=8-34). (B) Schematic drawing showing different IgG backbones and the location of the GLP-1 part at the respective N-termini.

(25) FIG. 25 shows results of analyzing the cellular GLP-1 receptor agonist activity of selected GLP-1RA sequences fused to either N-terminus of the heavy chain of 16H7, or to the N-terminus of the light chain of 16H7, or to both, on a mixed IgG backbones measured via HTRF CAMP assay using HEK293 cells overexpressing the human GLP-1R. Results for the natural peptide ligand GLP-1(7-36) are included. Shown are mean EC50 values as box and whisker plot, n=5-73.

(26) FIG. 26 Study design for treatment of non-human primates (Macaca fascicularis). Animals selected for study were obese and diabetic with NAS score >4.

(27) FIG. 27A-C Effect on daily total energy intake of vehicle, SAR10 (dulaglutide), dosed every 3.sup.rd day, SAR16 (Ab0004, 16H7)) dosed in week 1, 3, and 6, and in combination in cynomolgus monkeys. The black arrows indicate SAR16 dosing.

(28) FIG. 28A-F Effect on daily food intake of vehicle, SAR10 (dulaglutide), SAR16 (Ab0004), and the combination in cynomolgus monkeys split into breakfast, lunch and dinner.

(29) FIG. 29 Effect on daily food intake of vehicle, SAR10 (dulaglutide), SAR16 (Ab0004), and the combination in cynomolgus monkeys split into breakfast, lunch and dinner. For better visualization error bars are omitted.

(30) FIG. 30 Effect of vehicle, SAR10 (dulaglutide), SAR16 (Ab0004), and combination on body weight and relative body weight change in cynomolgus monkeys.

(31) FIG. 31 shows the fat mass change as assessed via Dual-Energy X-ray Absorptiometry (DEXA). Shown are the effects of vehicle, SAR10 (dulaglutide), SAR16 (Ab0004), and the combination on whole body composition in cynomolgus monkeys (baseline vs. day 92 of treatment, mean values?SEM).

(32) FIG. 32 shows the plasma glucose levels over time in cynomolgus monkeys during an iv glucose tolerance test (GTT) at baseline vs. day 92 of treatment with vehicle, SAR10 (dulaglutide), SAR16 (Ab0004), or the combination.

(33) FIG. 33 shows the plasma glucose levels over time in cynomolgus monkeys during an iv glucose tolerance test (GTT) at baseline vs. day 92 of treatment with vehicle, SAR10 (dulaglutide), SAR16 (Ab0004) or the combination.

(34) FIG. 34 shows the area under the curve (AUC) of ivGTT in cynomolgus monkeys at day 92 of treatment with vehicle, SAR10 (dulaglutide), SAR16 (Ab0004), or the combination.

(35) FIG. 35 shows the effects of vehicle, SAR10 (dulaglutide), SAR16 (Ab0004), and the combination on fasting plasma glucose levels of the cynomolgus monkeys over time.

(36) FIG. 36 shows the effects of vehicle, SAR10 (dulaglutide), SAR16 (Ab0004), and the combination on fasting triglyceride levels of the cynomolgus monkeys over time.

(37) FIG. 37 shows the effects of vehicle, SAR10 (dulaglutide), SAR16 (Ab0004), and the combination on fasting LDL-cholesterol levels of the cynomolgus monkeys over time.

(38) FIG. 38 shows the effects of vehicle, SAR10 (dulaglutide), SAR16 (Ab0004), and the combination on fasting VLDL-cholesterol levels of the cynomolgus monkeys over time.

DEFINITIONS

(39) The definitions provided herein below shall apply to the antigen-binding protein provided herein (see e.g. section A, or section B2) or the conjugate provided herein (see e.g. section B).

(40) The terms GLP-1R agonistic peptide, GLP-1R agonist, GLP-1 peptide and GLP peptide are used interchangeably herein. The terms refer to a peptide which binds to and activates the GLP-1 receptor, such as GLP-1 (as the primary GLP-1R agonist). In some embodiments, the GLP-1R agonistic peptide has a length of about 25 to 45 amino acids. The GLP-1R agonistic peptide has an amino acid sequence according to the general sequence of SEQ ID NO: 51, 52, 53, 54, 55, 59, 60, 61 or 62.

(41) Assays for assessing whether a compound activates the GLP-1 receptor are known in the art. For example, it can be assessed as described in the Examples section, e.g. in the section In vitro cellular assays for GLP-1, Glucagon and GIP receptor efficacy.

(42) An antigen binding protein is a protein comprising a portion that binds to an antigen as referred to herein. Optionally, the antigen binding protein comprises a scaffold or framework portion that allows the antigen binding portion to adopt a conformation that promotes binding of the antigen binding protein to the antigen.

(43) The antigen binding protein provided herein may be an isolated antigen-binding protein. An isolated antigen-binding protein, in some embodiments, is an antigen-binding protein which has been purified. Purification of an antigen-binding protein can be achieved by methods well-known in the art such as Size Exclusion Chromatography (SEC). Accordingly, the antigen-binding protein shall have been isolated from the cells in which the antigen-binding protein was produced. In some embodiments, an isolated antigen-binding protein is purified to greater than 70% by weight of antigen-binding protein as determined by, for example, the Lowry method, and in some embodiments, to greater than 80%, 90%, 95%, 96%, 97%, 98% or 99% by weight. In some embodiments, the term isolated antibody refers to an antibody that is mainly free of other antibodies having different antigenic specificities.

(44) An antibody may be a natural or conventional antibody in which two heavy chains are linked to each other by disulfide bonds and each heavy chain is linked to a light chain by a disulfide bond. In mammals, antibodies are classified into five main classes or isotypes, IgA, IgD, IgE, IgG and IgM. They are classed according to the heavy chain they contain, alpha, delta, epsilon, gamma or mu, respectively. These differ in the sequence and number of constant domains, hinge structure and the valency of the antibody. There are two types of light chain, lambda (I) and kappa (?) with kappa light chains being the more common of the two. Although these are relatively dissimilar in protein sequence they share a similar structure and function.

(45) The five main heavy chain classes (or isotypes) determine the functional activity of an antibody molecule: IgM, IgD, IgG, IgA and IgE. The heavy chain may be of any isotype. In some embodiments, the heavy chain is a IgG heavy chain. Each chain contains distinct sequence domains. IgG is the most abundant antibody in normal human serum, accounting for 70-85% of the total immunoglobulin pool. It is monomeric with a molecular weight of approximately 150 kDa, is the major antibody of the secondary immune response and has the longest half-life of the five immunoglobulin classes. IgG consists of four human subclasses (IgG1, IgG2, IgG3 and IgG4) each containing a different heavy chain. They are highly homologous and differ mainly in the hinge region and the extent to which they activate the host immune system. IgG1 and IgG4 contain two inter-chain disulphide bonds in the hinge region, IgG2 has 4 and IgG3 has 1.

(46) The heavy chain may comprise different Fc backbones. In some embodiments, the Fc backbone is a backbone selected from the backbones provided in Table A2 in the Examples section. Thus, the Fc backbone may comprise an amino acid sequence as shown in Table A2. In an embodiment, the Fc backbone is IgG4 PE. In another embodiment, the Fc backbone is IgG1 NNAS.

(47) The light chain includes two domains or regions, a variable domain (VL) and a constant domain (CL). The heavy chain includes four domains, a variable domain (VH) and three constant domains (CH1, CH2 and CH3, collectively referred to as CH). The variable regions of both light (VL) and heavy (VH) chains determine binding recognition and specificity to the antigen. The constant region domains of the light (CL) and heavy (CH) chains confer important biological properties such as antibody chain association, secretion, trans-placental mobility, complement binding, and binding to Fc receptors (FcR). The Fv fragment is the N-terminal part of the Fab fragment of an immunoglobulin and consists of the variable portions of one light chain and one heavy chain. The specificity of the antibody resides in the structural complementarity between the antibody combining site and the antigenic determinant. Antibody combining sites are made up of residues that are primarily from the hypervariable or complementarity determining regions (CDRs). Occasionally, residues from non-hypervariable or framework regions (FR) influence the overall domain structure and hence the combining site. The term Complementarity Determining Regions (abbreviated CDRs) refer to amino acid sequences which together define the binding affinity and specificity of the natural Fv region of a native immunoglobulin binding site. The light and heavy chains of an immunoglobulin each have three CDRs, designated CDR1-L, CDR2-L, CDR3-L (for Light Chain Complementary Determining Regions) or CDRL1, CDRL2, CDRL3 and CDR1-H, CDR2-H, CDR3-H (for Heavy Chain Complementary Determining Regions) or CDRH1, CDRH2, CDRH3, respectively. A conventional antibody antigen-binding site, therefore, includes six CDRs, comprising the CDR set from each of a heavy and a light chain variable region.

(48) Framework Regions (FRs) refer to amino acid sequences interposed between CDRs, i.e. to those portions of immunoglobulin light and heavy chain variable regions that are relatively conserved among different immunoglobulins in a single species. The light and heavy chains of an immunoglobulin each have four FRs, designated FR1-L, FR2-L, FR3-L, FR4-L, and FR1-H, FR2-H, FR3-H, FR4-H, respectively.

(49) From N-terminal to C-terminal, light chain variable region and heavy chain variable region both typically have the following order of these elements: FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.

(50) Numbering systems have been established for assigning numbers to amino acids that occupy positions in each of above domains. Complementarity determining regions and framework regions of a given antibody can be identified using the system described by Kabat et al., in Sequences of Proteins of Immunological Interest, 5th Ed., US Dept. of Health and Human Services, PHS, NIH, NIH Publication no. 91-3242, 1991. In one embodiment, CDR and FR sequences are given herein according to the system described by Kabat. However, the CDRs can also be redefined according to an alternative nomenclature scheme based on IMGT definition (Lefranc, M. P. et al., 2003, Dev Comp Immunol. 27(1): 55-77).

(51) As used herein, a human framework region is a framework region that is substantially identical (about 85%, or more, in particular 90%, 95%, 97%, 99% or 100%) to the framework region of a naturally occurring human antibody.

(52) In some embodiments, the term antibody refers to conventional or full-length antibodies (i.e. antibodies comprising two heavy chains and two light chains).

(53) The antigen binding protein may comprise variants of the six CDRs as referred to herein. The term differing by not more than a total of three amino acid additions, substitutions, and/or deletions from said CDR, such as the heavy chain CDR1, means that the variant differs from said CDR by at most three amino acid additions, substitutions, and/or deletions, i.e. differs by only one, two, or three amino acid additions, substitutions, and/or deletions.

(54) The term antigen refers to a molecule capable of being bound by the antigen binding protein provided herein. In one embodiment, the antigen is (i) beta-Klotho (KLB) and/or (ii) a complex comprising beta-Klotho and one of FGFR1c, FGFR2c, FGFR3c, and FGFR4. Thus, the antigen binding protein provided herein shall bind (i) beta-Klotho and/or (ii) a complex comprising beta-Klotho and one of FGFR1c, FGFR2c, FGFR3c, and FGFR4. In some embodiments, the antigen binding protein provided herein shall bind (i) beta-Klotho and/or (ii) a complex comprising beta-Klotho and FGFR1c. In one embodiment, the antigen binding protein provided herein binds the extracellular domain of beta-Klotho (KLB).

(55) The terms beta-Klotho, ?-Klotho and KLB are used interchangeably herein.

(56) In some embodiments, the beta-Klotho, FGFR1c, FGFR2c, FGFR3c, and FGFR4 proteins are human proteins. The amino acid sequences of the human proteins are well known in the art. For example, the amino acid sequence of human beta-Klotho and FGFR1c can be accessed via GenBank (for beta-Klotho: see NP_783864.1; for FGFR1c: see NP_001167534.1).

(57) In some embodiments, the beta-Klotho, FGFR1c, FGFR2c, FGFR3c, and FGFR4 proteins are non-human primate proteins, such as protein from cynomolgus monkey (Macaca fascicularis).

(58) In one embodiment, the antigen binding protein is a bivalent antigen binding protein, such as bivalent antibody, or a bivalent antigen-binding fragment of said antibody. A bivalent antigen binding protein, bivalent antibody, or bivalent antigen-binding fragment comprises two antigen binding sites. In one embodiment, the two binding sites may have the same antigen specificities and, thus, may be a monospecific antigen binding protein (or fragment thereof). Accordingly, the two binding sites shall bind the same antigen, i.e. (i) beta-Klotho (KLB) and/or (ii) a complex comprising beta-Klotho and one of FGFR1c, FGFR2c, FGFR3c, and FGFR4. In an embodiment, they bind beta-Klotho.

(59) In an embodiment, the two antigen binding sites bind the same epitope within the antigen. In another embodiment, the two antigen binding sites bind different epitopes within the antigen.

(60) In an embodiment, the antigen binding protein, or fragment thereof, comprises two light chain variable regions with identical CDRs and two heavy chain variable regions with identical CDRs. For example, antigen binding protein, or fragment thereof, may comprise two identical light chain variable regions and two identical heavy chain variable regions.

(61) In some embodiments, the bivalent antigen-binding fragment comprises two Fab fragments. Each of the two fragments shall bind the antigen. Further, the fragments shall be linked to each other. In the embodiments, the fragment is a F(ab)2 fragment. A F(ab)2 fragment is a bivalent fragment having two Fab fragments linked by a disulfide bridge at the hinge region.

(62) In an embodiment, the antigen binding protein is a diabody. A diabody is a bivalent antibody which comprises two polypeptide chains. Each polypeptide chain comprises the variable heavy domains and variable light domains joined by a linker. In an embodiment, the two polypeptide chains of a diabody are identical. In an alternative embodiment, the two polypeptide chains have different amino acid sequences, provided that the two chains bind the same antigen (either the same epitope or different epitopes within the same antigen).

(63) The antigen-binding protein, or fragment thereof, shall activate the cell-surface receptor complex comprising ?-Klotho and FGFR1c. Thus, it shall act as an agonist. Whether an antigen-binding protein, or fragment thereof, activates the cell-surface receptor complex comprising ?-Klotho and FGFR1c can be determined by well-known methods. For example, it can be assessed as described in the Materials and Methods section Luciferase reporter gene assay. In one embodiment, activation of the cell-surface receptor complex comprising ?-Klotho and FGFR1c is determined by measuring FGF21 receptor autophosphorylation and/or phosphorylation of MAPK ERK1/2 upon contact with the antigen-binding protein provided herein in vitro.

(64) A substitution of an amino acid residue, such as of an amino acid residue which is associated with reduced stability, refers to the replacement of said amino acid residue with a different amino acid residue, such as with a different naturally occurring amino acid residue. When used in connection with amino acids, the term naturally occurring refers to the 20 conventional amino acids (i.e., alanine (Ala or A), cysteine (Cys or C), aspartic acid (Asp or D), glutamic acid (Glu or E), phenylalanine (Phe or F), glycine (Gly or G), histidine (His or H), isoleucine (Ile or I), lysine (Lys or K), leucine (Leu or L), methionine (Met or M), asparagine (Asn or N), proline (Pro or P), glutamine (Gln or Q), arginine (Arg or R), serine (Ser or S), threonine (Thr or T), valine (Val or V), tryptophan (Trp or W), and tyrosine (Tyr or Y)).

(65) In some embodiments, an amino acid residue as referred to herein, such as of an amino acid residue which is associated with reduced stability, is not substituted with the following amino acids cysteine (Cys or C), aspartic acid (Asp or D), methionine (Met or M) and asparagine (Asn or N).

(66) In one embodiment, the substitution (or substitutions) is a conservative amino acid substitution (are conservative substitutions). Such a substitution is a substitution of an amino acid with an amino acid of the same family of amino acids, i.e. an amino acid which is related in its side chain (e.g., in terms of the electrical charge and/or size). Naturally occurring amino acids are generally divided into four families: acidic (aspartate, glutamate); basic (lysine, arginine, histidine); non-polar (alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan); and uncharged polar (glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine).

(67) Phenylalanine, tryptophan, and tyrosine are sometimes classified jointly as aromatic amino acids.

(68) With respect the antigen-binding protein, the position of an amino acid is indicated herein by referring to the chain, i.e. either the heavy chain, or the light chain, and the position of the amino acid residue in the heavy chain or the light chain. Antibody 16H7 is used as reference antibody.

(69) The amino acid sequence of 16H7 is shown in FIG. 1. The heavy chain of 16H7 has an amino acid sequence as shown in SEQ ID NO: 1, the light chain of 16H7 has an amino acid sequence as shown in SEQ ID NO: 2. Thus, the position a given amino acid residue corresponds to the position of the in the heavy chain of 16H7 (as represented by SEQ ID NO: 1) and the light chain of 16H7 (as represented by SEQ ID NO: 2), respectively. In one embodiment, a capital letter preceding the number for the position indicates the amino acid present at this position in 16H7. The one letter code is applied. For example, D91 in the light chain means that 16H7 comprises an aspartic acid at this position. A capital letter following the number for the position means indicates the amino acid used for substitution. For example, D91E in the light chain means that the amino acid residue D at position 91 of the light chain has been substituted with an E.

(70) Alternatively, the amino acid residues are defined using the following nomenclature: X.sub.LC-Number (such as X.sub.LC93), and X.sub.HC-Number (such as X.sub.HC31),
wherein the subscript LC-Number indicates the corresponding position in the light chain of 16H7, and wherein the subscript HC-Number indicates the corresponding position in the heavy chain of 16H7. It is to be understood that the defined amino acid residue might have a different position within the mutated antigen-binding protein.

(71) The definitions given in the specification and the sequence listing for amino acid residues indicated with X, such as the definitions for X.sub.HC34, X.sub.HC35, X.sub.HC54, X.sub.HC58, X.sub.HC60, X.sub.HC102, X.sub.HC104, X.sub.HC108, X.sub.HC109, X.sub.LC25, X.sub.LC49, X.sub.LC50, X.sub.LC91, X.sub.LC93 and X.sub.LC95, In one embodiment, apply to all CDRs, light chain variable domains, heavy chain variable domains, full light chains and full heavy chains comprising these amino acid residues.

(72) With respect GLP-1R agonistic peptides, the position of an amino acid is indicated herein by referring to the position of the amino acid residue in the peptide (Examples: X.sub.1, X.sub.10 or X.sub.12). Amino acids within a GLP-1R agonistic peptide do not contain the subscript LC and HC.

(73) The term conjugate, as used herein, refers to a compound comprising an antigen-binding protein, or antigen-binding fragment thereof, which binds ?-Klotho and/or a complex comprising ?-Klotho and FGFR1c, wherein the antigen-binding protein, or antigen-binding fragment thereof, is linked to (i.e. conjugated to) at least one agonistic GLP-1 peptide by a suitable bond. In one embodiment, a suitable bond is a covalent bond.

(74) The antigen binding protein and the least one agonistic GLP-1 peptide may be linked via one or more suitable linker molecules, e.g., a linker peptide or a non-peptidic polymer, such as PEG.

(75) In an embodiment, the conjugate is a fusion of the antigen-binding protein, or antigen-binding fragment thereof, and the least one agonistic GLP-1 peptide. Thus, the antigen-binding protein, or antigen-binding fragment thereof, is linked to the at least one GLP-1 peptide by peptide bonds allowing recombinant expression.

(76) In some embodiments, the antigen binding protein or antigen-binding fragment thereof is conjugated to the at least one GLP-1 peptide via a linker. In one embodiment, the linker is linker peptide.

(77) A linker peptide, typically has a length of at least two amino acids. In one embodiment, it has a length of at least 5 amino acids. In another embodiment, it has a length of at least 10 amino acids. In another embodiment, it has a length of at least 15 amino acids. In another embodiment, it has a length of at least 20 amino acids. For example, the linker may have a length of 2 to 50 amino acids, or about 5 to about 30 amino acids, or 10 to 25 amino acids.

(78) The linker peptide may be a glycine-serine-rich linker. For example, at least 50%, at least 60%, at least 70%, at least 80%, at least 85% of the amino acids are glycine or serine residues, respectively. In another embodiment, the amino acids are selected from glycine and serine, i.e., the peptide linker is exclusively composed of glycine and serine (referred to as a glycine-serine linker). In one embodiment, the peptide linker further comprises an alanine residue at its C-terminus.

(79) The antigen-binding protein, or fragment thereof, may be conjugated, fused to at least GLP-1R (Glucagon-Like Peptide-1 Receptor) agonistic peptide. Accordingly, the conjugate provided herein may comprise one or more than one GLP-1R agonistic peptide, such as two, three, four, five, six, seven, eight, nine or ten one GLP-1R agonistic peptide.

(80) Percent (%) amino acid sequence identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. In one embodiment, standard parameters are applied for determining the degree of sequence identity of two sequences. In some embodiments, the degree of sequence identity is calculated over the whole length of the two sequences. In some embodiments, the degree of identity is to be determined by comparing two optimally aligned sequences over a comparison window, where the fragment of amino acid sequence in the comparison window may comprise additions or deletions (e.g., gaps or overhangs) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment. The percentage is calculated by determining the number of positions at which the identical amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity. Optimal alignment of sequences for comparison may be conducted by the local homology algorithm of Smith and Waterman Add. APL. Math. 2:482 (1981), by the homology alignment algorithm of Needleman and Wunsch J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson and Lipman Proc. Natl. Acad. Sci. (USA) 85: 2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, BLAST, PASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group (GCG), 575 Science Dr., Madison, WI), or by visual inspection. Given that two sequences have been identified for comparison, GAP and BESTFIT are typically employed to determine their optimal alignment and, thus, the degree of identity. In one embodiment, the default values of 5.00 for gap weight and 0.30 for gap weight length are used. In an embodiment, the percent identity between two amino acid sequences is determined using the Needleman and Wunsch algorithm (Needleman 1970, J. Mol. Biol. (48):444-453) which has been incorporated into the needle program in the EMBOSS software package (EMBOSS: The European Molecular Biology Open Software Suite, Rice, P., Longden, I., and Bleasby, A., Trends in Genetics 16(6), 276-277, 2000), a BLOSUM62 scoring matrix, and a gap opening penalty of 10 and a gap extension penalty of 0.5. A preferred, non-limiting example of parameters to be used for aligning two amino acid sequences using the needle program are the default parameters, including the EBLOSUM62 scoring matrix, a gap opening penalty of 10 and a gap extension penalty of 0.5.

(81) The term at least 80% identical with respect to two sequences means that the two sequences have 80% sequence identity or more. In some embodiments, the sequences are at least 85% or 87% identical. In some embodiments, the sequences are at least 90% identical. In some embodiments, the sequences are at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical. In some embodiments, the sequences are identical, i.e. 100% identical.

(82) The term cell or host cell, as used herein, refers to an intact cell, i.e., a cell with an intact membrane that has not released its normal intracellular components such as enzymes, organelles, or genetic material. In certain exemplary embodiments, an intact cell is a viable cell, i.e., a living cell capable of carrying out its normal metabolic functions. In certain exemplary embodiments, a cell or a host cell is any cell which can be transfected or transformed with an exogenous nucleic acid. In certain exemplary embodiments, the cell, when transfected or transformed with an exogenous nucleic acid and transferred to a recipient, can express the nucleic acid in the recipient.

(83) The term cell includes prokaryotic cells, such as bacterial cells, and eukaryotic cells, such as yeast cells, fungal cells or mammalian cells. Suitable bacterial cells include, but are not limited to, cells from gram-negative bacterial strains, such as strains of Escherichia coli, Proteus, and Pseudomonas, and gram-positive bacterial strains, such as strains of Bacillus, Streptomyces, Staphylococcus, and Lactococcus. Suitable fungal cells include, but are not limited to, cells from the species of Trichoderma, Neurospora, and Aspergillus. Suitable yeast cells include, but are not limited to, cells from the species of Saccharomyces (for example, Saccharomyces cerevisiae), Schizosaccharomyces (for example, Schizosaccharomyces pombe), Pichia (for example, Pichia pastoris and Pichia methanolica), and Hansenula. Suitable mammalian cells include, but are not limited to, for example, CHO (Chinese Hamster Ovary) cells, BHK cells, HeLa cells, COS cells, HEK-293 and the like. In one embodiment, HEK-293 cells are used. In another embodiment, CHO cells are used. However, amphibian cells, insect cells, plant cells, and any other cells used in the art for the expression of heterologous proteins can be used as well. In certain exemplary embodiments, mammalian cells (e.g., cells from humans, mice, hamsters, pigs, goats, or primates) are used for adoptive transfer.

(84) In some embodiments, the host cell comprises the polynucleotide encoding the antigen-binding protein provided herein, and/or vector comprising said polynucleotide. In one embodiment, said vector is an expression vector.

(85) A cell or host cell may be isolated or part of a tissue or organism, such as a non-human organism. The term non-human organism, as used herein, is meant to include non-human primates or other animals, e.g., mammals, such as cows, horses, pigs, sheep, goats, dogs, cats, rabbits or rodents (e.g., mice, rats, guinea pigs and hamsters). In some embodiment, the non-human organism is a cynomolgus monkey.

(86) A pharmaceutical composition as set forth herein typically comprises the antigen-binding protein provided herein together with a pharmaceutically acceptable carrier and/or a pharmaceutically acceptable excipient. The term pharmaceutically acceptable, as used herein, refers to the non-toxicity of a material which, in certain exemplary embodiments, does not interact with the action of the active agent of the pharmaceutical composition, i.e. the antigen-binding protein.

(87) The term carrier, as used herein, refers to an organic or inorganic component, of a natural or synthetic nature, in which the active component is combined in order to facilitate, enhance or enable application. In one embodiment, the term carrier also includes one or more compatible solid or liquid fillers, diluents or encapsulating substances, which are suitable for administration to a subject.

(88) Suitable carrier substances for parenteral administration include, but are not limited to, sterile water, Ringer's solution, Lactated Ringer's solution, physiological saline, bacteriostatic saline (e.g., saline containing 0.9% benzyl alcohol), phosphate-buffered saline (PBS), Hank's solution, polyalkylene glycols, hydrogenated naphthalenes and, in particular, biocompatible lactide polymers, lactide/glycolide copolymers or polyoxyethylene/polyoxy-propylene copolymers.

(89) The term excipient, as used herein, is intended to include all substances which may be present in a pharmaceutical composition and which are not active ingredients, such as salts, binders (e.g., lactose, dextrose, sucrose, trehalose, sorbitol, mannitol), fillers, lubricants, thickeners, surface active agents, preservatives, emulsifiers, buffer substances, flavoring agents, or colorants.

(90) The form of the pharmaceutical composition, the route of administration, the dosage and the regimen naturally depend upon the condition to be treated, the severity of the illness, the age, weight, and gender of the patient, etc.

(91) The pharmaceutical composition can be formulated for a topical, oral, parenteral, intranasal, intravenous, intramuscular, subcutaneous or intraocular administration and the like. In some embodiments, the composition is formulated for intravenous administration. In some embodiments, the composition is formulated for subcutaneous administration.

(92) In some embodiments, the pharmaceutical compositions contain vehicles which are pharmaceutically acceptable for a formulation capable of being administered parenterally, such as intravenously or subcutaneously. These may be in particular isotonic, sterile, saline solutions (monosodium or disodium phosphate, sodium, potassium, calcium or magnesium chloride and the like or mixtures of such salts), or dry, especially freeze-dried compositions which upon addition, depending on the case, of sterilized water or physiological saline, permit the constitution of injectable solutions.

(93) The antigen binding protein and composition described herein may be administered via any conventional route, e.g., orally, pulmonary administration, by inhalation or parenterally, including by injection or infusion. In some embodiments, parenteral administration is used, such as intravenous, intraarterial, subcutaneous, intradermal or intramuscular administration. In some embodiments, the antigen binding protein or composition provided herein is administered intravenously. In some embodiments, the antigen binding protein and composition is administered intravenously.

(94) The antigen binding protein and composition described herein are usually administered in therapeutically effective amounts. The term therapeutically effective amount is understood by the skilled person. In some embodiments, the term refers to an amount which achieves a desired therapeutic reaction or a desired therapeutic effect alone or together with further doses, optionally without causing or only minimally causing unacceptable or unwanted side-effects.

(95) The terms subject and patient are used interchangeably herein. The subject or patient may be a vertebrate. The term includes both humans and other animals, particularly mammals, and other organisms. Accordingly, herein the subject may be an animal such as a mouse, rat, hamster, rabbit, guinea pig, ferret, cat, dog, chicken, sheep, bovine species, horse, camel, or primate. In some embodiments, the subject is a mammal. In some embodiments, the subject is a primate. In some embodiments, the subject is human. In some embodiments, the subject is 16 years old, or older.

(96) In some embodiments, the subject is suffering from a disease or disorder as referred to herein. For example, the subject may be an obese subject. In some embodiments, the patient is at risk of suffering from a disease or disorder as referred to herein.

(97) In one embodiment, the term disease or disorder refers to any pathological or unhealthy state which can be treated by administering the antigen binding protein, or the pharmaceutical composition provided herein. In particular obesity, being overweight, metabolic syndrome, diabetes mellitus, diabetic retinopathy, hyperglycemia, dyslipidemia, NASH and/or atherosclerosis.

(98) The term obesity, as used herein, refers to a medical condition in which excess body fat has accumulated to the extent that it may have a negative effect on health. In terms of a human (adult) subject, obesity can be defined as a body mass index (BMI) greater than or equal to 30 kg/m.sup.2 (BMI?30 kg/m.sup.2). In some embodiments, obesity can be defined as a body mass index (BMI) greater than or equal to 35 kg/m.sup.2. In some embodiments, obesity can be defined as a body mass index (BMI) greater than or equal to 40 kg/m.sup.2. Thus, the subject may have a BMI of greater than or equal to 30 kg/m.sup.2, such as greater than or equal to 35, such as greater than or equal to 40 kg/m.sup.2.

(99) The BMI is a simple index of weight-for-height that is commonly used to classify overweight and obesity in adults. It is defined as a person's weight in kilograms divided by the square of his/her height in meters (kg/m.sup.2).

(100) The phrase being overweight or overweight, as used herein, refers to a medical condition in which the amount of body fat is higher than is optimally healthy. In terms of a human (adult) subject, being overweight or overweight can be defined as a body mass index (BMI) greater than or equal to 25 kg/m.sup.2 (e.g., 25 kg/m.sup.2?BMI<30 kg/m.sup.2). In an embodiment, the term can be defined as a body mass index (BMI) greater than or equal to 27 kg/m.sup.2 (e.g., 27 kg/m.sup.2?BMI<30 kg/m.sup.2).

(101) In an embodiment, the patient who is overweight/obese suffers from at least one weight-related comorbid condition, such as hypertension, type 2 diabetes mellitus, or dyslipidemia.

(102) The term metabolic syndrome, as used herein, typically refers to a clustering of at least three of the following medical conditions: abdominal (central) obesity (e.g., defined as waist circumference ?94 cm for Europid men and ?80 cm for Europid women, with ethnicity specific values for other groups), elevated blood pressure (e.g., 130/85 mmHg or higher), elevated fasting plasma glucose (e.g., at least 100 mg/dL), high serum triglycerides (e.g., at least 150 mg/dL), and low high-density lipoprotein (HDL) levels (e.g., less than 40 mg/dl for males and less than 50 mg/dl for females).

(103) Diabetes mellitus (also simply referred to as diabetes), as used herein, refers to a group of metabolic diseases characterized by high levels of blood glucose resulting from defects in insulin production, insulin action, or both. In one embodiment, diabetes mellitus is selected from the group consisting of type 1 diabetes mellitus, type 2 diabetes mellitus, gestational diabetes mellitus. The current WHO diagnostic criteria for diabetes mellitus are as follows: fasting plasma glucose ?7.0 mmol/l (126 mg/dL) or 2-hour plasma glucose ?11.1 mmol/l (200 mg/dL).

(104) In some embodiments, diabetes is type 1 diabetes mellitus. Type 1 diabetes mellitus as used herein, is a condition characterized by high blood glucose levels caused by total lack of insulin. This occurs when the body's immune system attacks the insulin producing beta cells in the pancreas and destroys them. The pancreas then produces little or no insulin. Pancreatic removal or disease may also lead to loss of insulin-producing beta cells. Type 1 diabetes mellitus accounts for between 5% and 10% of cases of diabetes.

(105) In some embodiments, diabetes is type 2 diabetes mellitus. Type 2 diabetes mellitus as used herein, is a condition characterized by excess glucose production in spite of the availability of insulin, and circulating glucose levels remain excessively high as a result of inadequate glucose clearance (insulin action).

(106) In some embodiments, diabetes is gestational diabetes. Gestational diabetes, as used herein, is a condition in which women without previously diagnosed diabetes exhibit high blood glucose levels during pregnancy (especially during the third trimester). Gestational diabetes affects 3-10% of pregnancies, depending on the population studied.

(107) Diabetic retinopathy, as used herein, is an ocular disease induced by the metabolic disarrangements occurring in diabetic patients and leads to progressive loss of vision.

(108) The term hyperglycemia, as used herein, refers to an excess of sugar (glucose) in the blood.

(109) The term dyslipidemia, as used herein, refers to a disorder of lipoprotein metabolism, including lipoprotein overproduction (hyperlipidemia) or deficiency (hypolipidemia). Dyslipidemias may be manifested by elevation of the total cholesterol, low-density lipoprotein (LDL) cholesterol and/or triglyceride concentrations, and/or a decrease in high-density lipoprotein (HDL) cholesterol concentration in the blood.

(110) Non-Alcoholic Steatohepatitis (NASH), as used herein, refers to a liver disease characterized by an accumulation of fat (lipid droplets), along with inflammation and degeneration of hepatocytes. Once initiated, the disease is accompanied with a high risk of cirrhosis, a state wherein liver functions are altered that can progress to liver insufficiency. Thereafter, NASH often progresses to liver cancer.

(111) Atherosclerosis, as used herein, refers to a vascular disease characterized by irregularly distributed lipid deposits called plaque in the intima of large and medium-sized arteries that may cause narrowing of arterial lumens and proceed to fibrosis and calcification. Lesions are usually focal and progress slowly and intermittently. Occasionally, plaque rupture occurs leading to obstruction of blood flow resulting in tissue death distal to the obstruction. Limitation of blood flow accounts for most clinical manifestations, which vary with the distribution and severity of the obstruction.

(112) The term treating or treatment, as used herein, refers to the administration of a compound or composition or a combination of compounds or compositions to a subject in order to: prevent, ameliorate, or eliminate a disease and/or disorder as referred to herein, such as obesity, in a subject. Thus, the term encompasses both the treatment of an existing disease or disorder as referred to herein, or prevention of disease or disorder, i.e. prophylaxis. It will therefore be recognized that treatment as referred to herein may, in some embodiments, be prophylactic. In some embodiments, the term refers to the treatment of an existing disease or disorder as referred to herein. Thus, the subject is suffering from said disease or disorder.

DETAILED DESCRIPTION OF THE PRESENT INVENTION

(113) Provided herein are agonistic monoclonal antibodies which bind to the FGFR1/KLB receptor complex and which have improved stability. The provided antibodies are described in Section A.

(114) Further provided herein are conjugates comprising an FGFR1/KLB agonistic antigen-binding protein and at least one GLP-1R agonistic peptide. The provided conjugates are described in Section B.

(115) The provided antibody described in Section A might be also comprised by the conjugate described in section B (as FGFR1/KLB agonistic antigen-binding protein).

(116) Section A) Agonistic Monoclonal Antibodies which Bind to the FGFR1/KLB Receptor Complex and which have Improved Stability

(117) Provided herein is an antigen binding protein having improved physico-chemical properties, such as an increased stability, as compared to the monoclonal antibody 16H7. The antigen binding protein shall comprise i) light chain CDRs 1, 2 and 3 and heavy chain CDRs 1, 2 and 3 as defined herein, a light chain and a heavy chain variable region as defined herein, and/or a light and heavy chain as defined herein.

(118) Specifically, the antigen binding protein provided herein shall comprise at least one amino acid substitution as compared to 16H7. In one embodiment, at least amino acid residue of 16H7 which is associated with reduced stability is replaced by another amino acid residue, such as an naturally occurring amino acid residue. In some embodiments, the at least one amino acid residue of 16H7 which is associated with reduced stability is selected from group consisting of M34 of the heavy chain, D109 of the heavy chain, N25 of the light chain, D49 of the light chain, D50 of the light chain, D91 of the light chain and N93 of the light chain of 16H7. In some embodiments, two, three, four, five, or six the aforementioned amino acid residues are substituted. In some embodiments, all of the aforementioned amino acid residues are substituted.

(119) The antigen binding protein provided herein may also comprise variant CDRs of the respective light chain CDRs 1, 2 and 3 and heavy chain CDRs 1, 2 and 3. In some embodiments, said variants differ by not more than a total of five amino acid additions, substitutions, and/or deletions from the respective CDR. In some embodiments, said variants differ by not more than a total of four amino acid additions, substitutions, and/or deletions from the respective CDR. In some embodiments, said variants differ by not more than a total of three amino acid additions, substitutions, and/or deletions from the respective CDR. In some embodiments, said variants differ by not more than a total of two amino acid additions, substitutions, and/or deletions from the respective CDR. In some embodiments, said variants differ by not more than a total of one amino acid addition, substitution, and/or deletion from the respective CDR.

(120) In some embodiments, the mutations are substitutions. Thus, the variants differ by not more than a total of five, four, three, two, or one amino acid substitution(s) from the respective CDR. Based on the results shown in Tables D1 and D2 in the Examples section, the skilled person is enabled to select suitable substitutions.

(121) However, it is envisaged that the amino acid residues G35, F54, E58, S60, G104 and Y108 in the heavy chain and D95 in the light chain of 16H7 are not mutated. Accordingly, it is envisaged that the antigen binding protein provided herein comprises amino acid residues corresponding to amino acid residues G35, F54, E58, S60, G104 and Y108 in the heavy chain, and amino acid residue D95 in the light chain of 16H7. Thus, the aforementioned amino acid residues should not be mutated, i.e. they should not be substituted or deleted.

(122) In some embodiments, the amino acid residue 183 present in the heavy chain of 16H7 is substituted with a different amino acid, such as a T (183T substitution)

(123) In one embodiment, the antigen binding protein provided herein comprises a) a heavy chain CDR1, b) a heavy chain CDR2, c) a heavy chain CDR3, d) a light chain CDR1, e) a light chain CDR2 and f) a light chain CDR3.

(124) The CDRs are defined in the section Summary of the present invention above and herein below.

(125) In one embodiment, the heavy chain CDR1 comprises a1) NARX.sub.HC34X.sub.HC35VS (SEQ ID NO: 3), wherein X.sub.HC34 is M, V, F, N, Y, P, S, Q, H, G, D, I, L, R, W, or T, and wherein X.sub.HC35 is G, or a2) a variant of the heavy chain CDR1 of a1) which differs by not more than a total of five, four or three amino acid additions, substitutions, and/or deletions from said heavy chain CDR1 with the proviso that the amino acid residues at positions X.sub.HC34 and X.sub.HC35 are not substituted or deleted.

(126) In one embodiment, the heavy chain CDR2 comprises b1) HIX.sub.HC54SNDX.sub.HC58KX.sub.HC60 YSTSLKS (SEQ ID NO: 6), wherein X.sub.HC54 is F, wherein X.sub.HC58 is E, and wherein X.sub.HC60 is S, or b2) a variant of the heavy chain CDR2 of b1) which differs by not more than a total of five, four or three amino acid additions, substitutions, and/or deletions from said heavy chain CDR2, with the proviso that the amino acid residues at positions X.sub.HC54, X.sub.HC58, and X.sub.HC60 are not substituted or deleted.

(127) In one embodiment, the heavy chain CDR3 comprises c1) SVX.sub.HC102 TX.sub.HC104GYYX.sub.HC108X.sub.HC109GMDV (SEQ ID NO: 8), wherein X.sub.HC109 is D, E, V, Y, T, F, N, W, L, Q, G, I, M, R, K, or H, X.sub.HC102 is V, X.sub.HC104 is G and X.sub.HC108 is Y, or c2) a variant of the heavy chain CDR3 of c1) which differs by not more than a total of five, four or three amino acid additions, substitutions, and/or deletions from said heavy chain CDR3, with the proviso that the amino acid residues at positions X.sub.HC109, X.sub.HC102, X.sub.HC104 and X.sub.HC108 are not substituted or deleted.

(128) In one embodiment, the light chain CDR1 comprises d1) GGX.sub.LC25NIGSESVH (SEQ ID NO: 11), wherein X.sub.LC25 is N, S, E, G, K, R, T, Y, F, I, A, L, V, H, Q, W, P, or M, or d2) a variant of the light chain CDR1 of d1) which differs by not more than a total of five, four or three amino acid additions, substitutions, and/or deletions from said light chain CDR1 with the proviso that the amino acid residue at position X.sub.LC25 is not substituted or deleted.

(129) In one embodiment, the light chain CDR2 comprises e1) X.sub.LC49X.sub.LC50SDRPS (SEQ ID NO: 14), wherein X.sub.LC49 is D, S, E, H, N, Y, T, A, F, V, K, L, M, G, R, W, P, or I, and X.sub.LC50 is D, E, A, S, Q, G, P, V, W, L, T, I, M, H, R, K, F, or Y, or e2) a variant of the light chain CDR2 of e1) which differs by not more than a total of five, four or three amino acid additions, substitutions, and/or deletions from said light chain CDR2 with the proviso that the amino acid residues at positions X.sub.LC49 and X.sub.LC50 are not substituted or deleted.

(130) In one embodiment, the light chain light chain CDR3 comprising f1) QVWX.sub.LC91GX.sub.LC93SX.sub.LC95HVV (SEQ ID NO: 19), wherein X.sub.LC91 is D, E, Q, W, M, R, G, L, H, N, T, F, I, V, S, A, or K, X.sub.LC93 is N, E, I, L, M, G, W, P, R, D, Y, A, S, V, T or F, and X.sub.LC95 is D, or f2) a variant of the light chain CDR3 of f1) which differs by not more than a total of five, four or three amino acid additions, substitutions, and/or deletions from said light chain CDR3 with the proviso that the amino acid residues at positions X.sub.LC91, X.sub.LC93 and X.sub.LC95 are not substituted or deleted.

(131) In some embodiments, the antigen binding protein provided herein comprises a) a heavy chain CDR1 comprising NARX.sub.HC34X.sub.HC35VS (SEQ ID NO: 3), wherein X.sub.HC34 is M, V, F, N, Y, P, S, Q, H, G, D, I, L, R, W, or T, and wherein X.sub.HC35 is G, b) a heavy chain CDR2 comprising HIX.sub.HC54SNDX.sub.HC58KX.sub.HC60 YSTSLKS (SEQ ID NO: 6), wherein X.sub.HC54 is F, wherein X.sub.HC58 is E, and wherein X.sub.HC60 is S, c) a heavy chain CDR3 comprising SVX.sub.HC102 TX.sub.HC104GYYX.sub.HC108X.sub.HC109GMDV (SEQ ID NO: 8), wherein X.sub.HC109 is D, E, V, Y, T, F, N, W, L, Q, G, I, M, R, K, or H, X.sub.HC102 is V, X.sub.HC104 IS G and X.sub.HC108 is Y, d) a light chain CDR1 comprising GGX.sub.LC25NIGSESVH (SEQ ID NO: 11), wherein X.sub.LC25 is N, S, E, G, K, R, T, Y, F, I, A, L, V, H, Q, W, P, or M, e) a light chain CDR2 comprising X.sub.LC49X.sub.LC50SDRPS (SEQ ID NO: 14), wherein X.sub.LC49 is D, S, E, H, N, Y, T, A, F, V, K, L, M, G, R, W, P, or I, and X.sub.LC50 is D, E, A, S, Q, G, P, V, W, L, T, I, M, H, R, K, F, or Y, and/or f) a light chain CDR3 comprising QVWX.sub.LC91GX.sub.LC93SX.sub.LC95HVV (SEQ ID NO: 19), wherein X.sub.LC91 is D, E, Q, W, M, R, G, L, H, N, T, F, I, V, S, A, or K, X.sub.LC93 is N, E, I, L, M, G, W, P, R, D, Y, A, S, V, T or F, and X.sub.LC95 is D.

(132) In some embodiments, X.sub.HC34 is V, F, N, Y, P, S, Q, H, G, D, I, L, R, W, or T, such as V. In some embodiments, X.sub.HC109 is E, V, Y, T, F, N, W, L, Q, G, I, M, R, K, or H, such as E. In some embodiments, X.sub.LC25 is S, E, G, K, R, T, Y, F, I, A, L, V, H, Q, W, P, or M, such as S. In some embodiments, X.sub.LC49 is S, E, H, N, Y, T, A, F, V, K, L, M, G, R, W, P, or I, such as S or E. For example, X.sub.LC49 may be S. In some embodiments, X.sub.LC50 is D, E, A, S, Q, G, P, V, W, L, T, I, M, H, R, K, F, or Y, such as E or A. For example, X.sub.LC50 may be E. In some embodiments, X.sub.LC91 is D, E, Q, W, M, R, G, L, H, N, T, F, I, V, S, A, or K, such as E. In some embodiments, X.sub.LC93 is N, E, I, L, M, G, W, P, R, D, Y, A, S, V, T or F, such as E.

(133) In some embodiments of the antigen-binding protein provided herein, X.sub.HC34 IS V, X.sub.HC109 is E, X.sub.LC25 is S, X.sub.LC49 is S or E, X.sub.LC50 is E or A, X.sub.LC91 is E, and X.sub.LC93 is E.

(134) In some embodiments of the antigen-binding protein provided herein, X.sub.HC34 IS V, X.sub.HC109 is E, X.sub.LC25 is S, X.sub.LC49 is S, X.sub.LC50 is E, X.sub.LC91 is E, and X.sub.LC93 is E.

(135) In some embodiments, the antigen binding protein provided herein comprises the CDRs of the antibodies designated Ab0331, Ab0335, Ab0351, Ab0428. Ab0429, Ab0430 which were identified in the present studies. The CDRs of these antibodies (according to Kabat) are shown in Table 1.

(136) The CDRs of Ab0331, Ab0335, Ab0351, Ab0428. Ab0429, Ab0430 according to the IMGT nomenclature are shown in Table 2.

(137) Alternatively or additionally, the antigen-binding protein provided herein comprises i) a heavy chain variable region comprising i1) an amino acid sequence of GFSLNNARX.sub.HC34X.sub.HC35VSWIRQPPGKALEWLAHIX.sub.HC54SNDX.sub.HC58KX.sub.HC60 YSTSLK SRLTISKDTSKSQVVLTMTNMDPVDTATYYCARSVX.sub.HC102TX.sub.HC104GYYX.sub.HC108X.sub.HC109GMDV (SEQ ID NO: 21), such as an amino acid sequence shown in SEQ ID NO: 22, 23 or 24, or i2) a variant of the sequence under i1), said variant being at least 80% identical to said polypeptide with the proviso that the amino acid residues corresponding to positions X.sub.HC34, X.sub.HC35 X.sub.HC54, X.sub.HC58, X.sub.HC60, X.sub.HC109, X.sub.HC102, X.sub.HC104 and X.sub.HC108 are not substituted or deleted in said variant, and ii) a light chain variable region comprising ii1) an amino acid sequence of GGX.sub.LC25NIGSESVHWYQQKPGQAPVLVVYX.sub.LC49X.sub.LC50SDRPSGIPERFSGSNSGN TATLTISRVEAGDEADYYCQVWX.sub.LC91GX.sub.LC93SX.sub.LC95HVV (SEQ ID NO: 25), such as an amino acid sequence shown in SEQ ID NO: 26, 27 or 28, or ii2) a variant of the sequence under ii1), said variant being at least 80% identical to said polypeptide with the proviso that the amino acid residues corresponding to positions X.sub.LC25, X.sub.LC49, X.sub.LC50, X.sub.LC91, X.sub.LC93 and X.sub.LC95 are not substituted or deleted in said variant.

(138) Alternatively or additionally, the antigen binding protein provided herein comprises a heavy chain variable region and a light chain variable region as follows i) a heavy chain variable region comprising an amino acid sequence of QVTLKESGPVLVKPTETLTLTCTVSGFSLNNARX.sub.HC34X.sub.HC35VSWIRQPPGKALEW LAHIX.sub.HC54SNDX.sub.HC58KX.sub.HC60 YSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYY CARSVX.sub.HC102 TX.sub.HC104GYYX.sub.HC108X.sub.HC109GMDVWGQGTTVTVSS (SEQ ID NO: 29), such as a heavy chain variable region comprising an amino acid sequence as shown in SEQ ID NO: 30, 31 or 32, or a variant of said heavy chain variable region, said variant being at least 80% identical to said heavy chain variable region with the proviso that the amino acid residues corresponding to positions X.sub.HC34, X.sub.HC35 X.sub.HC54, X.sub.HC58, X.sub.HC60, X.sub.HC109, X.sub.HC102, X.sub.HC104 and X.sub.HC108 are not substituted or deleted in said variant, and ii) a light chain variable region comprising an amino acid sequence of SYVLTQPPSVSVAPGQTARITCGGX.sub.LC25NIGSESVHWYQQKPGQAPVLVVYX.sub.LC49X.sub.LC50SDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWX.sub.LC91GX.sub.LC93SX.sub.LC95HVV FGGGTKLTVL (SEQ ID NO: 33), such as a light chain variable region comprising an amino acid sequence as shown in SEQ ID NO: 34, 35 or 36, or a variant of said light chain variable region, said variant being at least 80% identical to said light chain variable region with the proviso that the amino acid residues corresponding to positions X.sub.LC25, X.sub.LC49, X.sub.LC50, X.sub.LC91, X.sub.LC93 and X.sub.LC95 are not substituted or deleted in said variant.

(139) In some embodiments, the antigen binding protein provided herein comprises the heavy chain variable region and the light chain variable region of the antibodies designated Ab0331, Ab0335, Ab0351, Ab0428, Ab0429, Ab0430, or variants of said regions (which fulfill the criteria above). Table 3 shows the sequences of the heavy chain variable region and the light chain variable region of these antibodies.

(140) In some embodiments, the antigen-binding protein comprises the heavy and light chain variable regions of Ab0331 and Ab0428. Accordingly, the antigen binding protein comprises a heavy chain variable region comprising an amino acid sequence as shown in SEQ ID NO: 30 and a light chain variable region comprising an amino acid sequence as shown in SEQ ID NO: 34.

(141) In some embodiments, the antigen-binding protein comprises the heavy and light chain variable regions of Ab0335 and Ab0429. Accordingly, the antigen binding protein comprises a heavy chain variable region comprising an amino acid sequence as shown in SEQ ID NO: 31 and a light chain variable region comprising an amino acid sequence as shown in SEQ ID NO: 35.

(142) In some embodiments, the antigen-binding protein comprises the heavy and light chain variable regions of Ab0351 and Ab0430. Accordingly, In some embodiments, the antigen binding protein comprises a heavy chain variable region comprising an amino acid sequence as shown in SEQ ID NO: 32 and a light chain variable region comprising an amino acid sequence as shown in SEQ ID NO: 36.

(143) Alternatively or additionally, the antigen binding protein provided herein comprises a heavy chain and a light chain as follows i) a heavy chain comprising an amino acid sequence of QVTLKESGPVLVKPTETLTLTCTVSGFSLNNARX.sub.HC34X.sub.HC35 VSWIRQPPGKALEWLAHIX.sub.HC54SNDX.sub.HC58KX.sub.HC60 YSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARSVX.sub.HC102T X.sub.HC104GYYX.sub.HC108X.sub.HC109GMDVWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGC LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNV DHKPSNTKVDKRVESKYGPPCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHY TQKSLSLSLG (SEQ ID NO: 37), such as an amino acid sequence as shown in SEQ ID NO: 38, 39, 40, 41, 42 or 43, or a variant of said heavy chain, said variant being at least 80% identical to said heavy chain with the proviso that the amino acid residues corresponding to positions X.sub.HC34, X.sub.HC35 X.sub.HC54, X.sub.HC58, X.sub.HC60, X.sub.HC109, X.sub.HC102, X.sub.HC104 and X.sub.HC108 are not substituted or deleted in said variant, and ii) a light chain comprising an amino acid sequence of SYVLTQPPSVSVAPGQTARITCGGX.sub.LC25NIGSESVHWYQQKPGQAPVLVVYX.sub.LC49X.sub.LC50S DRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWX.sub.LC91GX.sub.LC93SX.sub.LC95HVVFGGG TKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGV ETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS (SEQ ID NO: 44), such as an amino acid sequence as shown in SEQ ID NO: 45, 46, 47, 48, 49 or 50, or a variant of said light chain, said variant being at least 80% identical to said light chain with the proviso that the amino acid residues corresponding to positions X.sub.LC25, X.sub.LC49, X.sub.LC50, X.sub.LC91, X.sub.LC93 and X.sub.LC95 are not substituted or deleted in said variant

(144) In some embodiments, the antigen binding protein provided herein comprises the heavy chain and the light chain of the antibodies designated Ab0331, Ab0335, Ab0351, Ab0428, Ab0429, Ab0430, or variants of the heavy or light chains (which fulfill the criteria above). Table 4 shows the sequences of the full light and heavy chains of these antibodies. The CDRs are indicated in bold. The variable domains are underlined. The Fc backbone in the heavy chain is underlined twice.

(145) In some embodiments, the heavy chain comprises an amino acid sequence as shown in SEQ ID NO: 38, and the light chain comprises an amino acid sequence as shown in SEQ ID NO: 45.

(146) In some embodiments, the heavy chain comprises an amino acid sequence as shown in SEQ ID NO: 39, and the light chain comprises an amino acid sequence as shown in SEQ ID NO: 46.

(147) In some embodiments, the heavy chain comprises an amino acid sequence as shown in SEQ ID NO: 40, and the light chain comprises an amino acid sequence as shown in SEQ ID NO: 47.

(148) In some embodiments, the heavy chain comprises an amino acid sequence as shown in SEQ ID NO: 41, and the light chain comprises an amino acid sequence as shown in SEQ ID NO: 48.

(149) In some embodiments, the heavy chain comprises an amino acid sequence as shown in SEQ ID NO: 42, and the light chain comprises an amino acid sequence as shown in SEQ ID NO: 49.

(150) In some embodiments, the heavy chain comprises an amino acid sequence as shown in SEQ ID NO: 43, and the light chain comprises an amino acid sequence as shown in SEQ ID NO: 50.

(151) In one embodiment, the provided antigen-binding protein binds ?-Klotho or a complex comprising ?-Klotho and FGFR1c, or both ?-Klotho and a complex comprising ?-Klotho and FGFR1c. In some embodiments, the provided antigen-binding protein binds a complex comprising ?-Klotho and FGFR1c.

(152) In one embodiment, the provided antigen-binding protein activates the cell-surface receptor complex comprising ?-Klotho and FGFR1c.

(153) Advantageously, the provided antigen-binding protein is an antibody, such as a monoclonal antibody, or an antigen-binding fragment thereof.

(154) In one embodiment, the antibody is a bivalent antibody. Further, it is envisaged that the antigen-binding fragment is a bivalent antigen-binding fragment.

(155) Section B) Conjugates Comprising an FGFR1/KLB Agonistic Antigen-Binding Protein and at Least One GLP-1R Agonistic Peptide.

(156) As set forth above, provided herein are conjugates comprising an FGFR1/KLB targeting agonistic antigen-binding protein, or a fragment thereof, and at least one GLP-1R agonistic peptide. Specifically, the conjugate comprises an antigen binding protein which binds ?-Klotho and/or a complex comprising ?-Klotho and FGFR1c, wherein antigen binding protein is conjugated to at least one GLP-1 peptide.

(157) Typically, the antigen-binding protein comprised by the conjugate provided herein activates the cell-surface receptor complex comprising ?-Klotho and FGFR1c (see above, see e.g. section B above, Summary of the present invention).

(158) Advantageously, the antigen-binding protein comprised by the conjugate provided herein is an antibody, such as a monoclonal antibody, or an antigen-binding fragment thereof. For example, the antibody may be an antibody as described in section A above (Summary of the present invention and Detailed description of the present invention. Typically, the antibody is a bivalent antibody. Further, it is envisaged that the antigen-binding fragment is a bivalent antigen-binding fragment.

(159) In one embodiment, the conjugate comprises an antigen binding protein having improved physico-chemical properties, such as an increased stability, as compared to the monoclonal antibody 16H7. The antigen binding protein shall comprise i) light chain CDRs 1, 2 and 3 and heavy chain CDRs 1, 2 and 3 as defined herein, a light chain and a heavy chain variable region as defined herein, and/or a light and heavy chain as defined herein.

(160) Specifically, the antigen binding protein shall comprise at least one amino acid substitution as compared to 16H7. In one embodiment, at least amino acid residue of 16H7 which is associated with reduced stability is replaced by another amino acid residue, such as an naturally occurring amino acid residue. In some embodiments, the at least one amino acid residue of 16H7 which is associated with reduced stability is selected from group consisting of M34 of the heavy chain, D109 of the heavy chain, N25 of the light chain, D49 of the light chain, D50 of the light chain, D91 of the light chain and N93 of the light chain of 16H7. In some embodiments, two, three, four, five, or six the aforementioned amino acid residues are substituted. In some embodiments, all of the aforementioned amino acid residues are substituted.

(161) The antigen binding protein may also comprise variant CDRs of the respective light chain CDRs 1, 2 and 3 and heavy chain CDRs 1, 2 and 3. In some embodiments, said variants differ by not more than a total of five amino acid additions, substitutions, and/or deletions from the respective CDR. In some embodiments, said variants differ by not more than a total of four amino acid additions, substitutions, and/or deletions from the respective CDR. In some embodiments, said variants differ by not more than a total of three amino acid additions, substitutions, and/or deletions from the respective CDR. In some embodiments, said variants differ by not more than a total of two amino acid additions, substitutions, and/or deletions from the respective CDR. In some embodiments, said variants differ by not more than a total of one amino acid addition, substitution, and/or deletion from the respective CDR.

(162) In some embodiments, the mutations are substitutions. Thus, the variants differ by not more than a total of five, four, three, two, or one amino acid substitution(s) from the respective CDR. Based on the results shown in Tables D1 and D2 in the Examples section, the skilled person is enabled to select suitable substitutions.

(163) However, it is envisaged that the amino acid residues G35, F54, E58, S60, G104 and Y108 in the heavy chain and D95 in the light chain of 16H7 are not mutated. Accordingly, it is envisaged that the antigen binding protein comprises amino acid residues corresponding to amino acid residues G35, F54, E58, S60, G104 and Y108 in the heavy chain, and amino acid residue D95 in the light chain of 16H7. Thus, the aforementioned amino acid residues should not be mutated, i.e. they should not be substituted or deleted.

(164) In some embodiments, the amino acid residue 183 present in the heavy chain of 16H7 is substituted with a different amino acid, such as a T (183T substitution)

(165) In one embodiment, the antigen binding protein comprises a) a heavy chain CDR1, b) a heavy chain CDR2, c) a heavy chain CDR3, d) a light chain CDR1, e) a light chain CDR2 and f) a light chain CDR3.

(166) The CDRs are defined in the section Summary of the present invention above and herein below.

(167) In one embodiment, the heavy chain CDR1 comprises a1) NARX.sub.HC34X.sub.HC35VS (SEQ ID NO: 3), wherein X.sub.HC34 is M, V, F, N, Y, P, S, Q, H, G, D, I, L, R, W, or T, and wherein X.sub.HC35 is G, or a2) a variant of the heavy chain CDR1 of a1) which differs by not more than a total of five, four or three amino acid additions, substitutions, and/or deletions from said heavy chain CDR1 with the proviso that the amino acid residues at positions X.sub.HC34 and X.sub.HC35 are not substituted or deleted.

(168) In one embodiment, the heavy chain CDR2 comprises b1) HIX.sub.HC54SNDX.sub.HC58KX.sub.HC60 YSTSLKS (SEQ ID NO: 6), wherein X.sub.HC54 is F, wherein X.sub.HC58 is E, and wherein X.sub.HC60 is S, or b2) a variant of the heavy chain CDR2 of b1) which differs by not more than a total of five, four or three amino acid additions, substitutions, and/or deletions from said heavy chain CDR2, with the proviso that the amino acid residues at positions X.sub.HC54, X.sub.HC58, and X.sub.HC60 are not substituted or deleted.

(169) In one embodiment, the heavy chain CDR3 comprises c1) SVX.sub.HC102TX.sub.HC104GYYX.sub.HC108X.sub.HC109GMDV (SEQ ID NO: 8), wherein X.sub.HC109 is D, E, V, Y, T, F, N, W, L, Q, G, I, M, R, K, or H, X.sub.HC102 is V, X.sub.HC104 is G and X.sub.HC108 is Y, or c2) a variant of the heavy chain CDR3 of c1) which differs by not more than a total of five, four or three amino acid additions, substitutions, and/or deletions from said heavy chain CDR3, with the proviso that the amino acid residues at positions X.sub.HC109, X.sub.HC102, X.sub.HC104 and X.sub.HC108 are not substituted or deleted.

(170) In one embodiment, the light chain CDR1 comprises d1) GGX.sub.LC25NIGSESVH (SEQ ID NO: 11), wherein X.sub.LC25 is N, S, E, G, K, R, T, Y, F, I, A, L, V, H, Q, W, P, or M, or d2) a variant of the light chain CDR1 of d1) which differs by not more than a total of five, four or three amino acid additions, substitutions, and/or deletions from said light chain CDR1 with the proviso that the amino acid residue at position X.sub.LC25 is not substituted or deleted.

(171) In one embodiment, the light chain CDR2 comprises e1) X.sub.LC49X.sub.LC50SDRPS (SEQ ID NO: 14), wherein X.sub.LC49 is D, S, E, H, N, Y, T, A, F, V, K, L, M, G, R, W, P, or I, and X.sub.LC50 is D, E, A, S, Q, G, P, V, W, L, T, I, M, H, R, K, F, or Y, or e2) a variant of the light chain CDR2 of e1) which differs by not more than a total of five, four or three amino acid additions, substitutions, and/or deletions from said light chain CDR2 with the proviso that the amino acid residues at positions X.sub.LC49 and X.sub.LC50 are not substituted or deleted.

(172) In one embodiment, the light chain light chain CDR3 comprising f1) QVWX.sub.LC91 GX.sub.LC93SX.sub.LC95HVV (SEQ ID NO: 19), wherein X.sub.LC91 is D, E, Q, W, M, R, G, L, H, N, T, F, I, V, S, A, or K, X.sub.LC93 is N, E, I, L, M, G, W, P, R, D, Y, A, S, V, T or F, and X.sub.LC95 is D, or f2) a variant of the light chain CDR3 of f1) which differs by not more than a total of five, four or three amino acid additions, substitutions, and/or deletions from said light chain CDR3 with the proviso that the amino acid residues at positions X.sub.LC91, X.sub.LC93 and X.sub.LC95 are not substituted or deleted.

(173) In some embodiments, the antigen binding protein comprises g) a heavy chain CDR1 comprising NARX.sub.HC34X.sub.HC35VS (SEQ ID NO: 3), wherein X.sub.HC34 is M, V, F, N, Y, P, S, Q, H, G, D, I, L, R, W, or T, and wherein X.sub.HC35 is G, h) a heavy chain CDR2 comprising HIX.sub.HC54SNDX.sub.HC58 KX.sub.HC60 YSTSLKS (SEQ ID NO: 6), wherein X.sub.HC54 is F, wherein X.sub.HC58 is E, and wherein X.sub.HC60 is S, i) a heavy chain CDR3 comprising SVX.sub.HC102 TX.sub.HC104GYYX.sub.HC108X.sub.HC109GMDV (SEQ ID NO: 8), wherein X.sub.HC109 is D, E, V, Y, T, F, N, W, L, Q, G, I, M, R, K, or H, X.sub.HC102 is V, X.sub.HC104 IS G and X.sub.HC108 is Y, j) a light chain CDR1 comprising GGX.sub.LC25NIGSESVH (SEQ ID NO: 11), wherein X.sub.LC25 is N, S, E, G, K, R, T, Y, F, I, A, L, V, H, Q, W, P, or M, k) a light chain CDR2 comprising X.sub.LC49X.sub.LC50SDRPS (SEQ ID NO: 14), wherein X.sub.LC49 is D, S, E, H, N, Y, T, A, F, V, K, L, M, G, R, W, P, or I, and X.sub.LC50 is D, E, A, S, Q, G, P, V, W, L, T, I, M, H, R, K, F, or Y, and/or l) a light chain CDR3 comprising QVWX.sub.LC91GX.sub.LC93SX.sub.LC95HVV (SEQ ID NO: 19), wherein X.sub.LC91 is D, E, Q, W, M, R, G, L, H, N, T, F, I, V, S, A, or K, X.sub.LC93 is N, E, I, L, M, G, W, P, R, D, Y, A, S, V, T or F, and X.sub.LC95 is D.

(174) In some embodiments, X.sub.HC34 is V, F, N, Y, P, S, Q, H, G, D, I, L, R, W, or T, such as V. In some embodiments, X.sub.HC109 is E, V, Y, T, F, N, W, L, Q, G, I, M, R, K, or H, such as E. In some embodiments, X.sub.LC25 is S, E, G, K, R, T, Y, F, I, A, L, V, H, Q, W, P, or M, such as S. In some embodiments, X.sub.LC49 is S, E, H, N, Y, T, A, F, V, K, L, M, G, R, W, P, or I, such as S or E. For example, X.sub.LC49 may be S. In some embodiments, X.sub.LC50 is D, E, A, S, Q, G, P, V, W, L, T, I, M, H, R, K, F, or Y, such as E or A. For example, X.sub.LC50 may be E. In some embodiments, X.sub.LC91 is D, E, Q, W, M, R, G, L, H, N, T, F, I, V, S, A, or K, such as E. In some embodiments, X.sub.LC93 is N, E, I, L, M, G, W, P, R, D, Y, A, S, V, T or F, such as E.

(175) In some embodiments of the antigen-binding protein, X.sub.HC34 is V, X.sub.HC109 IS E, X.sub.LC25 is S, X.sub.LC49 is S or E, X.sub.LC50 is E or A, X.sub.LC91 is E, and X.sub.LC93 is E.

(176) In some embodiments of the antigen-binding protein, X.sub.HC34 IS V, X.sub.HC109 IS E, X.sub.LC25 is S, X.sub.LC49 is S, X.sub.LC50 is E, X.sub.LC91 is E, and X.sub.LC93 is E.

(177) In some embodiments, the antigen binding protein comprises the CDRs of the antibodies designated Ab0331, Ab0335, Ab0351, Ab0428. Ab0429, Ab0430 which were identified in the present studies. The CDRs of these antibodies (according to Kabat) are shown in Table 1. The CDRs of Ab0331, Ab0335, Ab0351, Ab0428. Ab0429, Ab0430 according to the IMGT nomenclature are shown in Table 2.

(178) Alternatively or additionally, the antigen-binding herein comprises i) a heavy chain variable region comprising i1) an amino acid sequence of GFSLNNARX.sub.HC34X.sub.HC35VSWIRQPPGKALEWLAHIX.sub.HC54SNDX.sub.HC58KX.sub.HC60 YSTSLK SRLTISKDTSKSQVVLTMTNMDPVDTATYYCARSVX.sub.HC102 TX.sub.HC104GYYX.sub.HC108X.sub.HC109GMDV (SEQ ID NO: 21), such as an amino acid sequence shown in SEQ ID NO: 22, 23 or 24, or i2) a variant of the sequence under i1), said variant being at least 80% identical to said polypeptide with the proviso that the amino acid residues corresponding to positions X.sub.HC34, X.sub.HC35 X.sub.HC54, X.sub.HC58, X.sub.HC60, X.sub.HC109, X.sub.HC102, X.sub.HC104 and X.sub.HC108 are not substituted or deleted in said variant, and ii) a light chain variable region comprising ii1) an amino acid sequence of GGX.sub.LC25NIGSESVHWYQQKPGQAPVLVVYX.sub.LC49X.sub.LC50SDRPSGIPERFSGSNSGN TATLTISRVEAGDEADYYCQVWX.sub.LC91 GX.sub.LC93SX.sub.LC95HVV (SEQ ID NO: 25), such as an amino acid sequence shown in SEQ ID NO: 26, 27 or 28, or ii2) a variant of the sequence under ii1), said variant being at least 80% identical to said polypeptide with the proviso that the amino acid residues corresponding to positions X.sub.LC25, X.sub.LC49, X.sub.LC50, X.sub.LC91, X.sub.LC93 and X.sub.LC95 are not substituted or deleted in said variant.

(179) Alternatively or additionally, the antigen binding protein comprises a heavy chain variable region and a light chain variable region as follows i) a heavy chain variable region comprising an amino acid sequence of QVTLKESGPVLVKPTETLTLTCTVSGFSLNNARX.sub.HC34X.sub.HC35VSWIRQPPGKALEW LAHIX.sub.HC54SNDX.sub.HC58KX.sub.HC60 YSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYY CARSVX.sub.HC102TX.sub.HC104GYYX.sub.HC108X.sub.HC109GMDVWGQGTTVTVSS (SEQ ID NO: 29), such as a heavy chain variable region comprising an amino acid sequence as shown in SEQ ID NO: 30, 31 or 32, or a variant of said heavy chain variable region, said variant being at least 80% identical to said heavy chain variable region with the proviso that the amino acid residues corresponding to positions X.sub.HC34, X.sub.HC35 X.sub.HC54, X.sub.HC58, X.sub.HC60, X.sub.HC109, X.sub.HC102, X.sub.HC104 and X.sub.HC108 are not substituted or deleted in said variant, and ii) a light chain variable region comprising an amino acid sequence of SYVLTQPPSVSVAPGQTARITCGGX.sub.LC25NIGSESVHWYQQKPGQAPVLVVYX.sub.LC49X.sub.LC50SDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWX.sub.LC91GX.sub.LC93SX.sub.LC95HVV FGGGTKLTVL (SEQ ID NO: 33), such as a light chain variable region comprising an amino acid sequence as shown in SEQ ID NO: 34, 35 or 36, or a variant of said light chain variable region, said variant being at least 80% identical to said light chain variable region with the proviso that the amino acid residues corresponding to positions X.sub.LC25, X.sub.LC49, X.sub.LC50, X.sub.LC91, X.sub.LC93 and X.sub.LC95 are not substituted or deleted in said variant.

(180) In some embodiments, the antigen binding protein comprises the heavy chain variable region and the light chain variable region of the antibodies designated Ab0331, Ab0335, Ab0351, Ab0428, Ab0429, Ab0430, or variants of said regions (which fulfill the criteria above). Table 3 shows the sequences of the heavy chain variable region and the light chain variable region of these antibodies.

(181) In some embodiments, the antigen-binding protein comprises the heavy and light chain variable regions of Ab0331 and Ab0428. Accordingly, the antigen binding protein comprises a heavy chain variable region comprising an amino acid sequence as shown in SEQ ID NO: 30 and a light chain variable region comprising an amino acid sequence as shown in SEQ ID NO: 34.

(182) In some embodiments, the antigen-binding protein comprises the heavy and light chain variable regions of Ab335 and Ab429. Accordingly, the antigen binding protein comprises a heavy chain variable region comprising an amino acid sequence as shown in SEQ ID NO: 31 and a light chain variable region comprising an amino acid sequence as shown in SEQ ID NO: 35.

(183) In some embodiments, the antigen-binding protein comprises the heavy and light chain variable regions of Ab0351 and Ab0430. Accordingly, in some embodiments, the antigen binding protein comprises a heavy chain variable region comprising an amino acid sequence as shown in SEQ ID NO: 32 and a light chain variable region comprising an amino acid sequence as shown in SEQ ID NO: 36.

(184) Alternatively or additionally, the antigen binding protein comprises a heavy chain and a light chain as follows i) a heavy chain comprising an amino acid sequence of QVTLKESGPVLVKPTETLTLTCTVSGFSLNNARX.sub.HC34X.sub.HC35 VSWIRQPPGKALEWLAHIX.sub.HC54SNDX.sub.HC58KX.sub.HC60 YSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARSVX.sub.HC102 T X.sub.HC104GYYX.sub.HC108X.sub.HC109GMDVWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGC LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNV DHKPSNTKVDKRVESKYGPPCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHY TQKSLSLSLG (SEQ ID NO: 37), such as an amino acid sequence as shown in SEQ ID NO: 38, 39, 40, 41, 42 or 43, or a variant of said heavy chain, said variant being at least 80% identical to said heavy chain with the proviso that the amino acid residues corresponding to positions X.sub.HC34, X.sub.HC35 X.sub.HC54, X.sub.HC58, X.sub.HC60, X.sub.HC109, X.sub.HC102, X.sub.HC104 and X.sub.HC108 are not substituted or deleted in said variant, and ii) a light chain comprising an amino acid sequence of SYVLTQPPSVSVAPGQTARITCGGX.sub.LC25NIGSESVHWYQQKPGQAPVLVVYX.sub.LC49X.sub.LC50S DRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWX.sub.LC91GX.sub.LC93SX.sub.LC95HVVFGGG TKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGV ETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS (SEQ ID NO: 44), such as an amino acid sequence as shown in SEQ ID NO: 45, 46, 47, 48, 49 or 50, or a variant of said light chain, said variant being at least 80% identical to said light chain with the proviso that the amino acid residues corresponding to positions X.sub.LC25, X.sub.LC49, X.sub.LC50, X.sub.LC91, X.sub.LC93 and X.sub.LC95 are not substituted or deleted in said variant

(185) In some embodiments, the antigen binding protein comprises the heavy chain and the light chain of the antibodies designated Ab0331, Ab0335, Ab0351, Ab0428, Ab0429, Ab0430, or variants of the heavy or light chains (which fulfill the criteria above). Table 4 shows the sequences of the full light and heavy chains of these antibodies. The CDRs are indicated in bold. The variable domains are underlined. The Fc backbone in the heavy chain is underlined twice.

(186) In some embodiments, the heavy chain comprises an amino acid sequence as shown in SEQ ID NO: 38, and the light chain comprises an amino acid sequence as shown in SEQ ID NO: 45.

(187) In some embodiments, the heavy chain comprises an amino acid sequence as shown in SEQ ID NO: 39, and the light chain comprises an amino acid sequence as shown in SEQ ID NO: 46.

(188) In some embodiments, the heavy chain comprises an amino acid sequence as shown in SEQ ID NO: 40, and the light chain comprises an amino acid sequence as shown in SEQ ID NO: 47.

(189) In some embodiments, the heavy chain comprises an amino acid sequence as shown in SEQ ID NO: 41, and the light chain comprises an amino acid sequence as shown in SEQ ID NO: 48.

(190) In some embodiments, the heavy chain comprises an amino acid sequence as shown in SEQ ID NO: 42, and the light chain comprises an amino acid sequence as shown in SEQ ID NO: 49.

(191) In some embodiments, the heavy chain comprises an amino acid sequence as shown in SEQ ID NO: 43, and the light chain comprises an amino acid sequence as shown in SEQ ID NO: 50.

(192) In one embodiment, the antigen-binding protein binds ?-Klotho or a complex comprising ?-Klotho and FGFR1c, or both ?-Klotho and a complex comprising ?-Klotho and FGFR1c. In some embodiments, the antigen-binding protein binds a complex comprising ?-Klotho and FGFR1c.

(193) In the conjugate provided herein, the antigen-binding protein is conjugated to at least one GLP-1R agonistic peptide.

(194) In one embodiment, the GLP-1R agonistic peptide comprises or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 59, 60, 61 and 62. The definitions have been provided above.

(195) For example, X.sub.1 may be H, Y or F. In one embodiment, X.sub.1 is H

(196) For example, X.sub.10 may be K or L. In one embodiment, X.sub.10 is K. In another embodiment, X.sub.10 is L.

(197) For example, X.sub.12 may be K, I, Q or E, such as K, I or Q. In one embodiment, X.sub.12 is K. In another embodiment, X.sub.12 is I.

(198) For example, X.sub.13 may be Q or L. In one embodiment, X.sub.13 is Q. In another embodiment, X.sub.13 is L.

(199) For example, X.sub.14 may be L or C. In one embodiment, X.sub.14 is C. In another embodiment, X.sub.14 is L.

(200) For example, X.sub.15 is E, A or D, such as E or D. In one embodiment, X.sub.15 is E. In another embodiment, X.sub.15 is D.

(201) For example, X.sub.16 is E, K or S, such as E or K. In one embodiment, X.sub.16 is E. In another embodiment, X.sub.16 is K.

(202) For example, X.sub.17 is E, R or Q, such as E or R. In one embodiment, X.sub.17 is E. In another embodiment, X.sub.17 is R.

(203) For example, X.sub.18 is L, A or R, such as A or R. In one embodiment, X.sub.18 is A. In another embodiment, X.sub.18 is R.

(204) For example, X.sub.19 is V, A, F or Q, such as V, A, or F, or, for example, V or Q.

(205) For example, X.sub.20 is R, H, Q, K or I, such as R, H or Q, such as R or Q. In one embodiment, X.sub.20 is

(206) Q. In another embodiment, X.sub.20 is R.

(207) For example, X.sub.21 is L, E, H or R. In one embodiment, X.sub.21 is L. In another embodiment, X.sub.21 is E.

(208) For example, X.sub.23 is I, Y or F. In one embodiment, X.sub.23 is I.

(209) For example, X.sub.24 is E, A, L or Y. In one embodiment, X.sub.24 is E. In another embodiment, X.sub.24 is Y.

(210) For example, X.sub.27 is I, L, K, V or E.

(211) For example, X.sub.28 is A, K, N or E. In one embodiment, X.sub.28 is A.

(212) For example, X.sub.29 is G, T, K, V or absent such as G or T. In one embodiment, X.sub.29 is G. In another embodiment, X.sub.29 is T.

(213) For example, X.sub.30 is G, R, or absent. In some embodiments, X.sub.30 is G.

(214) X.sub.31 to X.sub.42 have been defined above. In an embodiment, both X.sub.14 and X.sub.42 are C.

(215) In one embodiment, the above GLP-1R agonistic peptide further comprises at least one additional amino acid residue at its N-terminus. In one embodiment, the at least one additional amino acid residue is a single amino acid residue. In one embodiment, the at least single amino acid residue is G.

(216) The GLP-1R agonistic peptide comprising or consisting of an amino acid sequence SEQ ID NO: 61 and 62, optionally, further comprises a peptide extension consisting of up to 12, 11 or 10 amino acid residues at its C-terminus. In an embodiment, the sequence of the peptide extension corresponds to the sequence of X.sub.31 to X.sub.42 of SEQ ID NO: 59. In one embodiment, the peptide extension is a single amino acid residue, e.g., P. In one embodiment, the peptide extension comprises or consists of the amino acid sequence PSSGAPPPS (SEQ ID NO: 63). In another embodiment, the peptide extension comprises or consists of the amino acid sequence PKKIRYS (SEQ ID NO: 64). Further, it is envisaged that the peptides of SEQ ID NO: 59 and 60 comprise the peptide extension of SEQ ID NO: 63 or 64.

(217) Exemplary amino acid sequences of a peptide extension, or for amino acid regions X.sub.30 to X.sub.42 of SEQ ID NO: 60 or 61 are highlighted in bold in Table A3.

(218) In one embodiment, the GLP-1R agonistic peptide comprises or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 51, 52, 53, 54 and 55. The definitions have been provided above.

(219) In one embodiment of the conjugate, antigen binding fragment is conjugated to one, two, three, or four, or more GLP-1 peptides, such as two or four GLP-1 peptides.

(220) In one embodiment of the conjugate, each heavy chain variable region and/or each light chain variable region of the antigen binding protein is conjugated to at least one GLP-1 peptide.

(221) In one embodiment of the conjugate, the C-terminus of the at least one GLP-1 peptide is conjugated to the antigen-binding protein.

(222) In one embodiment of the conjugate antibody, or antigen-binding fragment thereof is conjugated to the at least one GLP-1 peptide via a linker, such as peptide linker as set forth above.

(223) The present invention further relates to the following subject-matter.

(224) Further provided is a pharmaceutical composition comprising the antigen-binding protein provided herein (see e.g. section A) or the conjugate provided herein (see e.g. section B) together with a pharmaceutically acceptable carrier and/or excipient.

(225) Further provided is a polynucleotide encoding the antigen-binding protein or the conjugate provided herein. Further provided is a vector comprising said polynucleotide.

(226) Further provided is a host cell comprising the polynucleotide provided herein, the vector polynucleotide provided herein, and/or the antigen binding protein provided herein or the conjugate provided herein.

(227) Further provided is a method of producing the antigen binding protein provided herein or conjugate provided herein, comprising incubating the host cell provided herein under conditions that allow for expressing said antigen binding protein.

(228) In some embodiments, the antigen binding protein provided herein, the conjugate provided herein, or the pharmaceutical composition provided herein is for use in treatment of a disease or disorder.

(229) Applications/Treatment

(230) The antigen binding protein provided herein, the conjugate or pharmaceutical composition provided herein can be used in research, therapy or prophylaxis.

(231) Encompassed by the present disclosure is an in vivo or in vitro method, comprising administering the antigen binding protein provided herein or conjugate provided herein or pharmaceutical composition provided herein in an effective amount to said host cell.

(232) Provided is a method for treating a disease or disorder in a subject, such as a human, comprising administering to said subject a therapeutically effective amount of the antigen binding protein provided herein or the conjugate provided herein, or the pharmaceutical composition provided herein, such as to treat the disease or disorder.

(233) In a further aspect, the antigen binding protein provided herein or conjugate provided herein, or the pharmaceutical composition provided herein, is for use in the manufacture of a medicament for the treatment of a disease or disorder.

(234) In some embodiments, the disease or disorder is selected from obesity, being overweight, metabolic syndrome, diabetes mellitus, such as type 2 diabetes mellitus, diabetic retinopathy, hyperglycemia, dyslipidemia, Non-Alcoholic Steatohepatitis (NASH) and/or atherosclerosis.

(235) In some embodiments, obesity is treated.

(236) In some embodiments, a subject being overweight is treated.

(237) In some embodiments, diabetes is treated, such as type 2 diabetes mellitus.

(238) In some embodiments, diabetic retinopathy is treated.

(239) In some embodiments, hyperglycemia is treated.

(240) In some embodiments, dyslipidemia is treated.

(241) In some embodiments, NASH is treated.

(242) In some embodiments, dyslipidemia is treated.

(243) In some embodiments, atherosclerosis is treated.

(244) Sequences

(245) TABLE-US-00010 TABLE1 CDRsofexemplaryantibodies(accordingtoKabat) CDR- CDR- SEQ H1- SEQ CDR-H2- SEQ CDR-H3- SEQ CDR-L1- SEQ L2- SEQ CDR-L3- No. ID Kabat ID Kabat ID Kabat ID Kabat ID Kabat ID Kabat Ab0331 4 NARV 7 HIFSNDEKS 9 SVVTGGYY 12 GGSNIG 15 SESD 20 QVWEGE GVS YSTSLKS YEGMDV SESVH RPS SDHVV Ab0335 4 NARV 7 HIFSNDEKS 9 SVVTGGYY 12 GGSNIG 16 SASD 20 QVWEGE GVS YSTSLKS YEGMDV SESVH RPS SDHVV Ab0351 4 NARV 7 HIFSNDEKS 9 SVVTGGYY 12 GGSNIG 17 EESD 20 QVWEGE GVS YSTSLKS YEGMDV SESVH RPS SDHVV Ab0428 4 NARV 7 HIFSNDEKS 9 SVVTGGYY 12 GGSNIG 15 SESD 20 QVWEGE GVS YSTSLKS YEGMDV SESVH RPS SDHVV Ab0429 4 NARV 7 HIFSNDEKS 9 SVVTGGYY 12 GGSNIG 16 SASD 20 QVWEGE GVS YSTSLKS YEGMDV SESVH RPS SDHVV Ab0430 4 NARV 7 HIFSNDEKS 9 SVVTGGYY 12 GGSNIG 17 EESD 20 QVWEGE GVS YSTSLKS YEGMDV SESVH RPS SDHVV

(246) TABLE-US-00011 TABLE2 CDRsofexemplaryantibodies(IMGTnomenclature) CDR- SEQ CDR-H1- SEQ CDR-H2- SEQ SEQ SEQ L2- SEQ No. ID IMGT ID IMGT ID CDR-H3-IMGT ID CDR-L1-IMGT ID IMGT ID CDR-L3-IMGT Ab0331 4 GFSLNNARV 7 IFSNDE 9 ARSVVTGGYYYEGMD 12 GGSNIGSESV 15 SES 20 QVWEGESDHV G K V H V Ab0335 4 GFSLNNARV 7 IFSNDE 9 ARSVVTGGYYYEGMD 12 GGSNIGSESV 16 SAS 20 QVWEGESDHV G K V H V Ab0351 4 GFSLNNARV 7 IFSNDE 9 ARSVVTGGYYYEGMD 12 GGSNIGSESV 17 EES 20 QVWEGESDHV G K V H V Ab0428 4 GFSLNNARV 7 IFSNDE 9 ARSVVTGGYYYEGMD 12 GGSNIGSESV 15 SES 20 QVWEGESDHV G K V H V Ab0429 4 GFSLNNARV 7 IFSNDE 9 ARSVVTGGYYYEGMD 12 GGSNIGSESV 16 SAS 20 QVWEGESDHV G K V H V Ab0430 4 GFSLNNARV 7 IFSNDE 9 ARSVVTGGYYYEGMD 12 GGSNIGSESV 17 EES 20 QVWEGESDHV G K V H V

(247) TABLE-US-00012 TABLE3 Lightandheavychainvariabledomainsofexemplaryantibodies. TheCDRsareindicatedinbold. Ab Heavychainvariable Lightchainvariable NO domainsequence domainsequence Ab0331 QVTLKESGPVLVKPTETLTLTCTVSGFS SYVLTQPPSVSVAPGQTARITCGGSNIGSES Ab0428 LNNARVGVSWIRQPPGKALEWLAHIFS VHWYQQKPGQAPVLVVYSESDRPSGIPERF NDEKSYSTSLKSRLTISKDTSKSQVVLT SGSNSGNTATLTISRVEAGDEADYYCQVWE MTNMDPVDTATYYCARSVVTGGYYYE GESDHVVFGGGTKLTVL(SEQIDNO:34) GMDVWGQGTTVTVSS(SEQIDNO:30) Ab0335 QVTLKESGPVLVKPTETLTLTCTVSGFS SYVLTQPPSVSVAPGQTARITCGGSNIGSES Ab0429 LNNARVGVSWIRQPPGKALEWLAHIFS VHWYQQKPGQAPVLVVYSASDRPSGIPERF NDEKSYSTSLKSRLTISKDTSKSQVVLT SGSNSGNTATLTISRVEAGDEADYYCQVWE MTNMDPVDTATYYCARSVVTGGYYYE GESDHVVFGGGTKLTVL(SEQIDNO:35) GMDVWGQGTTVTVSS(SEQIDNO:31) Ab0351 QVTLKESGPVLVKPTETLTLTCTVSGFS SYVLTQPPSVSVAPGQTARITCGGSNIGSES Ab0430 LNNARVGVSWIRQPPGKALEWLAHIFS VHWYQQKPGQAPVLVVYEESDRPSGIPERF NDEKSYSTSLKSRLTISKDTSKSQVVLT SGSNSGNTATLTISRVEAGDEADYYCQVWE MTNMDPVDTATYYCARSVVTGGYYYE GESDHVVFGGGTKLTVL(SEQIDNO:36) GMDVWGQGTTVTVSS(SEQIDNO:32)

(248) TABLE-US-00013 TABLE4 Fulllightandheavychainsofexemplaryantibodies.TheCDRs areindicatedinbold.Thevariabledomainsareunderlined. TheFcbackboneintheheavychainisunderlinedtwice. Ab NO Heavychainsequence Lightchainsequence Ab0331 QVILKESGPVLVKPTETLTLICTVSGFSLNNARV SYVLTQPPSVSVAPGQTARITCGGSNIGSES GVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKS VHWYQQKPGQAPVLVVYSESDRPSGIPERF RLTISKDTSKSQVVLTMTNMDPVDTATYYCARS SGSNSGNTATLTISRVEAGDEADYYCQVWE VVTGGYYYEGMDVWGQGTTVTVSSASTKGPSV GESDHVVFGGGTKLTVLGQPKANPTVTLFP FPLAPCSRSTSESTAALGCLVKDYFPEPVTVSW PSSEELQANKATLVCLISDFYPGAVTVAWKA NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS DGSPVKAGVETTKPSKQSNNKYAASSYLSL SLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCP TPEQWKSHRSYSCQVTHEGSTVEKTVAPT PCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTC ECS(SEQIDNO:45) VVVDVSQEDPEVQFNVVYVDGVEVHNAKTKPRE EQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSC SVMHEALHNHYTQKSLSLSLG(SEQIDNO:38) Ab0335 QVTLKESGPVLVKPTETLTLTCTVSGFSLNNARV SYVLTQPPSVSVAPGQTARITCGGSNIGSES GVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKS VHVVYQQKPGQAPVLVVYSASDRPSGIPER RLTISKDTSKSQVVLTMTNMDPVDTATYYCARS FSGSNSGNTATLTISRVEAGDEADYYCQVW VVTGGYYYEGMDVWGQGTTVTVSSASTKGPSV EGESDHVVFGGGTKLTVLGQPKANPTVTLF FPLAPCSRSTSESTAALGCLVKDYFPEPVTVSW PPSSEELQANKATLVCLISDFYPGAVTVAWK NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS ADGSPVKAGVETTKPSKQSNNKYAASSYLS SLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCP LTPEQWKSHRSYSCQVTHEGSTVEKTVAPT PCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTC ECS(SEQIDNO:46) VVVDVSQEDPEVQFNVVYVDGVEVHNAKTKPRE EQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSC SVMHEALHNHYTQKSLSLSLG(SEQIDNO:39) Ab0351 QVTLKESGPVLVKPTETLTLTCTVSGFSLNNARV SYVLTQPPSVSVAPGQTARITCGGSNIGSES GVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKS VHVVYQQKPGQAPVLVVYEESDRPSGIPERF RLTISKDTSKSQVVLTMTNMDPVDTATYYCARS SGSNSGNTATLTISRVEAGDEADYYCQVWE VVTGGYYYEGMDVWGQGTTVTVSSASTKGPSV GESDHVVFGGGTKLTVLGQPKANPTVTLFP FPLAPCSRSTSESTAALGCLVKDYFPEPVTVSW PSSEELQANKATLVCLISDFYPGAVTVAWKA NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS DGSPVKAGVETTKPSKQSNNKYAASSYLSL SLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCP TPEQWKSHRSYSCQVTHEGSTVEKTVAPT PCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTC ECS(SEQIDNO:47) VVVDVSQEDPEVQFNVVYVDGVEVHNAKTKPRE EQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSC SVMHEALHNHYTQKSLSLSLG(SEQIDNO:40) Ab0428 QVTLKESGPVLVKPTETLTLTCTVSGFSLNNARV SYVLTQPPSVSVAPGQTARITCGGSNIGSES GVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKS VHVVYQQKPGQAPVLVVYSESDRPSGIPERF RLTISKDTSKSQVVLTMTNMDPVDTATYYCARS SGSNSGNTATLTISRVEAGDEADYYCQVWE VVTGGYYYEGMDVWGQGTTVTVSSASTKGPSV GESDHVVFGGGTKLTVLGQPKANPTVTLFP FPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW PSSEELQANKATLVCLISDFYPGAVTVAWKA NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS DGSPVKAGVETTKPSKQSNNKYAASSYLSL SLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTH TPEQWKSHRSYSCQVTHEGSTVEKTVAPT TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPE ECS(SEQIDNO:48) VTCVVVDVSHEDPEVKFNVVYVDGVEVHNAKTK PREEQYNNASRVVSVLTVLHQDWLNGKEYKCK VSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPG(SEQID NO:41) Ab0429 QVTLKESGPVLVKPTETLTLTCTVSGFSLNNARV SYVLTQPPSVSVAPGQTARITCGGSNIGSES GVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKS VHVVYQQKPGQAPVLVVYSASDRPSGIPER RLTISKDTSKSQVVLTMTNMDPVDTATYYCARS FSGSNSGNTATLTISRVEAGDEADYYCQVW VVTGGYYYEGMDVWGQGTTVTVSSASTKGPSV EGESDHVVFGGGTKLTVLGQPKANPTVTLF FPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW PPSSEELQANKATLVCLISDFYPGAVTVAWK NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS ADGSPVKAGVETTKPSKQSNNKYAASSYLS SLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTH LTPEQWKSHRSYSCQVTHEGSTVEKTVAPT TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPE ECS(SEQIDNO:49) VTCVVVDVSHEDPEVKFNVVYVDGVEVHNAKTK PREEQYNNASRVVSVLTVLHQDWLNGKEYKCK VSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPG(SEQID NO:42) Ab0430 QVTLKESGPVLVKPTETLTLTCTVSGFSLNNARV SYVLTQPPSVSVAPGQTARITCGGSNIGSES GVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKS VHVVYQQKPGQAPVLVVYEESDRPSGIPERF RLTISKDTSKSQVVLTMTNMDPVDTATYYCARS SGSNSGNTATLTISRVEAGDEADYYCQVWE VVTGGYYYEGMDVWGQGTTVTVSSASTKGPSV GESDHVVFGGGTKLTVLGQPKANPTVTLFP FPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW PSSEELQANKATLVCLISDFYPGAVTVAWKA NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS DGSPVKAGVETTKPSKQSNNKYAASSYLSL SLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTH TPEQWKSHRSYSCQVTHEGSTVEKTVAPT TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPE ECS(SEQIDNO:50) VTCVVVDVSHEDPEVKFNVVYVDGVEVHNAKTK PREEQYNNASRVVSVLTVLHQDWLNGKEYKCK VSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPG(SEQID NO:43)

(249) The present invention further encompasses the following items. The definitions given herein above apply mutatis mutandis. 1. A conjugate comprising an antigen binding protein comprising a) a heavy chain CDR1 comprising a1) NARX.sub.HC34X.sub.HC35VS (SEQ ID NO: 3), wherein X.sub.HC34 is V, F, N, Y, P, S, Q, H, G, D, I, L, R, W, or T, and wherein X.sub.HC35 is G, or a2) a variant of the heavy chain CDR1 of a1) which differs by not more than a total of three amino acid additions, substitutions, and/or deletions from said heavy chain CDR1 with the proviso that the amino acid residues at positions X.sub.HC34 and X.sub.HC35 are not substituted or deleted, b) a heavy chain CDR2 comprising b1) HIX.sub.HC54SNDX.sub.HC58KX.sub.HC60 YSTSLKS (SEQ ID NO: 6), wherein X.sub.HC54 is F, wherein X.sub.HC58 is E, and wherein X.sub.HC60 is S, or b2) a variant of the heavy chain CDR2 of b1) which differs by not more than a total of three amino acid additions, substitutions, and/or deletions from said heavy chain CDR2, with the proviso that the amino acid residues at positions X.sub.HC54, X.sub.HC58, and X.sub.HC60 are not substituted or deleted, c) a heavy chain CDR3 comprising c1) SVX.sub.HC102TX.sub.HC104GYYX.sub.HC108X.sub.HC109GMDV (SEQ ID NO: 8), wherein X.sub.HC109 is E, V, Y, T, F, N, W, L, Q, G, I, M, R, K, or H, X.sub.HC102 is V, X.sub.HC104 is G and X.sub.HC108 IS Y, or c2) a variant of the heavy chain CDR3 of c1) which differs by not more than a total of three amino acid additions, substitutions, and/or deletions from said heavy chain CDR3, with the proviso that the amino acid residues at positions X.sub.HC109, X.sub.HC102, X.sub.HC104 and X.sub.HC108 are not substituted or deleted, d) a light chain CDR1 comprising d1) GGX.sub.LC25NIGSESVH (SEQ ID NO: 11), wherein X.sub.LC25 is S, E, G, K, R, T, Y, F, I, A, L, V, H, Q, W, P, or M, or d2) a variant of the light chain CDR1 of d1) which differs by not more than a total of three amino acid additions, substitutions, and/or deletions from said light chain CDR1 with the proviso that the amino acid residue at position X.sub.LC25 is not substituted or deleted, e) a light chain CDR2 comprising e1) X.sub.LC49X.sub.LC50SDRPS (SEQ ID NO: 14), wherein X.sub.LC49 is S, E, H, N, Y, T, A, F, V, K, L, M, G, R, W, P, or I, and X.sub.LC50 is E, A, S, Q, G, P, V, W, L, T, I, M, H, R, K, F, or Y, or e2) a variant of the light chain CDR2 of e1) which differs by not more than a total of three amino acid additions, substitutions, and/or deletions from said light chain CDR2 with the proviso that the amino acid residues at positions X.sub.LC49 and X.sub.LC50 are not substituted or deleted, and/or f) a light chain CDR3 comprising f1) QVWX.sub.LC91GX.sub.LC93SX.sub.LC95HVV (SEQ ID NO: 19), wherein X.sub.LC91 is E, Q, W, M, R, G, L, H, N, T, F, I, V, S, A, or K, X.sub.LC93 is E, I, L, M, G, W, P, R, D, Y, A, S, V, T or F, and X.sub.LC95 is D, or f2) a variant of the light chain CDR3 of f1) which differs by not more than a total of three amino acid additions, substitutions, and/or deletions from said light chain CDR3 with the proviso that the amino acid residues at positions X.sub.LC91, X.sub.LC93 and X.sub.LC95 are not substituted or deleted, wherein the antigen binding protein is conjugated to at least one GLP-1R agonistic peptide, wherein the GLP-1R agonistic peptide comprises or consists of the amino acid sequence

(250) TABLE-US-00014 (SEQIDNO:61) X.sub.1-G-E-G-T-F-T-S-D-X.sub.10-S-X.sub.12-X.sub.13-L-X.sub.15-X.sub.16-X.sub.17- X.sub.18-X.sub.19-X.sub.20-X.sub.21-F-X.sub.23-E-W-L-X.sub.27-X.sub.28-X.sub.29-G, wherein X.sub.1 is H, Y or F, X.sub.10 is K or L, X.sub.12 is K, I or Q, X.sub.13 is Q or L, X.sub.15 is E, A or D, X.sub.16 is E, K or S, X.sub.17 is E, R or Q, X.sub.18 is L, A or R, X.sub.19 is V, A or F, X.sub.20 is R, H, Q, K or I, X.sub.21 is L, E, H or R, X.sub.23 is I, Y or F, X.sub.27 is I, L, K or E, X.sub.28 is A, K, N or E, and X.sub.29 is G, T, K or V; wherein, optionally, the amino acid sequence further comprises at least one additional amino acid residue at its N-terminus; and wherein, optionally, the amino acid sequence further comprises a peptide extension consisting of up to about 12, about 11 or about 10 amino acid residues at its C-terminus. 2. The conjugate of item 1, wherein the at least one GLP-1R agonistic peptide comprises or consists of the amino acid sequence

(251) TABLE-US-00015 (SEQIDNO:62) H-G-E-G-T-F-T-S-D-X.sub.10-S-K-Q-L-E-E-E-X.sub.18-V-X.sub.20-L- F-I-E-W-L-K-A-X.sub.29-G, wherein X.sub.10 is K or L, X.sub.18 is A or R, X.sub.20 is R or Q, and X.sub.29 is G or T; wherein, optionally, the amino acid sequence further comprises at least one additional amino acid residue at its N-terminus; and wherein, optionally, the amino acid sequence further comprises a peptide extension consisting of up to about 12, about 11 or about 10 amino acid residues at its C-terminus. 3. The conjugate of items 1 and 2, wherein the peptide extension comprises or consists of the amino acid sequence PSSGAPPPS (SEQ ID NO: 63) or PKKIRYS (SEQ ID NO: 64). 4. The conjugate of any one of items 1 to 3, wherein the antigen binding protein is an antibody or antigen binding fragment thereof, and/or wherein the antigen binding protein is conjugated to one, two, three, four, or more GLP-1R agonistic peptides, such as two or four at least one GLP-1R agonistic peptide. 5. The conjugate of item 4, wherein each heavy chain variable region and/or each light chain variable region is conjugated to at least one GLP-1R agonistic peptide. 6. The conjugate of any one of items 1 to 5, wherein the antigen binding protein is conjugated to the at least GLP-1R agonistic peptide via a linker, such as a linker peptide having a length of at least 2 amino acids. 7. The conjugate of any one of items 1 to 6, wherein X.sub.HC34 is V, X.sub.HC109 is E, X.sub.LC25 is S, X.sub.LC49 is S or E, X.sub.LC50 is E or A, X.sub.LC91 is E, and X.sub.LC93 is E, for example, wherein the antigen binding protein comprises i. a heavy chain CDR1 comprising NARVGVS (SEQ ID NO: 4), a heavy chain CDR2 comprising HIFSNDEKSYSTSLKS (SEQ ID NO: 7), a heavy chain CDR3 comprising SVVTGGYYYEGMDV (SEQ ID NO: 9), a light chain CDR1 comprising GGSNIGSESVH (SEQ ID NO: 12), a light chain CDR2 comprising SESDRPS (SEQ ID NO: 15), and a light chain CDR3 comprising QVWEGESDHVV (SEQ ID NO: 20), ii. a heavy chain CDR1 comprising NARVGVS (SEQ ID NO: 4), a heavy chain CDR2 comprising HIFSNDEKSYSTSLKS (SEQ ID NO: 7), a heavy chain CDR3 comprising SVVTGGYYYEGMDV (SEQ ID NO: 9), a light chain CDR1 comprising GGSNIGSESVH (SEQ ID NO: 12), a light chain CDR2 comprising SASDRPS (SEQ ID NO:16), and a light chain CDR3 comprising QVWEGESDHVV (SEQ ID NO: 20), or iii. a heavy chain CDR1 comprising NARVGVS (SEQ ID NO: 4), a heavy chain CDR2 comprising HIFSNDEKSYSTSLKS (SEQ ID NO: 7), a heavy chain CDR3 comprising SVVTGGYYYEGMDV (SEQ ID NO: 9), a light chain CDR1 comprising GGSNIGSESVH (SEQ ID NO: 12), a light chain CDR2 comprising EESDRPS (SEQ ID NO: 17), and a light chain CDR3 comprising QVWEGESDHVV (SEQ ID NO: 20). 8. The conjugate of any one of items 1 to 7, wherein the antigen binding protein comprises i) a heavy chain variable region of QVTLKESGPVLVKPTETLTLTCTVSGFSLNNARX.sub.HC34X.sub.HC35VSWIRQPPGKALEW LAHIX.sub.HC54SNDX.sub.HC58KX.sub.HC60 YSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYY CARSVX.sub.HC102TX.sub.HC104GYYX.sub.HC108X.sub.HC109GMDVWGQGTTVTVSS (SEQ ID NO: 29), or a variant of said heavy chain variable region, said variant being at least 80% identical to said heavy chain variable region with the proviso that the amino acid residues corresponding to positions X.sub.HC34, X.sub.HC35 X.sub.HC54, X.sub.HC58, X.sub.HC60, X.sub.HC109, X.sub.HC102, X.sub.HC104 and X.sub.HC108 are not substituted or deleted in said variant, and ii) a light chain variable region of SYVLTQPPSVSVAPGQTARITCGGX.sub.LC25NIGSESVHWYQQKPGQAPVLVVYX.sub.LC49X.sub.LC50SDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWX.sub.LC91GX.sub.LC93SX.sub.LC95HVV FGGGTKLTVL (SEQ ID NO: 33), or a variant of said light chain variable region, said variant being at least 80% identical to said light chain variable region with the proviso that the amino acid residues corresponding to positions X.sub.LC25, X.sub.LC49, X.sub.LC50, X.sub.LC91, X.sub.LC93 and X.sub.LC95 are not substituted or deleted in said variant. 9. The antigen binding protein of any one of items 1 to 8, comprising a) a heavy chain variable region comprising an amino acid sequence of QVTLKESGPVLVKPTETLTLTCTVSGFSLNNARVGVSWIRQPPGKALEWLAHIF SNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARSVVTGGYYY EGMDVWGQGTTVTVSS (SEQ ID NO: 30), and a light chain variable region comprising an amino acid sequence of SYVLTQPPSVSVAPGQTARITCGGSNIGSESVHWYQQKPGQAPVLVVYSESDR PSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWEGESDHVVFGGGTKLT VL (SEQ ID NO: 34), b) a heavy chain variable region comprising an amino acid sequence of QVTLKESGPVLVKPTETLTLTCTVSGFSLNNARVGVSWIRQPPGKALEWLAHIF SNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARSVVTGGYYY EGMDVWGQGTTVTVSS (SEQ ID NO: 31), and a light chain variable region comprising an amino acid sequence of SYVLTQPPSVSVAPGQTARITCGGSNIGSESVHWYQQKPGQAPVLVVYSASDR PSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWEGESDHVVFGGGTKLT VL (SEQ ID NO: 35), or c) a heavy chain variable region comprising an amino acid sequence of QVTLKESGPVLVKPTETLTLTCTVSGFSLNNARVGVSWIRQPPGKALEWLAHIF SNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARSVVTGGYYY EGMDVWGQGTTVTVSS (SEQ ID NO: 32), and a light chain variable region comprising an amino acid sequence of SYVLTQPPSVSVAPGQTARITCGGSNIGSESVHWYQQKPGQAPVLVVYEESDR PSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWEGESDHVVFGGGTKLT VL (SEQ ID NO: 36). 10. The conjugate of any one of items 1 to 9, wherein the antigen binding protein comprises i) a heavy chain comprising an amino acid sequence of QVTLKESGPVLVKPTETLTLTCTVSGFSLNNARX.sub.HC34X.sub.HC35 VSWIRQPPGKALEWLAHIX.sub.HC54SNDX.sub.HC58KX.sub.HC60 YSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARSVX.sub.HC102 T X.sub.HC104GYYX.sub.HC108X.sub.HC109GMDVWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGC LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNV DHKPSNTKVDKRVESKYGPPCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHY TQKSLSLSLG (SEQ ID NO: 37), or a variant of said heavy chain, said variant being at least 80% identical to said heavy chain with the proviso that the amino acid residues corresponding to positions X.sub.HC34, X.sub.HC35 X.sub.HC54, X.sub.HC58, X.sub.HC60, X.sub.HC109, X.sub.HC102, X.sub.HC104 and X.sub.HC108 are not substituted or deleted in said variant, and ii) a light chain comprising an amino acid sequence of SYVLTQPPSVSVAPGQTARITCGGX.sub.LC25NIGSESVHWYQQKPGQAPVLVVYX.sub.LC49X.sub.LC50S DRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWX.sub.LC91GX.sub.LC93SX.sub.LC95HVVFGGG TKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGV ETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS (SEQ ID NO: 44), or a variant of said light chain, said variant being at least 80% identical to said light chain with the proviso that the amino acid residues corresponding to positions X.sub.LC25, X.sub.LC49, X.sub.LC50, X.sub.LC91, X.sub.LC93 and X.sub.LC95 are not substituted or deleted in said variant, for example, wherein the antigen binding protein comprises a) a heavy chain comprising an amino acid sequence of SEQ ID NO: 38, and a light chain of comprising an amino acid sequence of SEQ ID NO: 45, b) a heavy chain comprising an amino acid sequence of SEQ ID NO: 39, and a light chain comprising an amino acid sequence of SEQ ID NO: 46, c) a heavy chain comprising an amino acid sequence of SEQ ID NO: 40, and a light chain comprising an amino acid sequence of SEQ ID NO: 47, d) a heavy chain comprising an amino acid sequence of SEQ ID NO: 41, and a light chain comprising an amino acid sequence of SEQ ID NO: 48, e) a heavy chain comprising an amino acid sequence of SEQ ID NO: 42, and a light chain comprising an amino acid sequence of SEQ ID NO: 49, or f) a heavy chain of comprising an amino acid sequence of SEQ ID NO: 43, and a light chain of comprising an amino acid sequence of SEQ ID NO: 50. 11. The conjugate of any one of items 1 to 10, wherein the antigen-binding protein is an antibody, or antigen-binding fragment thereof, for example a bivalent antibody and/or or a bivalent antigen-binding fragment. 12. A pharmaceutical composition comprising the conjugate of any one of items 1 to 11 together with a pharmaceutically acceptable carrier and/or excipient. 13. A host cell comprising the polynucleotide encoding the conjugate of any one of items 1 to 11, a vector comprising said polynucleotide, and/or the conjugate of any one of items 1 to 11. 14. A method of producing the conjugate of any one of items 1 to 11, comprising incubating the host cell of item 13 under conditions that allow for expressing said conjugate. 15. The conjugate of any one of items 1 to 11, or the pharmaceutical composition of item 12 for use in the treatment of obesity, being overweight, metabolic syndrome, diabetes mellitus, such as type 2 diabetes mellitus, diabetic retinopathy, hyperglycemia, dyslipidemia, Non-Alcoholic Steatohepatitis (NASH) and/or atherosclerosis.

(252) The present invention is now further described by reference to the following Examples, which are intended to illustrate, and not to limit, the scope of the present invention.

Examples

(253) Materials and Methods

(254) In the studies described herein, antibodies, GLP-peptides and antibody/GLP-peptide fusions were generated. Each generated compound was assigned a unique identifier which consists of letters followed by a number. The letters indicate the type of the compound: Ab is an antibody, P is a peptide, Fu is an antibody/GLP-peptide fusion.

(255) TABLE-US-00016 TABLE A1 Overview on generated antibodies (extract) AB No: IgGFc Variant LC Variant HC Variant Ab0001 IgG1 LALA 16H7 VL 16H7 VH Ab0002 IgG1 16H7 VL 16H7 VH LALA_N297A Ab0003 IgG4 PE 16H7 VL 16H7 VH Ab0004 IgG2 16H7 VL 16H7 VH Ab0006 IgG1 16H7 VL 16H7 VH LALA_NNAS Ab0007 IgG1 16H7 VL 16H7 VH LALA_GASS Ab0505 IgG2 17C3 VL 17C3 VH Ab0179 IgG4 PAA 16H7 VL 16H7 VH Ab0187 IgG4 PE 16H7 VL (N25S) 16H7 VH (M34V, I83T) Ab0188 IgG4 PE 16H7 VL (D49Y) 16H7 VH (M34V, I83T) Ab0189 IgG4 PE 16H7 VL (D50E) 16H7 VH (M34V, I83T) Ab0190 IgG4 PE 16H7 VL (D91T) 16H7 VH (M34V, I83T) Ab0191 IgG4 PE 16H7 VL (N93E) 16H7 VH (M34V, I83T) Ab0192 IgG4 PE 16H7 VL (D95E) 16H7 VH (M34V, I83T) Ab0194 IgG4 PE 16H7 VL (N25S) 16H7 VH (I83T, D109E) Ab0195 IgG4 PE 16H7 VL (D49Y) 16H7 VH (I83T, D109E) Ab0196 IgG4 PE 16H7 VL (D50E) 16H7 VH (I83T, D109E) Ab0197 IgG4 PE 16H7 VL (D91T) 16H7 VH (I83T, D109E) Ab0198 IgG4 PE 16H7 VL (N93E) 16H7 VH (I83T, D109E) Ab0199 IgG4 PE 16H7 VL (D95E) 16H7 VH (I83T, D109E) Ab0201 IgG4 PE 16H7 VL (N25S) 16H7 VH (M34V, I83T, D109E) Ab0202 IgG4 PE 16H7 VL (D49Y) 16H7 VH (M34V, I83T, D109E) Ab0203 IgG4 PE 16H7 VL (D50E) 16H7 VH (M34V, I83T, D109E) Ab0204 IgG4 PE 16H7 VL (D91T) 16H7 VH (M34V, I83T, D109E) Ab0205 IgG4 PE 16H7 VL (N93E) 16H7 VH (M34V, I83T, D109E) Ab0206 IgG4 PE 16H7 VL (D95E) 16H7 VH (M34V, I83T, D109E) Ab0208 IgG4 PE 16H7 VL (N25S) 16H7 VH (I83T, D109Y) Ab0209 IgG4 PE 16H7 VL (D49Y) 16H7 VH (I83T, D109Y) Ab0210 IgG4 PE 16H7 VL (D50E) 16H7 VH (I83T, D109Y) Ab0211 IgG4 PE 16H7 VL (D91T) 16H7 VH (I83T, D109Y) Ab0212 IgG4 PE 16H7 VL (N93E) 16H7 VH (I83T, D109Y) Ab0213 IgG4 PE 16H7 VL (D95E) 16H7 VH (I83T, D109Y) Ab0215 IgG4 PE 16H7 VL (N25S) 16H7 VH (I83T, D109S) Ab0216 IgG4 PE 16H7 VL (D49Y) 16H7 VH (I83T, D109S) Ab0217 IgG4 PE 16H7 VL (D50E) 16H7 VH (I83T, D109S) Ab0218 IgG4 PE 16H7 VL (D91T) 16H7 VH (I83T, D109S) Ab0219 IgG4 PE 16H7 VL (N93E) 16H7 VH (I83T, D109S) Ab0220 IgG4 PE 16H7 VL (D95E) 16H7 VH (I83T, D109S) Ab0180 IgG4 PE 16H7 VL (N25S) 16H7 VH Ab0181 IgG4 PE 16H7 VL (D49Y) 16H7 VH Ab0182 IgG4 PE 16H7 VL (D50E) 16H7 VH Ab0183 IgG4 PE 16H7 VL (D91T) 16H7 VH Ab0184 IgG4 PE 16H7 VL (N93E) 16H7 VH Ab0185 IgG4 PE 16H7 VL (D95E) 16H7 VH Ab0186 IgG4 PE 16H7 VL 16H7 VH (M34V, I83T) Ab0193 IgG4 PE 16H7 VL 16H7 VH (I83T, D109E) Ab0200 IgG4 PE 16H7 VL 16H7 VH (M34V, I83T, D109E) Ab0207 IgG4 PE 16H7 VL 16H7 VH (I83T, D109Y) Ab0214 IgG4 PE 16H7 VL 16H7 VH (I83T, D109S) Ab0221 IgG4 PE 16H7 VL (N25A) 16H7 VH Ab0222 IgG4 PE 16H7 VL (N25T) 16H7 VH Ab0223 IgG4 PE 16H7 VL (D49S) 16H7 VH Ab0224 IgG4 PE 16H7 VL (D49A) 16H7 VH Ab0225 IgG4 PE 16H7 VL (D49E) 16H7 VH Ab0226 IgG4 PE 16H7 VL (D49T) 16H7 VH Ab0227 IgG4 PE 16H7 VL (D50Y) 16H7 VH Ab0228 IgG4 PE 16H7 VL (D50A) 16H7 VH Ab0229 IgG4 PE 16H7 VL (D50H) 16H7 VH Ab0230 IgG4 PE 16H7 VL (D50S) 16H7 VH Ab0231 IgG4 PE 16H7 VL (D91A) 16H7 VH Ab0232 IgG4 PE 16H7 VL (D91E) 16H7 VH Ab0233 IgG4 PE 16H7 VL (D91H) 16H7 VH Ab0234 IgG4 PE 16H7 VL (N93S) 16H7 VH Ab0235 IgG4 PE 16H7 VL(N93D) 16H7 VH Ab0236 IgG4 PE 16H7 VL(N93A) 16H7 VH Ab0237 IgG4 PE 16H7 VL (D95A) 16H7 VH Ab0238 IgG4 PE 16H7 VL (D95S) 16H7 VH Ab0313 IgG4 PE 16H7 VL (D91T, N93E) 16H7 VH (M34V, I83T, D109E) Ab0312 IgG4 PE 16H7 VL (N25S, D49Y, D50E, 16H7 VH (M34V, I83T, D109E) N93E) Ab0295 IgG4 PE 16H7 VL (N25S, D49Y) 16H7 VH (M34V, I83T, D109E) Ab0296 IgG4 PE 16H7 VL (N25S, D50E) 16H7 VH (M34V, I83T, D109E) Ab0297 IgG4 PE 16H7 VL (D49Y, D50E) 16H7 VH (M34V, I83T, D109E) Ab0298 IgG4 PE 16H7 VL (N25S, D49Y, D50E) 16H7 VH (M34V, I83T, D109E) Ab0299 IgG4 PE 16H7 VL (N25S, D91T) 16H7 VH (M34V, I83T, D109E) Ab0300 IgG4 PE 16H7 VL (D49Y, D91T) 16H7 VH (M34V, I83T, D109E) Ab0301 IgG4 PE 16H7 VL (N25S, D49Y, D91T) 16H7 VH (M34V, I83T, D109E) Ab0302 IgG4 PE 16H7 VL (D50E, D91T) 16H7 VH (M34V, I83T, D109E) Ab0303 IgG4 PE 16H7 VL (N25S, D50E, D91T) 16H7 VH (M34V, I83T, D109E) Ab0304 IgG4 PE 16H7 VL (D49Y, D50E, D91T) 16H7 VH (M34V, I83T, D109E) Ab0305 IgG4 PE 16H7 VL (N25S, D49Y, D50E, 16H7 VH (M34V, I83T, D109E) D91T) Ab0306 IgG4 PE 16H7 VL (N25S, N93E) 16H7 VH (M34V, I83T, D109E) Ab0307 IgG4 PE 16H7 VL (D49Y, N93E) 16H7 VH (M34V, I83T, D109E) Ab0308 IgG4 PE 16H7 VL (N25S, D49Y, N93E) 16H7 VH (M34V, I83T, D109E) Ab0309 IgG4 PE 16H7 VL (D50E, N93E) 16H7 VH (M34V, I83T, D109E) Ab0310 IgG4 PE 16H7 VL (N25S, D50E, N93E) 16H7 VH (M34V, I83T, D109E) Ab0311 IgG4 PE 16H7 VL (D49Y, D50E, N93E) 16H7 VH (M34V, I83T, D109E) Ab0314 IgG4 PE 16H7 VL (N25S, D91T, N93E) 16H7 VH (M34V, I83T, D109E) Ab0315 IgG4 PE 16H7 VL (D49Y, D91T, N93E) 16H7 VH (M34V, I83T, D109E) Ab0316 IgG4 PE 16H7 VL (N25S, D49Y, D91T, 16H7 VH (M34V, I83T, D109E) N93E) Ab0317 IgG4 PE 16H7 VL (D50E, D91T, N93E) 16H7 VH (M34V, I83T, D109E) Ab0318 IgG4 PE 16H7 VL (N25S, D50E, D91T, 16H7 VH (M34V, I83T, D109E) N93E) Ab0319 IgG4 PE 16H7 VL (D49Y, D50E, D91T, 16H7 VH (M34V, I83T, D109E) N93E) Ab0320 IgG4 PE 16H7 VL (N25S, D49Y, D50E, 16H7 VH (M34V, I83T, D109E) D91T, N93E) Ab0366 IgG4 PE 16H7 VL (Y48del, S94C, H96C) 16H7 VH (M34V, I83T, D109E) Ab0367 IgG4 PE 16H7 VL (Y48del, S94C, H96C, 16H7 VH (M34V, I83T, D109E) D95E) Ab0368 IgG4 PE 16H7 VL (Y48del, S1C, S94C, 16H7 VH (M34V, I83T, D109E) H96C) Ab0369 IgG4 PE 16H7 VL (Y48del, S1C, S94C, 16H7 VH (M34V, I83T, D109E) D95E, H96C) Ab0370 IgG4 PE 16H7 VL (Y48del, W90H) 16H7 VH (M34V, H52W, I83T, D109E) Ab0371 IgG4 PE 16H7 VL (Y48del, D95E, W90H) 16H7 VH (M34V, H52W, I83T, D109E) Ab0372 IgG4 PE 16H7 VL (Y48del, D95E, W90H, 16H7 VH (M34V, H52W, I83T, S1C, S94C) D109E) Ab0373 IgG4 PE 16H7 VL (Y48del, D95E, W90H, 16H7 VH (M34V, H52W, I83T, S94C, H96C) D109E) Ab0374 IgG4 PE 16H7 VL (Y48del, D95E, W90F) 16H7 VH (M34V, F54W, I83T, D109E) Ab0375 IgG4 PE 16H7 VL (Y48del, D95E, W90F, 16H7 VH (M34V, F54W, I83T, S1C, S94C) D109E) Ab0376 IgG4 PE 16H7 VL (Y48del, D95E, W90F, 16H7 VH (M34V, F54W, I83T, S94C, H96C) D109E) Ab0377 IgG4 PE 16H7 VL (Y48del, D95V, W90F) 16H7 VH (M34V, F54W, I83T, D109E) Ab0378 IgG4 PE 16H7 VL (Y48del, D95V, W90F) 16H7 VH (M34V, H52S, F54W, I83T, D109E) Ab0379 IgG4 PE 16H7 VL (Y48del, D95V, W90F, 16H7 VH (M34V, F54W, I83T, S1C, S94C) D109E) Ab0380 IgG4 PE 16H7 VL (Y48del, D95V, W90F, 16H7 VH (M34V, H52S, F54W, S1C, S94C) I83T, D109E) Ab0381 IgG4 PE 16H7 VL (Y48del, D95V, W90F, 16H7 VH (M34V, F54W, I83T, S94C, H96C) D109E) Ab0382 IgG4 PE 16H7 VL (Y48del, D95V, W90F, 16H7 VH (M34V, H52S, F54W, S94C, H96C) I83T, D109E) Ab0383 IgG4 PE 16H7 VL (Y48del, D95V, W90F) 16H7 VH (M34V, H52W, I83T, D109E) Ab0386 IgG4 PE 16H7 VL (D95S, W90F) 16H7 VH (M34V, F54W, I83T, D109E) Ab0389 IgG4 PE 16H7 VL (Y48del, D95S, W90F, 16H7 VH (M34V, H52S, F54W, S1C, S94C) I83T, D109E) Ab0390 IgG4 PE 16H7 VL (Y48del, D95S, W90F, 16H7 VH (M34V, F54W, I83T, S94C, H96C) D109E) Ab0391 IgG4 PE 16H7 VL (Y48del, D95S, W90F, 16H7 VH (M34V, H52S, F54W, S94C, H96C) I83T, D109E) Ab0392 IgG4 PE 16H7 VL (Y48del, D95S, W90F) 16H7 VH (M34V, H52W, I83T, D109E) Ab0393 IgG4 PE 16H7 VL (Y48del, D95S, W90F, 16H7 VH (M34V, H52W, I83T, S94C, H96C) D109E) Ab0394 IgG4 PE 16H7 VL (Y48del, D95S, W90F, 16H7 VH (M34V, H52W, I83T, S1C, S94C) D109E) Ab0395 IgG4 PE 16H7 VL (Y48del, D95A, W90F) 16H7 VH (M34V, F54W, I83T, D109E) Ab0396 IgG4 PE 16H7 VL (Y48del, D95A, W90F) 16H7 VH (M34V, H52S, F54W, I83T, D109E) Ab0397 IgG4 PE 16H7 VL (Y48del, D95A, W90F, 16H7 VH (M34V, F54W, I83T, S1C, S94C) D109E) Ab0398 IgG4 PE 16H7 VL (Y48del, D95A, W90F, 16H7 VH (M34V, H52S, F54W, S1C, S94C) I83T, D109E) Ab0399 IgG4 PE 16H7 VL (Y48del, D95A, W90F, 16H7 VH (M34V, F54W, I83T, S94C, H96C) D109E) Ab0400 IgG4 PE 16H7 VL (Y48del, D95A, W90F, 16H7 VH (M34V, H52S, F54W, S94C, H96C) I83T, D109E) Ab0401 IgG4 PE 16H7 VL (Y48del, D95A, W90F) 16H7 VH (M34V, H52W, I83T, D109E) Ab0402 IgG4 PE 16H7 VL (Y48del, D95A, W90F, 16H7 VH (M34V, H52W, I83T, S94C, H96C) D109E) Ab0403 IgG4 PE 16H7 VL (Y48del, D95A, W90F, 16H7 VH (M34V, H52W, I83T, S1C, S94C) D109E) Ab0404 IgG4 PE 16H7 VL (Y48del, D95T, W90F) 16H7 VH (M34V, F54W, I83T, D109E) Ab0405 IgG4 PE 16H7 VL (Y48del, D95T, W90F) 16H7 VH (M34V, H52S, F54W, I83T, D109E) Ab0406 IgG4 PE 16H7 VL (Y48del, D95T, W90F, 16H7 VH (M34V, H52S, F54W, S1C, S94C) I83T, D109E) Ab0407 IgG4 PE 16H7 VL (Y48del, D95T, W90F, 16H7 VH (M34V, F54W, I83T, S94C, H96C) D109E) Ab0408 IgG4 PE 16H7 VL (Y48del, D95T, W90F) 16H7 VH (M34V, H52W, I83T, D109E) Ab0409 IgG4 PE 16H7 VL (Y48del, D95T, W90F, 16H7 VH (M34V, H52W, I83T, S94C, H96C) D109E) Ab0410 IgG4 PE 16H7 VL (Y48del, D95S, W90Y) 16H7 VH (M34V, I83T, D109E) Ab0411 IgG4 PE 16H7 VL (Y48del, D95S, W90Y, 16H7 VH (M34V, I83T, D109E) S94C, H96C) Ab0415 IgG4 PE 16H7 VL (N25S, D49Y, D50E, 16H7 VH (M34V, I83T, D109E) D91A, N93E) Ab0416 IgG4 PE 16H7 VL (N25S, D49Y, D50E, 16H7 VH (M34V, I83T, D109E) D91E, N93E) Ab0417 IgG4 PE 16H7 VL (N25S, D49Y, D50E, 16H7 VH (M34V, I83T, D109E) D91H, N93E) Ab0326 IgG4 PE 16H7 VL (N25S, D49Y, D50E, 16H7 VH (M34V, I83T, D109E) D91E, N93S) Ab0327 IgG4 PE 16H7 VL (N25S, D49Y, D50Y, 16H7 VH (M34V, I83T, D109E) D91E, N93E) Ab0328 IgG4 PE 16H7 VL (N25S, D49Y, D50A, 16H7 VH (M34V, I83T, D109E) D91A, N93S) Ab0329 IgG4 PE 16H7 VL (N25S, D49Y, D50S, 16H7 VH (M34V, I83T, D109E) D91A, N93S) Ab0330 IgG4 PE 16H7 VL (N25S, D49S, D50E, 16H7 VH (M34V, I83T, D109E) D91A, N93E) Ab0331 IgG4 PE 16H7 VL (N25S, D49S, D50E, 16H7 VH (M34V, I83T, D109E) D91E, N93E) Ab0332 IgG4 PE 16H7 VL (N25S, D49S, D50E, 16H7 VH (M34V, I83T, D109E) D91E, N93A) Ab0333 IgG4 PE 16H7 VL (N25S, D49S, D50Y, 16H7 VH (M34V, I83T, D109E) D91A, N93S) Ab0334 IgG4 PE 16H7 VL (N25S, D49S, D50A, 16H7 VH (M34V, I83T, D109E) D91A, N93S) Ab0335 IgG4 PE 16H7 VL (N25S, D49S, D50A, 16H7 VH (M34V, I83T, D109E) D91E, N93E) Ab0336 IgG4 PE 16H7 VL (N25S, D49S, D50H, 16H7 VH (M34V, I83T, D109E) D91A, N93S) Ab0337 IgG4 PE 16H7 VL (N25S, D49S, D50H, 16H7 VH (M34V, I83T, D109E) D91E, N93E) Ab0338 IgG4 PE 16H7 VL (N25S, D49S, D50S, 16H7 VH (M34V, I83T, D109E) D91A, N93S) Ab0339 IgG4 PE 16H7 VL (N25S, D49A, D50E, 16H7 VH (M34V, I83T, D109E) D91A, N93S) Ab0340 IgG4 PE 16H7 VL (N25S, D49A, D50E, 16H7 VH (M34V, I83T, D109E) D91E, N93S) Ab0341 IgG4 PE 16H7 VL (N25S, D49A, D50Y, 16H7 VH (M34V, I83T, D109E) D91A, N93S) Ab0342 IgG4 PE 16H7 VL (N25S, D49A, D50A, 16H7 VH (M34V, I83T, D109E) D91A, N93E) Ab0343 IgG4 PE 16H7 VL (N25S, D49A, D50A, 16H7 VH (M34V, I83T, D109E) D91A, N93S) Ab0344 IgG4 PE 16H7 VL (N25S, D49A, D50A, 16H7 VH (M34V, I83T, D109E) D91E, N93S) Ab0345 IgG4 PE 16H7 VL (N25S, D49A, D50A, 16H7 VH (M34V, I83T, D109E) D91E, N93A) Ab0346 IgG4 PE 16H7 VL (N25S, D49A, D50H, 16H7 VH (M34V, I83T, D109E) D91A, N93S) Ab0347 IgG4 PE 16H7 VL (N25S, D49A, D50S, 16H7 VH (M34V, I83T, D109E) D91A, N93S) Ab0348 IgG4 PE 16H7 VL (N25S, D49E, D50E, 16H7 VH (M34V, I83T, D109E) D91T, N93E) Ab0349 IgG4 PE 16H7 VL (N25S, D49E, D50E, 16H7 VH (M34V, I83T, D109E) D91T, N93S) Ab0350 IgG4 PE 16H7 VL (N25S, D49E, D50E, 16H7 VH (M34V, I83T, D109E) D91A, N93S) Ab0351 IgG4 PE 16H7 VL (N25S, D49E, D50E, 16H7 VH (M34V, I83T, D109E) D91E, N93E) Ab0352 IgG4 PE 16H7 VL (N25S, D49E, D50E, 16H7 VH (M34V, I83T, D109E) D91E, N93S) Ab0353 IgG4 PE 16H7 VL (N25S, D49E, D50E, 16H7 VH (M34V, I83T, D109E) D91E, N93A) Ab0354 IgG4 PE 16H7 VL (N25S, D49E, D50E, 16H7 VH (M34V, I83T, D109E) D91H, N93S) Ab0355 IgG4 PE 16H7 VL (N25S, D49E, D50Y, 16H7 VH (M34V, I83T, D109E) D91E, N93S) Ab0356 IgG4 PE 16H7 VL (N25S, D49E, D50A, 16H7 VH (M34V, I83T, D109E) D91A, N93S) Ab0357 IgG4 PE 16H7 VL (N25S, D49E, D50A, 16H7 VH (M34V, I83T, D109E) D91E, N93S) Ab0358 IgG4 PE 16H7 VL (N25S, D49E, D50A, 16H7 VH (M34V, I83T, D109E) D91H, N93S) Ab0359 IgG4 PE 16H7 VL (N25S, D49E, D50H, 16H7 VH (M34V, I83T, D109E) D91A, N93S) Ab0360 IgG4 PE 16H7 VL (N25S, D49E, D50H, 16H7 VH (M34V, I83T, D109E) D91E, N93S) Ab0361 IgG4 PE 16H7 VL (N25S, D49E, D50S, 16H7 VH (M34V, I83T, D109E) D91E, N93S) Ab0362 IgG4 PE 16H7 VL (N25S, D49T, D50E, 16H7 VH (M34V, I83T, D109E) D91A, N93S) Ab0363 IgG4 PE 16H7 VL (N25A, D49S, D50A, 16H7 VH (M34V, I83T, D109E) D91A, N93A) Ab0364 IgG4 PE 16H7 VL (N25A, D49E, D50E, 16H7 VH (M34V, I83T, D109E) D91E, N93S) Ab0365 IgG4 PE 16H7 VL (N25A, D49T, D50E, 16H7 VH (M34V, I83T, D109E) D91A, N93S) Ab0428 IgG1 NNAS 16H7 VL (N25S, D49S, D50E, 16H7 VH (M34V, I83T, D109E) D91E, N93E) Ab0429 IgG1 NNAS 16H7 VL (N25S, D49S, D50A, 16H7 VH (M34V, I83T, D109E) D91E, N93E) Ab0430 IgG1 NNAS 16H7 VL (N25S, D49E, D50E, 16H7 VH (M34V, I83T, D109E) D91E, N93E) Ab0423 IgG4 PE 16H7 VL (N25S, D49S, D50S, 16H7 VH (M34V, I83T, D109E) D91E, N93A) Ab0424 IgG4 PE 16H7 VL (N25S, D49S, D50S, 16H7 VH (M34V, I83T, D109E) D91H, N93A) Ab0431 IgG1 NNAS 16H7 VL 16H7 VH (M34V, I83T, D109E) Ab0453 IgG4 PE 16H7 VL (N25S, D49S, D50E, 16H7 VH (N30S, M34V, I83T, D91E, N93E) D109E) Ab0454 IgG4 PE 16H7 VL (N25S, D49S, D50E, 16H7 VH (N30T, M34V, I83T, D91E, N93E) D109E) Ab0455 IgG4 PE 16H7 VL (N25S, D49S, D50E, 16H7 VH (N30S, N31Y, M34V, D91E, N93E) I83T, D109E) Ab0456 IgG4 PE 16H7 VL (N25S, D49S, D50E, 16H7 VH (N30T, N31Y, M34V, D91E, N93E) I83T, D109E) Ab0457 IgG4 PE 16H7 VL (N25S, D49S, D50A, 16H7 VH (N30S, M34V, I83T, D91E, N93E) D109E) Ab0458 IgG4 PE 16H7 VL (N25S, D49S, D50A, 16H7 VH (N30T, M34V, I83T, D91E, N93E) D109E) Ab0459 IgG4 PE 16H7 VL (N25S, D49S, D50A, 16H7 VH (N30S, N31Y, M34V, D91E, N93E) I83T, D109E) Ab0460 IgG4 PE 16H7 VL (N25S, D49S, D50A, 16H7 VH (N30T, N31Y, M34V, D91E, N93E) I83T, D109E) Ab0461 IgG4 PE 16H7 VL (N25S, D49E, D50E, 16H7 VH (N30S, M34V, I83T, D91E, N93E) D109E) Ab0462 IgG4 PE 16H7 VL (N25S, D49E, D50E, 16H7 VH (N30T, M34V, I83T, D91E, N93E) D109E) Ab0463 IgG4 PE 16H7 VL (N25S, D49E, D50E, 16H7 VH (N30S, N31Y, M34V, D91E, N93E) I83T, D109E) Ab0464 IgG4 PE 16H7 VL (N25S, D49E, D50E, 16H7 VH (N30T, N31Y, M34V, D91E, N93E) I83T, D109E) Explanations: The column LC Variant describes the light chain of the tested antibody. 16H7 VL is the light chain of the reference antibody 16H7 (SEQ ID NO: 2, FIG. 1). Information on amino acid substitutions and/or deletions in the light chain as compared to light chain of 16H7 is provided in brackets. The column HC Variant describes the heavy chain of the tested antibody. 16H7 VH is the heavy chain variable domain of the reference antibody 16H7 (SEQ ID NO: 1, FIG. 1). Information on amino acid substitutions and deletions as compared to 16H7 is provided in brackets. The column IgGFc Variant provides information on the Fc backbone of the heavy chain. The reference antibody 16H7 contains an IgG2 backbone (see FIG. 1, Ab0004). In the other tested antibodies, the IgG2 backbone of 16H7 was replaced with one of the following backbones: IgG1 LALA, IgG1 LALA_N297A, IgG4 PE, IgG1 LALA_NNAS, IgG1 LALA_GASS, IgG4 PAA and IgG1 NNAS. The amino acid sequences of the tested Fc backbones are provided in Table A2. Ab0004 corresponds to 16H7 as disclosed in WO 2011/071783. Ab0505 is 17C3 as disclosed in WO 2011/071783 A1.

(256) TABLE-US-00017 TABLEA2 AminoacidsequencesofFcbackbonesoftheantibodies inTableA1 SEQID IgGFcVariant Aminoacidsequence NO IgG1LALA EPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPE 110 VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTIPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPG IgG1LALA_N297A EPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPE 111 VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYAST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTIPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPG IgG4PE ESKYGPPCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTC 112 VVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPRE PQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQP ENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH EALHNHYTQKSLSLSLG IgG2 ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCV 113 VVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVV SVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPGK IgG1LALA_NNAS EPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPE 114 VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNNA SRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTIPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPG IgG1LALA_GASS EPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPE 115 VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKGLASSIEKTISKAKGQ PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTIPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPG IgG4PAA ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTC 116 VVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPRE PQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQP ENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH EALHNHYTQKSLSLSLG IgG1NNAS EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPE 117 VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNNA SRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTIPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPG

(257) TABLE-US-00018 TABLEA3 OverviewonGLP-1peptides Peptide SEQ No(Pep ID No) Sequence NO P001 HGEGTFTSDVSSYLEEQAAKEFIAWLVK 69 P002 HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 70 P003 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 71 P004 HGEGTFTSDLSKQMEEEAVRLFIEWLKNGG 72 P005 HGEGTFTSDLSIQLDEEAVRLFIEWLLATGPVSGAPPPS 73 P006 HGEGTFTSDLSIQLDEEAVRLFIEWLEATGPVSGAPPPS 74 P007 HGEGTFTSDLSKQLEEEAVQLFIEWLEATGPSSGAPPPS 75 P008 HGEGTFTSDLSKQLEEERVQLFIEWLKATGPSSGAPPPS 76 P009 HGEGTFTSDLSKQLEEEAVQLFIEWLLATG 77 P010 HGEGTFTSDLSKQLEEEAVQLFIEWLLATGPSSGAPPPS 78 P011 HGEGTFTSDLSKQLEEEAVQLFIEWLLATGPSSGEPPPES 79 P012 HGEGTFTSDLSKQLEEEAVQLFIEWLLATGPSSGEPPPEG 80 P013 GHGEGTFTSDLSKQLEEEAVRLFIEWLKAGGPKKIRYS 81 P014 GHGEGTFTSDKSKQLEEEAVRLFIEWLKAGGPKKIRYS 82 P015 GHGEGTFTSDLSKQLEEEAVQLFIEWLKAGGPKKIRYS 83 P016 GHGEGTFTSDLSIQLEEEAVRLFIEWLLAGGPKKQRLS 84 P017 GHGEGTFTSDLSKQLEEEAVRLFIEWLKAGGPSSGAPPPS 85 P018 GHGEGTFTSDLSKQLEEERVQEFIEWLVKGRPSSGAPPPS 86 P019 GHGEGTFTSDLSIQLEEEAVRLFIEWLLAGGPSSGAPPPS 87 P020 GHGEGTFTSDLSIQLEEEAVRLFIEWLLATGPSSGAPPPS 88 P021 GHGEGTFTSDKSKQLEEEAVRLFIEWLKAGGPSSGAPPPS 89 P022 GHGEGTFTSDLSKQLEEEAVQLFIEWLKAGGPSSGAPPPS 90 P023 HGEGTFTSDKSKQLEKRLVRLFILWLIAGGHSSGKPPPK 91 P024 HGEGTFTSDKSKQLEKRLVRLFIYWLIAGGHSSGKPPPK 92 P025 HGEGTFTSDLSKQLEKRLQRLFIYWLIAGGHSSGKPPPK 93 P026 HGEGTFTSDLSKQLEKRLQRLFIYWLKAGGHSSGKPPPK 94 P027 HGEGTFTSDLSKLLEKRAVHEFIEWLIAGGPSSGKPPPK 95 P028 HGEGTFTSDLSKLLEKRAQHEFIEWLIAGGPSSGKPPPK 96 P029 HGEGTFTSDLSKLLEKRAVHEFIEWLKAGGPSSGKPPPK 97 P030 HGEGTFTSDLSKLLEKRAQHEFIEWLKAGGPSSGKPPPK 98 P031 HGEGTFTSDLSELLEKRAQHEFIEWLIAGGPSSGKPPPK 99 P032 HGEGTFTSDLSELLEKRAQHEFIEWLKAGGPSSGKPPPK 100 P033 HGEGTFTSDLSILCEKRAVHEFIEWLIAGGPSSGKPPPK 101 PGC P034 HGEGTFTSDLSILCEKRAVHEFIEWLKAGGPSSGKPPPK 102 PGC P035 HGEGTFTSDLSKQCEEERVQLFIEWLKATGPSSGKPPPK 103 PGC P036 GHGEGTFTSDLSKQLEEEAQRLFIEWLKAGGPSSGKPPPK 104 P037 GHGEGTFTSDLSKQLEEEAQHLFIEWLKAGGPSSGKPPPK 105 P038 GHGEGTFTSDLSKQLEEEAVQLFIEWLKAGGPSSGKPPPK 106 P039 GHGEGTFTSDLSKQLEEEAVRLFIAWLVK 107 P040 GHGEGTFTSDKSKQLEEEAVRLFIAWLVK 108 P041 GHGEGTFTSDLSKQLEEEAVQLFIAWLVK 109 The chemically synthesized peptides are modified with a C-terminal amide (NH.sub.2 group at the carboxyl terminal end).

(258) TABLE-US-00019 TABLE A4 Overview on generated Fusion antibodies Antibody Peptide component component Fusion (AB No (Pep No Number according to Backbone mAB according to Fusion (Fu No) Table A1) type type Table A3) variant Fu0008 Ab0001 IgG1 LALA 16H7 P002 HC Fu0009 Ab0001 IgG1 LALA 16H7 P001 HC Fu0010 Ab0001 IgG1 LALA 16H7 P008 HC Fu0012 Ab0001 IgG1 LALA 16H7 P035 HC Fu0013 Ab0001 IgG1 LALA 16H7 P014 HC Fu0014 Ab0001 IgG1 LALA 16H7 P040 HC Fu0015 Ab0001 IgG1 LALA 16H7 P021 HC Fu0016 Ab0001 IgG1 LALA 16H7 P017 HC Fu0017 Ab0001 IgG1 LALA 16H7 P036 HC Fu0018 Ab0001 IgG1 LALA 16H7 P037 HC Fu0020 Ab0001 IgG1 LALA 16H7 P024 HC Fu0022 Ab0001 IgG1 LALA 16H7 P026 HC Fu0023 Ab0001 IgG1 LALA 16H7 P013 HC Fu0024 Ab0001 IgG1 LALA 16H7 P039 HC Fu0025 Ab0001 IgG1 LALA 16H7 P015 HC Fu0026 Ab0001 IgG1 LALA 16H7 P041 HC Fu0027 Ab0001 IgG1 LALA 16H7 P022 HC Fu0028 Ab0001 IgG1 LALA 16H7 P038 HC Fu0031 Ab0001 IgG1 LALA 16H7 P033 HC Fu0032 Ab0001 IgG1 LALA 16H7 P027 HC Fu0033 Ab0001 IgG1 LALA 16H7 P028 HC Fu0034 Ab0001 IgG1 LALA 16H7 P031 HC Fu0035 Ab0001 IgG1 LALA 16H7 P034 HC Fu0036 Ab0001 IgG1 LALA 16H7 P029 HC Fu0037 Ab0001 IgG1 LALA 16H7 P030 HC Fu0038 Ab0001 IgG1 LALA 16H7 P032 HC Fu0039 Ab0001 IgG1 LALA 16H7 P003 LC Fu0040 Ab0001 IgG1 LALA 16H7 P002 LC Fu0041 Ab0001 IgG1 LALA 16H7 P001 LC Fu0042 Ab0001 IgG1 LALA 16H7 P008 LC Fu0044 Ab0001 IgG1 LALA 16H7 P035 LC Fu0045 Ab0001 IgG1 LALA 16H7 P014 LC Fu0047 Ab0001 IgG1 LALA 16H7 P021 LC Fu0048 Ab0001 IgG1 LALA 16H7 P017 LC Fu0049 Ab0001 IgG1 LALA 16H7 P036 LC Fu0050 Ab0001 IgG1 LALA 16H7 P037 LC Fu0052 Ab0001 IgG1 LALA 16H7 P024 LC Fu0053 Ab0001 IgG1 LALA 16H7 P025 LC Fu0054 Ab0001 IgG1 LALA 16H7 P026 LC Fu0057 Ab0001 IgG1 LALA 16H7 P015 LC Fu0059 Ab0001 IgG1 LALA 16H7 P022 LC Fu0060 Ab0001 IgG1 LALA 16H7 P038 LC Fu0063 Ab0001 IgG1 LALA 16H7 P033 LC Fu0064 Ab0001 IgG1 LALA 16H7 P027 LC Fu0065 Ab0001 IgG1 LALA 16H7 P028 LC Fu0067 Ab0001 IgG1 LALA 16H7 P034 LC Fu0068 Ab0001 IgG1 LALA 16H7 P029 LC Fu0069 Ab0001 IgG1 LALA 16H7 P030 LC Fu0070 Ab0001 IgG1 LALA 16H7 P032 LC Fu0071 Ab0001 IgG1 LALA 16H7 P003 HC + LC Fu0072 Ab0001 IgG1 LALA 16H7 P002 HC + LC Fu0073 Ab0001 IgG1 LALA 16H7 P001 HC + LC Fu0074 Ab0001 IgG1 LALA 16H7 P008 HC + LC Fu0076 Ab0001 IgG1 LALA 16H7 P035 HC + LC Fu0077 Ab0001 IgG1 LALA 16H7 P014 HC + LC Fu0079 Ab0001 IgG1 LALA 16H7 P021 HC + LC Fu0081 Ab0001 IgG1 LALA 16H7 P036 HC + LC Fu0082 Ab0001 IgG1 LALA 16H7 P037 HC + LC Fu0087 Ab0001 IgG1 LALA 16H7 P013 HC + LC Fu0089 Ab0001 IgG1 LALA 16H7 P015 HC + LC Fu0090 Ab0001 IgG1 LALA 16H7 P041 HC + LC Fu0092 Ab0001 IgG1 LALA 16H7 P038 HC + LC Fu0095 Ab0001 IgG1 LALA 16H7 P033 HC + LC Fu0096 Ab0001 IgG1 LALA 16H7 P027 HC + LC Fu0097 Ab0001 IgG1 LALA 16H7 P028 HC + LC Fu0098 Ab0001 IgG1 LALA 16H7 P031 HC + LC Fu0099 Ab0001 IgG1 LALA 16H7 P034 HC + LC Fu0100 Ab0001 IgG1 LALA 16H7 P029 HC + LC Fu0101 Ab0001 IgG1 LALA 16H7 P030 HC + LC Fu0102 Ab0001 IgG1 LALA 16H7 P032 HC + LC Fu0103 Ab0001 IgG1 LALA 16H7 P003 HC Fu0104 Ab0003 IgG4 PE 16H7 P002 HC Fu0105 Ab0003 IgG4 PE 16H7 P001 HC Fu0106 Ab0003 IgG4 PE 16H7 P008 HC Fu0107 Ab0003 IgG4 PE 16H7 P014 HC Fu0108 Ab0003 IgG4 PE 16H7 P023 HC Fu0109 Ab0003 IgG4 PE 16H7 P024 HC Fu0110 Ab0003 IgG4 PE 16H7 P013 HC Fu0111 Ab0003 IgG4 PE 16H7 P015 LC Fu0112 Ab0003 IgG4 PE 16H7 P002 LC Fu0113 Ab0003 IgG4 PE 16H7 P001 LC Fu0114 Ab0003 IgG4 PE 16H7 P008 LC Fu0119 Ab0003 IgG4 PE 16H7 P015 HC + LC Fu0120 Ab0003 IgG4 PE 16H7 P002 HC + LC Fu0121 Ab0003 IgG4 PE 16H7 P001 HC + LC Fu0122 Ab0003 IgG4 PE 16H7 P008 HC + LC Fu0123 Ab0003 IgG4 PE 16H7 P014 HC + LC Fu0126 Ab0003 IgG4 PE 16H7 P013 HC + LC Fu0127 Ab0003 IgG4 PE 16H7 P015 HC Fu0128 Ab0006 IgG1 NNAS 16H7 P002 HC Fu0129 Ab0006 IgG1 NNAS 16H7 P001 HC Fu0130 Ab0006 IgG1 NNAS 16H7 P008 HC Fu0131 Ab0006 IgG1 NNAS 16H7 P014 HC Fu0132 Ab0006 IgG1 NNAS 16H7 P023 HC Fu0133 Ab0006 IgG1 NNAS 16H7 P024 HC Fu0134 Ab0006 IgG1 NNAS 16H7 P013 HC Fu0135 Ab0006 IgG1 NNAS 16H7 P015 LC Fu0136 Ab0006 IgG1 NNAS 16H7 P002 LC Fu0137 Ab0006 IgG1 NNAS 16H7 P001 LC Fu0138 Ab0006 IgG1 NNAS 16H7 P008 LC Fu0139 Ab0006 IgG1 NNAS 16H7 P014 LC Fu0140 Ab0006 IgG1 NNAS 16H7 P023 LC Fu0141 Ab0006 IgG1 NNAS 16H7 P024 LC Fu0142 Ab0006 IgG1 NNAS 16H7 P013 LC Fu0143 Ab0006 IgG1 NNAS 16H7 P015 HC + LC Fu0144 Ab0006 IgG1 NNAS 16H7 P002 HC + LC Fu0147 Ab0006 IgG1 NNAS 16H7 P014 HC + LC Fu0148 Ab0006 IgG1 NNAS 16H7 P023 HC + LC Fu0150 Ab0006 IgG1 NNAS 16H7 P013 HC + LC Fu0151 Ab0006 IgG1 NNAS 16H7 P015 HC Fu0176 Ab0004 IgG2 16H7 P001 HC Fu0177 Ab0004 IgG2 16H7 P014 HC Fu0178 Ab0004 IgG2 16H7 P008 HC Fu0239 Ab0004 IgG2 16H7 P002 HC Fu0240 Ab0004 IgG2 16H7 P010 HC Fu0242 Ab0004 IgG2 16H7 P020 HC Fu0243 Ab0004 IgG2 16H7 P005 HC Fu0244 Ab0004 IgG2 16H7 P006 HC Fu0245 Ab0004 IgG2 16H7 P011 HC Fu0246 Ab0004 IgG2 16H7 P004 HC Fu0247 Ab0004 IgG2 16H7 P009 HC Fu0248 Ab0004 IgG2 16H7 P012 HC Fu0249 Ab0004 IgG2 16H7 P018 HC Fu0250 Ab0004 IgG2 16H7 P007 HC Fu0251 Ab0004 IgG2 16H7 P016 LC Fu0252 Ab0004 IgG2 16H7 P002 LC Fu0253 Ab0004 IgG2 16H7 P010 LC Fu0254 Ab0004 IgG2 16H7 P019 LC Fu0259 Ab0004 IgG2 16H7 P004 LC Fu0262 Ab0004 IgG2 16H7 P018 LC Fu0263 Ab0004 IgG2 16H7 P007 HC + LC Fu0265 Ab0004 IgG2 16H7 P002 HC + LC Fu0272 Ab0004 IgG2 16H7 P004 HC + LC Fu0275 Ab0004 IgG2 16H7 P018 HC + LC Fu0276 Ab0004 IgG2 16H7 P007 HC Fu0507 Ab0505 IgG2 17C3 P014 HC Fu0508 Ab0505 IgG2 17C3 P008 HC Fu0506 Ab0505 IgG2 17C3 P001 HC Explanation: The column Antibody component provides information on the antibody component of the fusion antibody. Further information on the antibody component can be found in Table A1. The column Peptide component provides information on the GLP-component of the fusion antibody. Further information on the peptide component can be found in Table A3. The column fusion variant provides information on whether the peptide component has been fused to the light chains (LC), to the heavy chains (HC), or both to the light chain and heavy chain (HC + LC) of the antibody component via a peptide linker. The sequence of an exemplary fusion antibody, Fu0077, is shown in FIG. 20. Fu0077 comprises the GLP-peptide designated P014 as GLP-peptide compound which is fused to the N-terminal end of the light chain and the heavy chain of the antibody designated Ab0001 via a linker peptide. Since the antibody comprises two light chains and two heavy chains, the fusion peptide comprises four peptide compounds. A schematic drawing of the generated fusion antibodies is provided in FIG. 21.

(259) Abbreviations employed are as follows: AA amino acid ACN acetonitrile AUC Area under the curve CAMP cyclic adenosine monophosphate Boc tert-butyloxycarbonyl BOP (benzotriazol-1-yloxy)tris(dimethylamino)phosphonium hexafluorophosphate BSA bovine serum albumin BW body weight tBu tertiary butyl CV column volume DCM dichloromethane DIC N,N-diisopropylcarbodiimide DIPEA N, N-diisopropylethylamine dl deciliter DMEM Dulbecco's modified Eagle's medium DMF dimethyl formamide DMS dimethylsulfide DPBS Dulbecco's phosphate-buffered saline EDT ethanedithiol EDTA ethylenediaminetetraacetic acid eq equivalents FA formic acid FBS fetal bovine serum Fmoc fluorenylmethyloxycarbonyl g gram GIPR GIP receptor GIP glucose-dependent insulinotropic polypeptide GLP-1 glucagon-like peptide 1 GLP-1R GLP-1 receptor GCG glucagon GCGR glucagon receptor HATU O-(7-azabenzotriazol-1-yl)-N,N,N,N-tetramethyluronium hexafluorophosphate HBSS Hanks' Balanced Salt Solution HBTU 2-(1H-benzotriazol-1-yl)-1,1,3,3-tetramethyl-uronium hexafluorophosphate HEPES 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid HOAt 1-hydroxy-7-azabenzotriazole HOBt 1-hydroxybenzotriazole HOSu N-hydroxysuccinimide HPLC High Performance Liquid Chromatography HSA human serum albumin HTRF Homogenous Time Resolved Fluorescence kg kilogram l liter LC/MS Liquid Chromatography/Mass Spectrometry M molar MBHA 4-methylbenzhydrylamine min minute(s) ml milliliter mm millimeter ?m micrometer mM millimolar millimole(s) mmol n.a. not available n.d. not determined nM nanomolar nm nanometer nmol nanomole(s) ?mol micromole(s) NMP N-methyl pyrrolidone Pbf 2,2,4,6,7-pentamethyldihydro-benzofuran-5-sulfonyl PBS phosphate buffered saline PEG polyethylene glycol pM picomolar RCF relative centrifugal acceleration RP-HPLC reversed-phase high performance liquid chromatography rpm revolutions per minute S.C. subcutaneous SD standard deviation sec second(s) SEM standard error of the mean TFA trifluoroacetic acid TIS/TIPS triisopropylsilane Trt trityl/triphenylmethyl TSTU N,N,N,N-tetramethyl-O(N-succinimidyl)uronium tetrafluoroborate UHPLC Ultra High Performance Liquid Chromatography/Ultra high pressure liquid chromatography UV ultraviolet V volume

(260) A) In-Depth Analysis of Biophysical Properties, Detailed Description of Methods

(261) Size-Exclusion Chromatography (SEC)

(262) Analytical SEC was performed using a BioSECcurity instrument (PSS Polymer) with an AdvanceBio 300 column (4.6 mm?300 mm) and AdvanceBio 300 guard column (Agilent Technologies) at room temperature. The analysis was run at a flow rate of 0.5 mL/min using 2? concentrated D-PBS buffer (Thermo Fisher Scientific) with detection at 280 nm. 10 ?L of protein sample (at 1 mg/mL) were applied onto the column. Data evaluation was performed using WinGPC software v8.1 (PSS Polymer). For estimation of the molecular weight, the SEC column was calibrated with the AdvanceBio SEC 300 ? Protein Standard (Agilent Technologies).

(263) Hydrophobic Interaction Chromatography (HIC)

(264) Analytical HIC was performed using a LC10 HPLC instrument (Shimadzu) or a Vanquish HPLC instrument (Thermo Fisher Scientific) equipped with a TSKgel Butyl-NPR column (2.5 ?m, 4.6?35 mm) (Tosoh Bioscience) at room temperature. The analysis was run at a flow rate of 1 mL/min with detection at 280 nm. 5 ?g of undiluted protein sample were applied onto the column. Gradient elution was from 15% B to 85% B in 7 min followed by 1 min to 100% B, then 1 min to 15% B and then 3 minutes equilibration at 15% B. Buffer A was composed of 1.5 mol/L ammonium sulfate, 25 mmol/L sodium phosphate pH 7.0. Buffer B was composed of 25 mmol/L sodium phosphate pH 7.0. Data evaluation was performed either using LabSolutions software v5.85 (Shimadzu) or Chromeleon 7 software (Thermo Fisher Scientific).

(265) Nano Differential Scanning Fluorimetry (nanoDSF)

(266) Onset temperatures (T.sub.onset) and melting points (T.sub.m) of protein denaturation were determined using nano differential scanning fluorimetry (nanoDSF). Samples were diluted in formulation buffer to a final concentration of 0.5 mg/mL and loaded into nanoDSF capillaries in duplicates (Nanotemper Technologies). All measurements were done using a Prometheus NT.plex nanoDSF device (Nanotemper Technologies). Heating rate was 1? C. per minute from 20? ? C. to 95? C. Data were recorded using PR. ThermControl Software v2.3.1 (Nanotemper Technologies) and analyzed using PR.Stability Analysis Software v1.0.3 (Nanotemper Technologies).

(267) Dynamic Light Scattering (DLS)

(268) Dynamic light scattering (DLS) was performed using a DynaPro Plate Reader (Wyatt Technology). The samples were measured in 384 well assay plates (Corning) at 25? C. Data were evaluated by cumulant fitting using Dynamics Software version 7.7.0.125 (Wyatt Technology).

(269) Colloidal stability of the samples was assessed by measuring the diffusion interaction parameter (KD) at 20? C. using a DynaPro Plate Reader (Wyatt Technology). Before the measurements the samples were buffer exchanged against 5 L of 10 mmol/L Histidine pH 6.0 by dialysis for 20 h with one buffer change using 1 mL Float-A-Lyzer G2 devices with 3.5-5 kDa cut-off (Spectrum Labs). A dilution series from 1 to 4.5 mg/mL, in 0.5 mg/mL increments, was prepared in 10 mmol/L Histidine pH 6.0 and measured in 384 well assay plates (Corning).

(270) Capillary Isoelectric Focusing (cIEF)

(271) Charge heterogeneity of the antibody samples was determined by capillary isoelectric focusing (cIEF) using a Maurice C device (Protein Simple). The samples were prepared by the cIEF protocol given by the manufacturer with an ampholyte mix 3-10 (Protein Simple) and peptide pI markers of 5.85 and 9.0 (Protein Simple). cIEF runs were analyzed using Compass Software v2.1.0 (Protein Simple).

(272) Capillary Gel Electrophoresis (cGE)

(273) Purity and size heterogeneity of the samples was determined by capillary gel electrophoresis (cGE) using a CESI8000 instrument (SCIEX) equipped with a pre-assembled fused silica capillary (50 ?m?300 mm, SCIEX). Protein samples at 1 mg/ml were prepared using the IgG purity heterogeneity Kit (SCIEX) under non-reducing conditions according to the manufacturer's specifications. Samples were electrophoretically separated for 35 minutes at 25? C. and the absorbance at 220 nm was recorded by a photo diode array (PDA) detector. The data were analyzed using 32 Karat Software (SCIEX).

(274) Accelerated Stress Stability

(275) To monitor changes in the chemical stability of the antibody samples, accelerated stress stability studies were performed. For screening of chemical stability of antibody variants, the accelerated stress stability was performed in 150 mmol/L NaCl, 10 mmol/L Histidine buffer pH 6.0 at 40? C. for up to 28 days. Control samples were kept at ?80? C. and samples after stress were also frozen to ?80? C. before analyses. Stressed and control samples were then analyzed by SPR for off-rate (KD) determination to human KLB and by cellular assays. For the accelerated stress stability with optimized antibody variants and the 16H7 antibody, the samples were buffer exchanged by dialysis for 20 h using 1 mL Float-A-Lyzer G2 devices with 3.5-5 kDa cut-off (Spectrum Labs) against 5 L of each stress buffer (10 mmol/L sodium acetate or sodium citrate buffer pH 5.0, 10 mmol/L histidine buffer pH 6.0, 10 mmol/L sodium phosphate buffer pH 8.0) with one buffer exchange. The concentration of the buffer exchanged samples was adjusted to 1 mg/mL with the respective buffer and the samples were incubated for up to 21 days at 40? C. in an incubator. For comparison, the 16H7 antibody was also stressed in formulation buffer at 40? C. for 28 days. Control samples and samples after stress in the respective buffers were frozen at ?80? C. before the analyses.

(276) Intact Mass Spectrometry (IMS)

(277) Protein integrity was analyzed by LC-MS. Antibody samples were deglycosylated with 12.5 ?g of protein diluted to 0.5 mg/mL in ddH2O treated with PNGaseF (1:50 (v/v)) (glycerol free, NewEnglandBiolabs) at 37? C. for 15 hours. The LC-MS analysis was performed using an Agilent 6540 Ultra High Definition (UHD) Q-TOF equipped with a dual ESI interface and an Agilent 1290/1260 Infinity LC System. Reversed phase (RP) chromatography was done using a PLRP-S 1000 A 5 ?m, 50?2.1 mm (Agilent) with a guard column PLRP-S 300 A 5 ?m, 3?5 mm (Agilent) at 200 ?L/min and 80? C. column temperature. Eluents were buffer A containing LC water and 0.1% formic acid as well as buffer B containing 90% acetonitrile, 10% LC water and 0.1% formic acid. 1 ?g of protein was injected onto the column and eluted using linear gradient from 0 to 17 minutes with increasing acetonitrile concentration. Data was analyzed using MassHunter Bioconfirm B.06 (Agilent). Molecular masses were calculated based on the amino acid sequences of the proteins using GPMAW software version 10 (Lighthouse data).

(278) B) Peptide Mapping (PM)

(279) mAb Sample Preparation for Tryptic Peptide Mapping Experiments

(280) 100 ?g mAb reference and stressed sample were denatured using 0.2 mol/L histidine chloride, 5.6 mmol/L guanidinium hydrochloride and 10 mmol/L TCEP (tris(2-carboxyethyl)phosphine, Thermo Fisher Scientific) pH 6 at 37? C. Buffer was exchanged to 20 mmol/L histidine chloride, 0.5 mmol/L TCEP, pH 6 in 0.5 mL Zeba Spin Desalting Columns (Thermo Fisher Scientific). mAbs were digested overnight at 37? C. at an enzyme to substrate ratio of 1:20. Digestion was stopped by addition of 7 ?L of 10% formic acid solution and samples were frozen at ?80? C. until further analysis.

(281) Detection of Modified Peptides by Liquid-Chromatography Tandem Mass-Spectrometry

(282) Peptides were analyzed using a Vanquish? Flex UHPLC System coupled to an orbitrap Fusion? Lumos? Tribrid? mass Spectrometer equipped with the EASY-ETD ion source (Thermo Fisher Scientific).

(283) For peptide separation a binary solvent system was used: (A) 0.1% formic acid and (B) 90% acetonitrile, 0.1% formic acid. 0.5 ?g of tryptic digested sample was separated with a 1 h gradient with linearly increasing concentrations of solvent B for 50 min, followed by 5 min at 95% B washing and 5 min re-equilibration to 5% solvent B on a Hypersil GOLD? C18 LC-column (150 mm?2.1 mm with 1.9 ?m particle size, Thermo Fisher Scientific). Peptides separated on the column were detected with the following crucial settings: Full MS Spectra were acquired at a resolution of 120,000 (defined at 200 m/z) with the mass range set to 375-1,500, an automated gain control (AGC) target of 4.0e5, a maximum injection time of 50 ms and 1 ?scan. Data-dependent (MS/MS) spectra were acquired in a top 5 data-dependent mode using a resolution of 15,000 (defined at 200 m/z) after accumulation of 5.0e4 AGC targets within an injection time of 200 ms. Ions were isolated at a 1.6 Th isolation window and fragmented in the HCD/EThcD and EtciD cells at 30% normalized collision energy. Dynamic exclusion was set to 10 s.

(284) Raw Data Processing

(285) Acquired MS data were processed using Expressionist software (GeneData version 11/12/12.5) and manually inspected to ensure correct assignment and relative quantification accuracy. Mass spectra were searched against the amino acid sequence of the sample molecule. Crucial settings are the mass tolerances for MS and MS/MS spectra which was set to 10 ppm, respectively. Post-translational modifications considered within the search parameters were deamidation and succinimide formation on asparagine, isomerization and succinimide formation on aspartate, pyro-Glutamate modifications, oxidation on methionine and common N-terminal glycosylations using the IgG N-glycan library from Expressionist.

(286) C) Binding Affinity Analysis Via BLI and SPR

(287) Bio-Layer Interferometry (BLI)

(288) The Octet HTX system (Molecular Devices Fort?Bio, #30-5102) is based on bio-layer interferometry (BLI) technology and was used for human and monkey (Macaca fascicularis) KLB off-rate screening of the expressed antibodies in the crude supernatants. The supernatants were diluted to 25 ?g/mL with Freestyle F17 Expression medium (Gibco, #A1383502) containing 6 mmol/L glutamine. 10 ?L of the diluted samples were transferred to the assay plate (Greiner microplates 384 well, PP, black, #781209) and further diluted 1:10 with 90 ?L D-PBS (Gibco, #14190-094)+0.1% BSA (Miltenyi Biotec, #130-091-376) to a final concentration of 2.5 ?g/mL. Expressed antibodies in the diluted samples were loaded on anti-hIgG Fc Capture antibody biosensors (AHC, Pall Fort?Bio, #18-5064) for 300 seconds (Loading step). After a 60 sec baseline step in D-PBS+0.1% BSA, the biosensors were dipped into 5 nmol/L human KLB (Biotechne R&D Systems, #5889-KB) or 5 nmol/L monkey KLB (Biotechne R&D Systems, #CUST0701 DLWG01 customized product) analyte for 300 sec to record the association kinetics. The dissociation kinetics was then reported by dipping the biosensors in D-PBS+0.1% BSA for 1800 sec.

(289) Biosensors were regenerated and neutralized with 10 mmol/L Glycine/HCl, pH 1.7 and D-PBS for 5 sec each, using three cycles before the first measurement and between all following measurements. Each assay was performed at 30? C. and 1000 rpm shaking with the sensor offset set to 3 mm and started after a delay of 600 sec to equilibrate the plate for 10 min.

(290) All samples were measured in a double-referenced manner: (i) reference sensor: by using D-PBS+10% mock SN+0.1% BSA instead human KLB or monkey KLB as analyte, and (ii) reference well: by using D-PBS+10% mock SN+0.1% BSA instead samples as ligand.

(291) All measurements of the antibody variants with single substitutions were performed as single determinations.

(292) Data analysis of off-rate screening experiments was done using Fort?Bio Data Analysis HT 11.0.0.50 software. All sample data points were calculated using (i) the double references thereby correcting for non-specific binding and ligand dissociation, and (ii) interstep correction to avoid misalignment between two measurement steps.

(293) The resulting binding curves were fitted with a local full 1:1 model and the dissociation constant koff and response were calculated by the software.

(294) Surface Plasmon Resonance (SPR)

(295) Binding affinity and kinetics were measured on a Biacore 8K instrument (GE Healthcare). For the affinity capture of the diluted mAb sample, an anti-human Fc antibody (human antibody capture kit, GE Healthcare) was immobilized on all eight channels of a series S CM5 sensor chip (GE Healthcare) to approximately 10.000 RU. The anti-beta-Klotho antibodies were diluted into HBS-EP+ assay buffer (GE Healthcare) to 0.04 ?g/mL. The antibodies were injected in the sample compartment, whereas the reference compartment was used without captured antibody. An antibody inject of 120 sec at 10 ?L/min resulted in a typical capture level of 200 RU. After Fc affinity capture the antigen human beta-Klotho (R&D Systems) or cynomolgus monkey beta-Klotho (R&D Systems), diluted into HBS-EP+ buffer with 10% non-specific binding reducer (GE Healthcare), was injected in a 1:1 dilution series from 0.78 nmol/L to 50 nmol/L over the reference and sample flow cells. For the antigen inject the flow rate was adjusted to 60 ?L/min with an association time of 180 sec and a dissociation time of 1800 sec. The maximum binding signal of beta-Klotho was in the range of 30 RU. At the end of each cycle an inject of regeneration solution, supplied with human antibody capture kit (GE Healthcare), supplemented with 10% non-specific binding reducer (GE Healthcare), for 1 min at 30 ?L/min to remove antibody and antigen was performed. Binding kinetics data were evaluated with a 1:1 binding model using the Biacore 8K Evaluation Software version 1.1.1.7442 (GE Healthcare).

(296) Screening of antibody mutants for binding to human beta-Klotho was determined in a different SPR assay set up. Human beta-Klotho was affinity captured by an anti-His antibody (from His capture kit, GE Healthcare) that was immobilized to a series S CM5 chip (GE Healthcare) by amine reactive coupling as described above. The antibody samples were used as analytes at 50 nmol/L concentration. Association time was 240 sec and dissociation time was 300 sec. Chip surfaces were regenerated using the regeneration solution supplied with the His capture kit. The off-rates (kd) were determined using single exponential fitting in the Biacore 8K Evaluation Software version 1.1.1.7442 (GE Healthcare).

(297) Analysis of the active fraction of stressed antibodies was performed by SPR using the same Fc capture assay set up as described above for the affinity determination. In this case the association and dissociation times for human beta-Klotho were set to 240 sec and 300 sec, respectively. The active fraction of the samples was calculated as the ratio of binding signal for human beta-Klotho and the Fc capture signal of the antibody, normalized to the active fraction of the unstressed control samples. Mean values from three experiments were calculated.

(298) D) Peptide Synthesis and Analysis

(299) General Synthesis of Peptidic Compounds

(300) Whereas fusion proteins were produced by recombinant methods (see below), peptidic GLP-1R agonists were chemically synthesized.

(301) Materials

(302) Different Rink-Amide resins (e.g. 4-(2,4-Dimethoxyphenyl-Fmoc-aminomethyl)-phenoxyacetamido-norleucylaminomethyl resin, Merck Biosciences; 4-[(2,4-Dimethoxyphenyl)(Fmoc-amino)methyl]phenoxy acetamido methyl resin, Agilent Technologies) were used for the synthesis of peptide amides with loadings in the range of 0.2-0.7 mmol/g.

(303) Fmoc protected natural amino acids were purchased e.g. from Protein Technologies Inc., Senn Chemicals, Merck Biosciences, Novabiochem, Iris Biotech, Bachem, Chem-Impex International or MATRIX Innovation. The following standard amino acids were used throughout the syntheses: Fmoc-L-Ala-OH, Fmoc-Arg(Pbf)-OH, Fmoc-L-Asn(Trt)-OH, Fmoc-L-Asp(OtBu)-OH, Fmoc-L-Cys(Trt)-OH, Fmoc-L-Gln(Trt)-OH, Fmoc-L-Glu(OtBu)-OH, Fmoc-Gly-OH, Boc-Gly-OH, Fmoc-L-His(Trt)-OH, Boc-L-His(Trt)-OH, Fmoc-L-Ile-OH, Fmoc-L-Leu-OH, Fmoc-L-Lys(Boc)-OH, Fmoc-L-Met-OH, Fmoc-L-Phe-OH, Fmoc-L-Pro-OH, Fmoc-L-Ser(tBu)-OH, Fmoc-L-Thr(tBu)-OH, Fmoc-L-Trp(Boc)-OH, Fmoc-L-Tyr(tBu)-OH, Fmoc-L-Val-OH.

(304) The solid phase peptide syntheses were performed for example on a Prelude Peptide Synthesizer (Mesa Laboratories/Gyros Protein Technologies) or a similar automated synthesizer using standard Fmoc chemistry and HBTU/DIPEA activation. DMF was used as the solvent.

(305) Deprotection: 20% piperidine/DMF for 2?2.5 min.

(306) Washes: 7?DMF.

(307) Coupling 2:5:10 200 mM AA/500 mM HBTU/2M DIPEA in DMF 2? for 20 min. Washes: 5?DMF.

(308) The peptides that have been synthesized on the automated synthesizer were cleaved from the resin with King's cleavage cocktail consisting of 82.5% TFA, 5% phenol, 5% water, 5% thioanisole, and 2.5% EDT, or a modified cleavage cocktail consisting of 95% TFA, 2.5% water, and 2.5% TIS. The crude peptides were then precipitated in diethyl or diisopropyl ether, centrifuged, and lyophilized. Peptides were analyzed by analytical HPLC and checked by ESI mass spectrometry. Crude peptides were purified by a conventional preparative RP-HPLC purification procedure.

(309) Alternatively, peptides were synthesized by a manual synthesis procedure.

(310) Solid Phase Synthesis (Manual Synthesis Procedure)

(311) 0.3 g Desiccated Rink amide MBHA Resin (0.5-0.8 mmol/g) was placed in a polyethylene vessel equipped with a polypropylene filter. Resin was swollen in DCM (15 ml) for 1 h and DMF (15 ml) for 1 h. The Fmoc group on the resin was de-protected by treating it twice with 20% (v/v) piperidine/DMF solution for 5 and 15 min. The resin was washed with DMF/DCM/DMF (6/6/6 time each). A Kaiser test (quantitative method) was used for the confirmation of removal of Fmoc from solid support. The C-terminal Fmoc-amino acid (5 equiv. excess corresponding to resin loading) in dry DMF was added to the de-protected resin and coupling of the Fmoc-amino acid was initiated with 5 equivalent excess of DIC and HOBt in DMF. The concentration of each reactant in the reaction mixture was approximately 0.4 M. The mixture was rotated on a rotor at room temperature for 2 h. Resin was filtered and washed with DMF/DCM/DMF (6/6/6 time each). Kaiser test on peptide resin aliquot upon completion of coupling was negative (no colour on the resin). After the first amino acid attachment, the unreacted amino group, if any, in the resin was capped using acetic anhydride/pyridine/DCM (1/8/8) for 20 min to avoid any deletion of the sequence. After capping, resin was washed with DCM/DMF/DCM/DMF (6/6/6/6 time each). The Fmoc group on the C-terminal amino acid attached peptidyl resin was deprotected by treating it twice with 20% (v/v) piperidine/DMF solution for 5 and 15 min. The resin was washed with DMF/DCM/DMF (6/6/6 time each). The Kaiser test on peptide resin aliquot upon completion of Fmoc-deprotection was positive.

(312) The remaining amino acids in target sequence on Rink amide MBHA Resin were sequentially coupled using Fmoc AA/DIC/HOBt method using 5 equivalent excess corresponding to resin loading in DMF. The concentration of each reactant in the reaction mixture was approximately 0.4 M. The mixture was rotated on a rotor at room temperature for 2 h. Resin was filtered and washed with DMF/DCM/DMF (6/6/6 time each). After each coupling step and Fmoc deprotection step, a Kaiser test was carried out to confirm the completeness of the reaction.

(313) Final Cleavage of Peptide from the Resin (Manual Synthesis Procedure)

(314) The peptidyl resin synthesized by manual synthesis was washed with DCM (6?10 ml), MeOH (6?10 ml) and ether (6?10 ml) and dried in vacuum desiccators overnight. The cleavage of the peptide from the solid support was achieved by treating the peptide-resin with reagent cocktail (92% TFA, 2% thioanisole, 2% phenol, 2% water and 2% TIPS; or 80% TFA, 5% thioanisole, 5% phenol, 2.5% EDT, 2.5% DMS, and 5% DCM; or 95% TFA, 2.5% water and 2.5% TIS) at room temperature for 3 to 4 h. Cleavage mixture was collected by filtration and the resin was washed with TFA (2 ml) and DCM (2?5 ml). The excess TFA and DCM was concentrated to small volume under nitrogen and a small amount of DCM (5-10 ml) was added to the residue and evaporated under nitrogen. The process was repeated 3-4 times to remove most of the volatile impurities. The residue was cooled to 0? C. and anhydrous ether was added to precipitate the peptide. The precipitated peptide was centrifuged, the supernatant ether was removed, fresh ether was added to the peptide and re-centrifuged. The crude sample was purified by preparative HPLC and lyophilized. The identity of peptide was confirmed by LCMS.

(315) Disulfide Formation

(316) To form an intramolecular disulfide bridge between two cysteines in the peptide sequence, one of the two following protocols has been applied:

(317) The purified peptide was dissolved in a large volume of 50% acetic acid in water. Then, 6 eq of a solution of iodine in water was added and the reaction mixture was stirred at room temperature until HPLC/MS analysis indicated completion of the reaction. The reaction was quenched by addition of an excess of ascorbic acid, lyophilized and purified by preparative HPLC. After lyophilization, the identity of peptide was confirmed by LCMS.

(318) Alternatively, the peptide was dissolved in trifluoroethanol (1 ml per mg) and treated dropwise with a solution of 80 mg iodine in 5 ml acetic acid and 50 ml trifluoroethanol until the yellow colour of the reaction mixture was persistent. The mixture was stirred at room temperature for 5 min, then treated dropwise with 0.1N aqueous ascorbic acid solution until decolouring.

(319) Completion of the reaction was confirmed by HPLC/MS analysis. The reaction mixture was concentrated, diluted with water and a small volume of ACN, then lyophilized. The crude sample was purified via preparative HPLC and lyophilized. The identity of peptide was confirmed by LCMS.

(320) General Preparative HPLC Purification Procedure

(321) The crude peptides were purified either on an ?kta Purifier System, a Jasco semiprep HPLC System, an Agilent 1100 HPLC system or a similar HPLC system. Preparative RP-C18-HPLC columns of different sizes and with different flow rates were used depending on the amount of crude peptide to be purified, e.g. the following columns have been used: Waters XSelect CSH C18 OBD Prep 5 ?m 30?250 mm, Waters SunFire C18 OBD Prep 5 ?m 30?250 mm, Waters SunFire C18 OBD Prep 5 ?m 50?150 mm, and Phenomenex Luna Prep C18 5 ?m 21.2?250 mm. Acetonitrile (B) and water+0.1% TFA (A) or water+0.1% FA (A) were employed as eluents. Product-containing fractions were collected and lyophilized to obtain the purified product, typically as TFA salt.

(322) Analytical HPLC/UHPLC

(323) Method A: With Detection at 220 nm, Optionally with Mass Analyser: Electrospray Positive Ion Mode column: Waters ACQUITY UPLC? BEH? C18 1.7 ?m (100?2.1 mm) at 40? C. solvent: H.sub.2O+0.1% FA: ACN+0.1% FA gradient: 98:02 (0 min), 98:02 (2.0 min), 30:70 (15.0 min), 05:95 (20.0 min)

(324) Method B: With Detection at 214 nm column: Waters ACQUITY UPLC? CSH? C18 1.7 ?m (150?2.1 mm) at 50? ? C. solvent: H.sub.2O+0.05% TFA: ACN+0.035% TFA (flow 0.5 ml/min) gradient: 80:20 (0 min) to 80:20 (3 min) to 25:75 (23 min) to 2:98 (23.5 min) to 2:98 (30.5 min) to 80:20 (31 min) to 80:20 (37 min) mass analyzer: Agilent 6230 Accurate-Mass TOF or Agilent 6550 iFunnel Q-TOF; both equipped with a Dual Agilent Jet Stream ESI ion source.

(325) Synthesis of Peptide Component P037 (see Table A3)

(326) The solid phase synthesis as described in Methods was carried out on Novabiochem Rink-Amide resin (4-(2,4-Dimethoxyphenyl-Fmoc-aminomethyl)-phenoxyacetamido-norleucylaminomethyl resin), 100-200 mesh, loading of 0.35 mmol/g. The automated Fmoc-synthesis strategy was applied with HBTU/DIPEA-activation. In position 1 Boc-Gly-OH was used in the solid phase synthesis protocol. The peptide was cleaved from the resin with King's cocktail (D. S. King, C. G. Fields, G. B. Fields, Int. J. Peptide Protein Res. 1990, 36, 255-266). The crude product was purified via preparative HPLC first on a Waters column (Waters SunFire C18 OBD Prep 5 ?m 50?150 mm) using an acetonitrile/water gradient (water with 0.1% TFA) and thereafter via preparative HPLC on a Waters column (Waters Xselect CSH Prep C18 5 ?m 50?150 mm) using an acetonitrile/water gradient (water with 0.1% TFA). The purified peptide was collected and lyophilized.

(327) The purified peptide was analysed by LCMS (Method B). Deconvolution of the mass signals found under the peak with retention time 8.71 min revealed the peptide mass 4288.18 which is in line with the expected value of 4288.16.

(328) Synthesis of Peptide Component P035 (See Table A3)

(329) The solid phase synthesis was carried out on Rink-resin with a loading of 0.43 mmol/g, 100-200 ?m from the company Novabiochem. The Fmoc-synthesis strategy was applied with HBTU/DIPEA-activation. In position 1 Boc-His(Trt)-OH was used in the solid phase synthesis protocol. The peptide was cleaved from the resin with King's cocktail (D. S. King, C. G. Fields, G. B. Fields, Int. J. Peptide Protein Res. 36, 1990, 255-266). The crude product was purified via preparative HPLC on a Waters column (XSelect CSH C18 OBD Prep 5 ?M 30?250 mm) using an acetonitrile/water gradient (both buffers with 0.05% TFA).

(330) The isolated peptide was cyclized using oxidation with iodine in TFE as described in Methods. The crude product was purified via preparative HPLC on a Waters column (SunFire C18 OBD Prep 5 ?m 50?150 mm) using an acetonitrile/water gradient (both buffers with 0.1% TFA). The purified peptide was analyzed by LCMS (Method B). Deconvolution of the mass signals found under the peak with retention time 6.61 min revealed the peptide mass 4567.23 which is in line with the expected value of 4567.23.

(331) In an analogous way, the other peptides P005, P006, P008, P010, P013, P014, P015, P017, P019, P020-P034, P035, P036, and P038 to P041 as listed in Table A3 were synthesized and characterized (not shown).

(332) E) High-Throughput Screening

(333) Cell Culture and Transfection

(334) Suspension-adapted HEK293-F cells (Invitrogen, #51-002) were cultivated in Freestyle F17 Expression medium (Gibco, #A1383502) containing 6 mM glutamine. The day prior transfection, the cells were seeded at a density of 1.3?10.sup.6 cells/mL in 3 L Fernbach Erlenmeyer flasks with vent cap (Corning, #431252) and incubated over night at 37? C. with agitation at 110 rpm and 8% CO.sub.2. The day of transfection, the cells were adjusted to 2.1?10.sup.6 cells/mL with F17 expression medium containing 6 mM glutamine. For each transfection 50 ng pXL4617_EBNA (EBNA1 expression plasmid) were mixed with 1 ?g DNA of the expression construct of interest (1:1 mixture of light and heavy chain constructs) and adjusted to a volume of 50 ?L with PB Buffer (Qiagen, #19066). 2.8 ?g PEI were diluted in 200 ?L Freestyle F17 Expression medium (Gibco, #A1383502) containing 6 mM glutamine (Polysciences, #23966-2) and were added to the DNA mixture. After a 12-minute incubation, 950 ?L cells (2.0?10.sup.6) were added to the DNA/PEI complex. All transfection experiments were conducted on 96-deep well plates (Nunc, #10447181) in a final working volume of 1200 ?L. The plates were covered with a DUETZ system lid (Kuehner Technology) and incubated for two days at 37? C., 8% CO.sub.2 and 1,000 rpm shaking with 3 mm orbit (Infors HT Multitron Pro).

(335) Expression Analysis Using Octet HTX

(336) Seven days after transfection, the cell supernatants containing expressed antibody constructs were harvested by centrifugation (3,220 rcf, 2 minutes). These supernatants were quantified by bio-layer interferometry (BLI) using the Octet HTXe system (Molecular Devices Fort?Bio, #30-5102) using Protein A biosensors (Molecular Devices Fort?Bio, #18-5013). Quantification with regeneration of the biosensor was performed as follows: 10 ?L of the cell supernatants were transferred to the assay plate (Greiner microplates 384 well, PP, black, #781209) and diluted 1:10 with 90 ?L D-PBS (Gibco, #14190-094)+0.1% BSA (Miltenyi Biotec, #130-091-376). Quantification time was set to 120 seconds, regeneration/neutralization of biosensors was done with 10 mM Glycine/HCl, pH 1.5 and D-PBS to 5 seconds, using three cycles before the first measurement and between all following measurements. The assay was performed at 30? C. and shaking at 1,000 rpm. The sensor offset was set to 3 mm. The experiment started after a delay of 600 seconds to equilibrate the plate for 10 minutes (30? ? C. and shaking).

(337) Data analysis was done using Fort?Bio Data Analysis 11.0.0.4 together with a pre-validated Ab0003 (16H7_LC?16H7_HC_IgG4PE, see Table A1) standard curve (binding rate versus concentration).

(338) Luciferase Reporter Gene Assay

(339) The cellular in vitro efficacy of mature human FGF21 and FGF21 like acting anti-FGFR1c/KLB monoclonal antibodies (see e.g. Table A1) and fusion antibodies (see e.g. Table A4), was measured using an FGF21 responsive reporter cell line obtained from Svar Life Science (Malm?, Sweden). The iLite FGF21 Assay Ready Cells (BM3071) are engineered cells optimized to express Firefly luciferase under the control of an FGF21 responsive promoter. Binding of FGF21 to the cell surface receptor composed of the tyrosine kinase receptor FGFR1c and co-receptor beta-Klotho (KLB) results in activation of the FGF21 regulated Firefly luciferase reporter gene construct. The Firefly luciferase signal can be measured in a luminometer following addition and incubation with a luciferase substrate. The Firefly luciferase signal is proportional to the functional activity of FGF21 in the sample.

(340) In detail, frozen iLite FGF21 Assay Ready Cells were thawed rapidly in a 37? C. water bath using gentle hand movements and diluted with prewarmed cell culture medium (DMEM+GlutaMAX (31966021, Gibco), 10% SeraPlus (P30-3701, PAN), 1?AB/AM (15240-096, Gibco)). Using a Multidrop Combi dispenser (ThermoFisher) per well 10 ?L of a suspension containing 4?10.sup.4 cells were dispensed in white-sided 384-well microplates with clear-bottom (6007480, Perkin Elmer) except column 1. Serial dilution of FGF-test compounds was done in cell culture medium using Corning 384 Clear Flat Bottom Polystyrene NBS microplates (#3640) on a Biomek i5 (Beckman Coulter) together with a Multidrop Combi (ThermoFisher). Test compounds were diluted 10? in 1:5 steps.

(341) Stimulation of cells was started by transferring 10 ?L of test compounds from predilution microplate into columns 3-24 of the microplate containing the cells using a Biomek i5, column 1 and 2 was left untreated by adding just 10 ?L medium (blank and basal). Cells were incubated for 5 hours at 37? C. in a humidified atmosphere of 5% CO.sub.2 in air. Reagents used to analyze luciferase activity were from the Dual-Glo Luciferase Assay System (E2940, Promega) according to the supplier's protocol. Firefly luciferase and Renilla luciferase luminescence were measured using a CLARIOstar multi-mode reader (BMG Labtech) as luminometer. Luminescence results of Firefly luciferase were normalized by accounting for Renilla luciferase. Data were obtained as arbitrary units (AU), and EC50 values were obtained from dose-response curves.

(342) In Vitro Cellular Assay for Human FGF21 Receptor Efficacy in CHO Cells

(343) The cellular in vitro efficacy of mature human FGF21 and FGF21 like acting anti-FGFR1c/KLB monoclonal antibodies was measured using a specific and highly sensitive In-Cell Western (ICW) assay. The ICW assay is an immunocytochemical assay usually performed in microplate format (Aguilar H. N. et al. (2010) PLOS ONE 5(4): e9965).

(344) CHO Flp-In cells (Invitrogen, Darmstadt, Germany) stably expressing the human FGFR1c together with human beta-Klotho (KLB) were used for determination of MAP kinase ERK1/2 phosphorylation. In order to analyze the cellular activity of agonistic compounds, using a Multidrop Combi a suspension of 50 ?L with 1.5?10.sup.4 cells were seeded into every well of 384-well plates (Corning #3764) except column 1 and grown for 24 h. Cells were serum starved with 45 ?L per well serum-free Ham's F-12 Nutrient Mix medium (Gibco, Darmstadt, Germany) for 1-2 h using a Tecan HydroSpeed microplate washer together with a Multidrop Combi. The cells were subsequently treated with increasing concentrations of either mature human FGF21 or the indicated monoclonal antibody for 5 min at 37? C. by adding 5 ?L per well into columns 3-24 of the microplate containing the cells using a Biomek i5, column 1 and 2 was left untreated by adding just 5 ?L PBS (blank and basal). Test compounds were diluted 10? in 1:5 steps. After incubation, the medium was discarded, and the cells were fixed by adding 60 ?L/well 3.7% freshly prepared para-formaldehyde for 20 min. Cells were permeabilized with 0.1% Triton-X-100 in PBS for 20 min. Blocking was performed with Odyssey blocking buffer (LICOR, Bad Homburg, Germany) for 2 h at room temperature. As primary antibody phospho-p44/42 MAPK (Erk1/2) (Thr202/Tyr204) antibody (Cell Signaling) in Odyssey blocking buffer with 0.1% Tween20 was added and incubated overnight at 4? C. After incubation with primary antibody, cells were washed with PBS plus 0.1% Tween20. The secondary anti-Rabbit 800CW antibody (LICOR, Bad Homburg, Germany) in Odyssey blocking buffer with 0.1% Tween20 was added and incubated for 1 h at room temperature. Subsequently, cells were washed again with PBS plus 0.1% Tween20, and infrared dye signals were quantified with an Odyssey imager (LICOR, Bad Homburg, Germany) at 700 and 800 nm.

(345) In Vitro Cellular Assay for Human FGF21 Receptor Efficacy in Primary Adipocytes

(346) Aim of this study was the determination of the cellular in vitro activity of recombinant human monoclonal antibodies mimicking FGF21 activity via targeting the human FGFR1c/KLB receptor complex. In this study, the activity of these agonistic monoclonal antibodies and the reference compounds human FGF21 and 16H7 was tested in human primary adipocytes by measuring their ability to stimulate ERK1/2 phosphorylation. The mitogen-activated protein (MAP) kinases ERK1/2 are a typical FGFR downstream signaling pathway effectors activated by FGF21.

(347) Preadipocytes isolated from subcutaneous or visceral adipose tissue of healthy human nondiabetic donors were fully differentiated into mature primary adipocytes. After starvation, adipocytes were treated with compounds for 5 minutes and then subsequently ERK phosphorylation was measured via the specific and highly sensitive In-Cell Western (ICW) assay. The ICW assay is an immunocytochemical assay usually performed in microplate format (Aguilar H. N. et al. (2010) PLOS ONE 5(4): e9965).

(348) Differentiation to Mature Adipocytes

(349) Human preadipocytes from visceral or subcutaneous depot were obtained in frozen aliquots from Lonza (Cologne, Germany). For cell number expansion, the cells were cultured in Endothelial Cell Growth Medium supplemented with supplement mix (PromoCell GmbH, Heidelberg, Germany) at 37? C. in a humidified atmosphere containing 5% CO.sub.2. After the third passage, the expanded cell number was high enough to start the differentiation into adipocytes. For differentiation, 4?10.sup.4 detached and resuspended preadipocytes per well were seeded onto microtiter plates (Corning #3764). After cell attachment, the cell medium was removed and replaced by differentiation medium (Dulbecco's Modified Eagle's Medium/Ham's F-10 Medium (1:1, volume per volume; PAN-Biotech GmbH, Aidenbach, Germany), 15 mmol/L HEPES buffer (pH 7.4), 33 ?mol/L biotin, 17 ?mol/L pantothenate, 1 ?mol/L dexamethasone, 0.2 mmol/L isobutylmethylxanthine, 10 nmol/L L-thyroxine (all from Sigma-Aldrich Chemie GmbH, Taufkirchen, Germany), 3% (vol/vol) fetal calf serum (FCS; PAN-Biotech GmbH), 100 nmol/L human insulin, 0.625? Antibiotic-Antimycotin (Life Technologies GmbH, Darmstadt, Germany), 0.1 ?mol/L peroxisome proliferator-activated receptor gamma (PPAR?) agonist.

(350) After 3 days, the differentiation medium was replaced by adipocyte medium (as described above, but without isobutylmethylxanthine and L-thyroxine) and the plates were incubated for ?10 additional days; the medium was changed on a 3-4-3-day cycle. Fourteen to 16 days after start of differentiation, the adipocyte medium was removed and replaced with adipocyte medium without insulin and PPAR? agonist. The plates were then incubated overnight at 37? C.

(351) In-Cell Western in Primary Adipocytes

(352) Primary human adipocytes of subcutaneous and visceral origin were used for determination of MAP kinase ERK1/2 phosphorylation. In order to analyze the cellular activity of the agonistic compounds, 4?10.sup.4 preadipocytes/well were seeded into 384-well plates and differentiated to mature adipocytes as described above. Cells were serum starved with 45 ?L per well serum-free medium (DMEM/Ham's F-10 Medium 1:1 (PAN-Biotech GmbH, Aidenbach, Germany) for 1-2 h using a Tecan HydroSpeed microplate washer together with a Multidrop Combi. The cells were subsequently treated with increasing concentrations of either mature human FGF21 or the indicated monoclonal antibody for 5 min at 37? C. by adding 5 ?L per well into columns 3-24 of the microplate containing the cells using a Biomek i5, column 1 and 2 was left untreated by adding just 5 ?L PBS (blank and basal). Test compounds were diluted 10? in 1:5 steps.

(353) After incubation, the medium was discarded, and the cells were fixed by adding 60 ?L/well 3.7% freshly prepared para-formaldehyde for 20 min. Cells were permeabilized with 0.1% Triton-X-100 in PBS for 20 min. Blocking was performed with Odyssey blocking buffer (LICOR, Bad Homburg, Germany) for 2 h at room temperature. As primary antibody phospho-p44/42 MAPK (Erk1/2) (Thr202/Tyr204) antibody (Cell Signaling) in Odyssey blocking buffer with 0.1% Tween20 was added and incubated overnight at 4? C. After incubation with primary antibody, cells were washed with PBS plus 0.1% Tween20. The secondary anti-Rabbit 800CW antibody (LICOR, Bad Homburg, Germany) in Odyssey blocking buffer with 0.1% Tween20 was added and incubated for 1 h at room temperature. Subsequently, cells were washed again with PBS plus 0.1% Tween20, and infrared dye signals were quantified with an Odyssey imager (LICOR, Bad Homburg, Germany) at 700 and 800 nm.

(354) In Vitro Cellular Assays for GLP-1, Glucagon and GIP Receptor Efficacy (HEK-293 Cell Line Over-Expressing Receptors)

(355) Agonism of compounds at the human glucagon-like peptide-1 (GLP-1), glucagon (GCG) or glucose-dependent insulinotropic polypeptide (GIP) receptors was determined by functional assays measuring cAMP response of recombinant PSC-HEK-293 cell lines stably expressing human GLP-1, GCG or GIP receptors, respectively. The peptides shown in Table A3 and the fusion antibodies shown in Table A4 were analysed.

(356) The cells were grown in a T-175 culture flask placed at 37? C. to near confluence in medium (DMEM/10% FBS) and collected in 2 ml vials in cell culture medium containing 10% DMSO in concentration of 10-50 million cells/ml. Each vial contained 1.8 ml cells. The vials were slowly frozen to ?80? C. in isopropanol, and then transferred in liquid nitrogen for storage.

(357) Prior to their use, frozen cells were thawed quickly at 37? C. and washed (5 min at 900 rpm) with 20 ml cell buffer (1?HBSS; 20 mM HEPES, 0.1% BSA). Cells were resuspended in assay buffer (cell buffer plus 2 mM IBMX) and adjusted to a cell density of 1 million cells/ml.

(358) For measurement of cAMP generation, 5 ?l cells (final 5000 cells/well) and 5 ?l of test compound were added to a 384-well plate, followed by incubation for 30 min at room temperature.

(359) The CAMP generated was determined using a kit from Cisbio Corp. based on HTRF (Homogenous Time Resolved Fluorescence). The CAMP assay was performed according to manufacturer's instructions (Cisbio).

(360) After addition of HTRF reagents diluted in lysis buffer (kit components), the plates were incubated for 1 h, followed by measurement of the fluorescence ratio at 665/620 nm. In vitro potency of agonists was quantified by determining the concentrations that caused 50% activation of the maximal response (EC50).

(361) Protein Expression and Purification

(362) Antibodies, such as the antibodies shown in Table A1, the fusion antibodies shown in Table A4, or the antibodies with single substitutions in the CDRs (Table D1 and D2) were expressed either in transiently transfected HEK293 or CHO cells. DNA coding for the different variants were cloned into an expression vector under a CMV promoter and a leader sequence directing the proteins into the culture supernatant. For expression in HEK293 cells sequence, MDMRVPAQLLGLLLLWLPGARC (SEQ ID NO: 56) was used as leader sequence. For large scale expression, cells were grown in non-baffled shake flasks (Corning) at 110 rpm, 37? C. and 8% CO.sub.2. At the time of transfection, the cell density was approximately 1.2?10.sup.6 cells/mL. Cell densities were determined with an automated cell counter (Nucleocounter NC-200, Chemometec, Allerod, Denmark). Before transfection, DNA was mixed with linear polyethyleneimine (PEI) at a ratio of 1:3 in Opti-MEM I-medium (Thermo Fisher Scientific). The transfection mixture was further incubated 20 min at room temperature and then added to the cell cultures. Cultivation was continued for 6 days. For large scale purification, cells were separated from the supernatants by centrifugation and the cell pellets were discarded. The 0.22 ?m filtered supernatant was loaded on a protein A column (MabSelect Sure resin, GE Healthcare) equilibrated in phosphate buffered saline (PBS, Gibco). mAbs were eluted with 0.1 M citrate buffer, pH 3.0. Subsequently buffer was exchanged to PBS on a Sephadex G25 desalting column (GE Healthcare). Further purification was done using a Superdex 200 gel filtration column (GE healthcare) equilibrated in PBS. Corresponding fractions were pooled, concentrated and stored until usage at ?80? C.

(363) Fabs of 16H7, Ab0442, Ab0443 and Ab0444 used for crystallization trials were expressed in HEK293 cells and purified as described above except that Lambda Select material (GE Healthcare) was used for the capture step.

(364) Expression of full length human FGF21 was done in E. coli. The expressed human FGF21 contains an N-terminal His-tag, followed by a Tev-protease cleavage site.

(365) TABLE-US-00020 FGF21expressionconstruct:His-Tev-humanFGF21 H29-S209: SEQIDNO:57 MGHHHHHHHHGGGENLYFQGHPIPDSSPLLQFGGQVRQRYLYTDDAQQTE AHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDG ALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAP RGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYA S

(366) The amino acid sequence of mature FGF21 is underlined.

(367) Expression was done in inclusion bodies and FGF21 was recovered from purified inclusion bodies. Cells were harvested by centrifugation and cell pellet was resuspended in 50 mM Tris, 300 mM NaCl, 0.2 mg/mL lysozyme, 25 ?L Benzonase/mL, pH 8.0. Cells were disrupted using a Panda 2K (GEA) homogenizer and the cell lysate was centrifuged for 60 min at 27,500?g and 4? C. The inclusion bodies were washed by resuspending them in 50 mM Tris, 500 mM NaCl, 5 mM DTT, 2% Triton X-100, pH 8.0 with an ultra-turrax dispenser (ika, Germany) and centrifugation for 30 min at 27,500?g and 4? C. For a second wash step protein was resuspended in 20 mM Tris, 500 mM NaCl, pH 8.0 and centrifuged as described above. Supernatant was discarded and inclusion bodies were solubilized in 4 M guanidinium chloride, 25 mM Tris, 500 mM NaCl, 1 mM DTT, pH 8.0. Resuspended inclusion bodies were centrifuged for 30 min at 27,000?g and 4? C. The cleared protein solution was loaded onto a Ni-column (His complete, Roche) and protein was refolded on the column by changing the buffer to 25 mM Tris, 0.5 mM arginine, 1 mM EDTA, 1 mM red. glutathione, 1 mM ox. glutathione, pH 8.0. The column was washed with 25 mM Tris, 0.5 M NaCl, pH 8.0 and the protein was eluted with 25 mM Tris, 0.5 M NaCl, 0.5 M imidazole, pH 8.0. The His-tag was cleaved off with Tev-protease and the protein solution was passed a second time over the Ni-column, now collecting the flow through. Further purification was done using a cation exchange chromatography step (Source 30 S, GE healthcare) followed by a gel filtration step using Fractogel BioSec material (Merck Millipore, Darmstadt, Germany) equilibrated in PBS. Corresponding fractions were collected, pooled, concentrated and stored at ?80? C. until further usage. The amino acid sequence of the final protein is shown in SEQ ID NO: 58:

(368) TABLE-US-00021 GHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSP ESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELL LEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEP PGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

(369) F) In Vivo MethodsNHP Studies

(370) F1: Study to Explore Ab0335 and Comparison to 16H7

(371) The intention of this study was to explore the pharmacological efficacy of Ab0335 (SAR18), a FGF21-mimicking agonistic anti-FGFR1c/KLB mAb, in comparison to 16H7 (SAR16) as described in WO 2011/071783. Both were tested as single administration in the most relevant animal model that reflects the intended human population. Monkeys are a desirable species to examine the potential effects of drug candidates because of the similarity of their absorption, distribution, metabolism, and excretion profile compared to that of humans. The cynomolgus monkey is selected as the test species of choice over other lower mammalian species for more meaningful and translatable results because it is closely related to humans, both phylogenetically and physiologically. Thus, the pharmacokinetic and pharmacodynamics of varying doses of the compounds were explored in the high-fat diet-induced obese and insulin resistance cynomolgus monkey model.

(372) DIO MonkeysAnimals and Housing Conditions

(373) The monkey study was performed at Kunming Biomed International (KBI), located in Yunnan Province, China.

(374) Cynomolgus monkey (Macaca fascicularis) was selected as the test species of choice for more meaningful results that were translatable to humans. More than 50 male monkeys were trained to identify 40 HFD induced obese monkeys for the study.

(375) They all fulfilled the following metabolic criteria: weight at least 8 kg, age at least 8 years, fasting insulin >55 uU/mL (in comparison lean monkeys of same age range: weight 5 to 8 kg, fasting glucose ?70 mg/dL, and fasting insulin ?25 mU/mL), HbA1c >4%, triglycerides >1.3 mmol/L, LDL >5 mmol/L.

(376) The monkeys were individually housed in species- and size appropriate metabolic stainless-steel caging with ad libitum access to water and under controlled environmental conditions with room temperature of 18? C. to 29? C., relative humidity of 30% to 70%, and a minimum of 10 air changes per hour. A time-controlled lighting system provided a regular 12-hour light/12-hour dark diurnal cycle. Cages were cleaned at regular intervals. The monkeys had three meals per day with a daily energy intake of ?680 kcal (?2.85 MJ). All food was withdrawn at 5:00 PM so that monkeys were fasted overnight. Monkeys were provided with enrichment toys or devices at all times. The three daily meals consisted of ?50 g of standard monkey formula feed [extruded pellets, 3.1 kcal/g (12.98 KJ/g): protein 24%, fat 15%, carbohydrate 61%] in the morning (9:00 AM to 10:00 AM), one apple [150 g, 80 kcal (33 kJ)] in the afternoon (2:00 PM to 3:00 PM), and 100 g of KBI proprietary high-fat diet feed in the evening [extruded pellets, 3.47 kcal/g (14.5 KJ/g): protein 14%, fat (porcine) 34%, carbohydrate 52%, sucrose 35%, 4:00 PM to 5:00 PM]. Each batch of monkey chow was delivered with an accompanying certificate of analysis detailing nutritional composition and levels of specified contaminants (e.g., heavy metals, aflatoxin, and insecticides). Ad libitum access to water through the main system was suspended on days in which water intake was quantified.

(377) Treatment

(378) There was a run-in period during which monkeys were injected subcutaneously with vehicle once weekly. Food intake (calculated as TEI) and water intake were measured daily along with once-weekly body weight evaluation and one-time baseline value determination for metabolic biomarkers, safety biomarkers, IV glucose tolerance test (IVGTT), and profile for glucose, insulin, and plasma lipids.

(379) For the dosing period 40 trained monkeys (n=10 per group) were selected and stratified for their body weight, fat composition and triglycerides in a four-arm design. All treatments, including a vehicle treated control group were administered subcutaneously on days+1, +19 and +37 and monitored closely for 8 weeks followed by a 4-week observation wash-out period. The dosing period was designed as a four-arm study, and monkeys were treated with either vehicle, SAR16, or SAR18.

(380) The SAR16-treated monkeys were dosed at 1 mg/kg on day+1, day+19, and day+37. The SAR18-treated monkeys were dosed in the low-dose arm at 1 mg/kg on day+1, day+19, and day+37. SAR18 was further dosed in the high-dose arm at 3 mg/kg on day+1, day+19, and day+37.

(381) F2: Efficacy of SAR16 (16H7) as a Standalone Treatment and in Combination with a GLP-1RA in DIO NASH Non-Human Primates

(382) The intention of this study was to explore the pharmacological efficacy of SAR16 (16H7), a FGF21-mimicking agonistic mAb, in comparison to the marketed GLP-1R agonist dulaglutide (herein also referred to as SAR10). Both were tested as single administration and in combination of both in the most relevant animal model that reflects the intended human population. Thus, the pharmacokinetic and pharmacodynamics of varying doses of the compounds were explored in the high-fat diet-induced obese and insulin resistance cynomolgus monkey model with diagnosed non-alcoholic steatohepatitis (NASH), mimicking the adult human NASH insulin resistance phenotype.

(383) DIO NASH MonkeysAnimals and Housing Conditions

(384) The monkey study was performed at Kunming Biomed International (KBI), located in Yunnan Province, China.

(385) Cynomolgus monkey (Macaca fascicularis) was selected as the test species of choice for more meaningful results that were translatable to humans. More than 50 male monkeys were trained to identify 40 HFD induced obese NASH monkeys for the study.

(386) They all fulfilled the following metabolic criteria: weight at least 7.5-15 kg and a body fat content of >25%, high baseline values of TG (>1 mmol/l), LDL (>5 mmol/l), liver enzyme ALT<120 U/L, HbA1c<10%, NAS Score ?5

(387) The other conditions, such as the housing conditions, were as described above for the study to explore Ab0335.

(388) Treatment (See Also FIG. 26)

(389) There was a run-in period during which monkeys were injected subcutaneously with vehicle every third day. Food intake (calculated as TEI) and water intake were measured daily along with twice-weekly body weight evaluation and baseline value determination for metabolic biomarkers, safety biomarkers, IV glucose tolerance test (IVGTT), liver biopsy for gene expression analysis, and profile for glucose, insulin, and plasma lipids.

(390) For the dosing period 40 trained monkeys (n=10 per group) were selected and stratified for body weight, fasting plasma glucose (FPG), and fasting plasma insulin (FPI) and insulin response from baseline during the IVGTT. All treatments were administered subcutaneously for 6 weeks (4 weeks evaluation plus 2 weeks run-out). The dosing period was designed as a four-arm, dose-ramping study, and monkeys were treated with either vehicle, SAR10, SAR16, or a combination of both SAR10 and SAR16.

(391) The SAR10-treated monkeys were dosed every 3rd day at 60 ?g/kg initiated by dose ramping (3 dose steps, week 1: 20 ?g/kg, week 2: 40 ?g/kg, week 3 to runout: 60 ?g/kg). The SAR16-treated monkeys were dosed at 1 mg/kg on day+1, 3 mg/kg on day+16, and then repeat maintenance dose of 3 mg/kg on day+46. The Combo-treated monkey were dosed with both SAR10 and SAR16 as the same pattern of the SAR10 and SAR16 treated monkeys.

Example 1: Analysis of Physico-Chemical Properties of 16H7

(392) The monoclonal antibody designated 16H7 of WO 2011/071783 (Ab0004) binds to the human FGFR1/KLB receptor complex and induces FGF21-like signaling. FIG. 1 shows the heavy and light chain sequences of 16H7.

(393) In this Example, 16H7 was subjected to thermal stress at 40? C. for 28 days at pH 6. Samples were obtained at baseline, at day 14 and day 28. EC50 values and Emax values were measured via a Luciferase gene reporter assay (as described in the Materials and Methods section Luciferase reporter gene assay). Further, the off-rates of the interaction of mAb 16H7 with human beta-Klotho were assessed via SPR interaction analysis on a CM5 chip and a Biacore 8K as described above. Different amounts of the antibodies at baseline, day 14 and day 28, were used to establish dose-response curves by Luciferase gene reporter assays. The results are shown in FIG. 2. As it can be derived from FIG. 2, 16H7 has an unfavorable stability.

Example 2: Identification of Problematic Amino Acid Positions in the CDRs of 16H7

(394) The antibody 16H7 (Ab0004) and 16H7 with IgG4 backbone (Ab0003, see Table A1) were analyzed for prevalent and severe liabilities with a designated set of in silico and in vitro methods. First, the heavy and light chain sequences of 16H7 (FIG. 1) were analyzed with focus on the CDRs using in silico methods to assess human germinality and potential problematic motifs (Immunology Today, 18, 509 (1997) PMID: 9386342; Lefranc, M.-P., The Immunologist, 7, 132-136 (1999); Lefranc, M.-P. et al., Dev. Comp. Immunol., 27, 55-77 (2003) PMID: 12477501; Kabat, E. A. et al., In: Sequences of Proteins of Immunological Interest, NIH Publication, 91-3242 (1991); Foote J, Winter G., J Mol Biol. 1992 Mar. 20; 224(2):487-99. PMID: 1560463; Vargas-Madrazo E, Paz-Garc?a E., J Mol Recognit. 2003 May-June; 16(3):113-20. Review. PMID: 12833565; IMGT, the international ImMunoGeneTics information system).

(395) Based on homology modeling and molecular dynamic simulation certain sites were identified that could be prone to deamidation, isoaspartate (isoAsp) formation, oxidation, or acidic cleavage.

(396) In addition, the monoclonal antibody was stressed at elevated temperatures (40? C.) and different pH values (pH 5.0, 6.0, or 8.0) for up to 28 days. Samples were subsequently analyzed via size-exclusion chromatography (SEC), dynamic light scattering (DLS), hydrophobic interaction chromatography (HIC), capillary isoelectric focusing (cIEF), dynamic scanning fluorimetry (DSF), and mass spectrometry (MS) as described in the Materials and Methods section.

(397) Table B provides an overview of MS peptide mapping results after forced degradation of Ab0003 (16H7 with IgG4 backbone) and Ab0004 (16H7 with IgG2 backbone) at 40? C. and different pH values for 21 days. Shown are assessed percentages of modifications at the given sites of 16H7 variants at day 0 (untreated control), 7, 14 and 21 days.

(398) TABLE-US-00022 TABLE B Overview MS peptide mapping results for Ab0003 and Ab0004 at different pH values pH 5 pH 6 pH 8 Day Day Day Day Day Day Day Day Day Day Day Day 0 7 14 21 0 7 14 21 0 7 14 21 Ab0003 HC M34 Oxidation 6.2 5.3 5.8 6.0 6.1 6.1 6.7 5.4 5.9 6.0 6.6 HC D88 Succinimide D 0.3 24.4 8.6 0.1 0.3 0.1 0.0 7.1 3.0 4.7 0.2 HC D91 Succinimide D 0.3 24.4 8.6 0.1 0.3 0.1 0.0 7.1 3.0 4.7 0.2 HC D109 Succinimide D 0.0 9.1 8.2 0.0 0.3 0.2 0.4 0.0 0.0 0.0 0.1 HC D112 Succinimide D 0.9 3.8 8.1 1.3 7.3 10.9 18.6 0.8 1.8 2.2 4.7 LC D49 Succinimide D 1.2 18.5 19.8 0.8 3.3 0.3 0.3 25.1 6.3 7.6 2.4 LC D50 Succinimide D 0.8 18.9 20.3 0.5 3.5 0.8 0.6 24.8 6.1 7.4 2.2 LC D52 Succinimide D 6.0 28.3 28.8 5.4 10.5 6.4 4.7 28.0 8.1 9.0 3.5 LC N65 Deamidated 0.1 0.2 0.3 0.1 0.3 0.4 0.8 0.2 1.6 2.3 4.8 LC D81 Succinimide D 2.2 6.2 6.8 2.0 3.4 3.7 4.1 1.5 1.4 1.6 1.9 LC D91 iD 0.7 14.2 16.9 1.4 7.2 7.8 10.1 0.9 1.3 1.4 2.8 LC N93 Deamidated 0.8 3.4 7.0 0.9 4.6 8.0 12.7 1.1 2.1 2.9 4.5 Ab0004 HC M34 Oxidation 4.1 4.7 4.2 4.6 2.5 3.3 3.9 5.6 3.9 4.5 3.8 6.1 HC D109 Succinimide D 1.5 12.5 18.1 26.4 2.5 10.7 14.6 24.0 3.4 2.7 4.6 7.3 LC N25 Succinimide N 1.4 4.4 4.9 6.6 1.4 6.3 7.8 10.1 1.4 2.2 2.4 3.4 LC D52 Succinimide D 1.8 4.7 4.5 4.9 1.5 2.7 2.8 2.7 1.2 0.8 0.7 1.0 LC D49/D50 iD 0.9 11.3 15.2 25.4 0.9 7.7 9.1 16.7 1.1 3.4 3.9 6.1 LC N65 Deamidated 0.1 0.2 0.2 0.6 0.1 0.2 0.3 0.9 0.1 1.2 2.2 4.9 LC D81 Succinimide D 2.7 5.9 5.9 5.4 2.2 2.7 3.4 3.8 1.7 1.6 1.3 2.3 LC D91 iD 1.3 13.1 16.3 17.6 1.7 7.2 7.3 9.6 2.0 1.7 1.6 2.8 LC N93 Deamidated 0.2 2.5 5.7 11.1 0.2 2.8 6.0 12.7 0.3 1.0 1.6 3.8 Abbreviations: HC = heavy chain, LC = light chain, iD = isoaspartate

(399) Amino acid residues of 16H7 associated with reduced stability (critical amino acids) of 16H7 identified via MS analysis and in silico analysis are listed in Table C.

(400) TABLE-US-00023 TABLE C Critical residues of 16H7 after 4 weeks of thermal stress, residues identified via MS analysis and in silico analysis Surrounding Chain Position Sequence Modification Comment LC N25 GNN Deamidation Deamidation LC D49 YDD Succinimide/iAsp iAsp formation LC D50 DDS Succinimide/iAsp Succinimide LC D91 WDG Succinimide/iAsp iAsp LC N93 GNS Deamidation Deamidation proven HC M34 RMG Oxidation Oxidation HC D109 YDG Succinimide/iAsp D109 Succinimide proven, iAsp low

(401) The crystal structure of 16H7 Fab was determined and is shown in FIG. 3. Critical amino acid residues of 16H7 are highlighted.

Example 3: Analysis of 16H7 Variants with Single Point Mutations

(402) In this example, all amino acids in the CDRs of the light and heavy chain of 16H7 were randomized. The IgG4 backbone was used. Every CDR position was varied by single point mutation using all 20 natural amino acids and tested for activity. Provided that they were found in the generated library, constructs encoding the antibodies were expressed in suspension-adapted HEK293-F cells. Cell supernatants containing expressed antibody constructs were harvested by centrifugation seven days after transfection and antibody expression was quantified by bio-layer interferometry (BLI) using Protein A biosensors as in the section Bio-layer interferometry (BLI). Further, the cellular activity of single point mutated 16H7 variants was measured via Luciferase gene reporter assay as described in the section Luciferase reporter gene assay. All measurements of the single amino acid mutants were performed as single determinations.

(403) The results are shown in FIG. 4 and in Tables D1 and D2. Table D1 shows the results for substitutions of single amino acids in the light chain CDRs of 16H7. Table D2 shows the results for substitutions of single amino acids in the heavy chain CDRs of 16H7.

(404) TABLE-US-00024 TABLE D1 16H7 variants with single point mutations in the light chain Mean Mean Mean Rel. Mean Mean Mean Rel. EC50 E max koff Expression EC50 E max koff Expression Substitution (nM) (%) (1/s) (%) Substitution (nM) (%) (1/s) (%) G23R 0.135 103 0.00003100 91 S51G 0.129 104 0.00010000 29 G23C 0.087 108 0.00004100 65 D52F 0.105 102 0.00000790 453 G23N 0.138 100 0.00002700 117 D52E 0.114 123 0.00000010 12 G23A 0.122 107 0.00004000 79 D52N 0.124 115 0.00000069 100 G23M 0.122 91 0.00004100 100 D52G 0.125 109 0.00003700 424 G23K 0.104 90 0.00003900 90 D52Q 0.107 101 0.00002700 131 G23H 0.096 95 0.00000520 45 D52Y 0.110 102 0.00009100 32 G23I 0.128 99 0.00002900 158 D52V 0.125 114 0.00006900 171 G23Y 0.124 107 0.00004200 118 D52M 0.144 105 0.00002400 227 G23V 0.105 93 0.00003900 99 D52H 0.109 97 0.00003600 74 G23D 0.104 108 0.00002200 105 D52I 0.140 110 0.00002800 54 G23P 0.117 101 0.00003800 82 D52K 0.117 101 0.00009200 41 G23F 0.109 98 0.00005000 94 D52R 0.091 96 0.00002900 73 G23T 0.105 112 0.00001500 92 D52S 0.098 108 0.00004000 19 G23S 0.143 120 0.00000010 96 D52T 0.109 100 0.00001800 158 G23L 0.131 106 0.00009100 76 D52P 0.117 90 na 145 G24S 0.135 121 0.00000830 117 D52A 0.163 101 0.00004800 13 G24R 0.106 98 0.00000150 103 D52L 0.107 106 0.00005700 63 G24P 0.112 110 0.00003800 94 R53Q 0.131 100 0.00024000 181 G24H 0.125 99 0.00002700 62 R53L 0.151 106 0.00002000 117 G24C 0.106 104 0.00002200 82 R53D 0.192 74 na 64 G24T 0.139 106 0.00006900 101 R53V 0.112 101 0.00001700 88 G24A 0.094 95 0.00003600 91 R53I 0.151 100 0.00001700 28 G24N 0.114 103 0.00001700 94 R53P 0.126 92 0.00028000 40 G24F 0.151 107 0.00002300 112 R53T 0.134 109 0.00008700 128 G24E 0.118 112 0.00002700 49 R53S 0.113 105 0.00029000 82 G24M 0.115 109 0.00004800 105 R53W 0.094 92 na 150 G24V 0.125 102 0.00008500 77 R53H 0.153 103 0.00015000 212 G24I 0.143 109 0.00002700 100 R53G 0.128 96 na 179 G24L 0.161 108 0.00003400 94 R53C 0.147 107 0.00044000 50 G24W 0.145 110 0.00003700 72 R53M 0.099 95 0.00018000 146 G24Y 0.137 107 0.00004100 67 R53A 0.132 89 0.00020000 191 G24K 0.143 102 0.00003900 97 R53F 0.125 98 na 131 N25E 0.107 106 0.00003000 118 R53Y 0.183 88 na 219 N25G 0.118 100 0.00003200 146 R53K 0.114 98 0.00004000 153 N25K 0.182 110 0.00003300 105 R53N 0.080 100 0.00015000 28 N25R 0.178 104 0.00004100 95 P54R 0.111 104 0.00011000 41 N25T 0.117 111 0.00002300 97 P54A 0.112 105 0.00002600 223 N25Y 0.099 104 0.00003100 140 P54D 0.115 96 0.00028000 195 N25F 0.112 104 0.00001600 87 P54I 0.115 112 0.00003500 121 N25I 0.122 104 0.00002200 46 P54V 0.110 109 0.00004100 154 N25A 0.081 96 0.00001600 109 P54W 0.091 98 0.00017000 53 N25L 0.134 109 0.00001200 99 P54L 0.133 108 0.00009600 156 N25V 0.121 106 0.00003200 105 P54G 0.141 114 0.00005100 156 N25H 0.137 106 0.00003000 90 P54N 0.150 105 0.00014000 187 N25Q 0.096 102 0.00000010 86 P54M 0.087 98 0.00003200 167 N25W 0.099 99 0.00000010 26 P54H 0.111 100 0.00014000 124 N25P 0.132 106 0.00001200 77 P54C 0.116 100 0.00012000 17 N25S 0.131 98 0.00004400 155 P54E 0.126 99 na 59 N25C 0.133 110 0.00000360 142 P54K 0.131 100 0.00016000 163 N25M 0.131 102 0.00000310 167 P54T 0.113 108 0.00018000 45 N26T 0.143 105 0.00004400 101 P54Y 0.150 110 0.00008300 91 N26F 0.158 95 0.00005400 92 P54S 0.103 102 0.00007900 162 N26A 0.106 98 0.00000460 19 P54F 0.143 105 0.00012000 177 N26H 0.138 112 0.00003500 44 S55A 0.112 110 0.00004200 209 N26G 0.097 94 0.00003700 97 S55D 0.146 109 0.00003600 105 N26Y 0.124 110 0.00003700 99 S55I 0.133 110 0.00001300 169 N26R 0.205 110 0.00002500 124 S55V 0.131 100 0.00004400 109 N26M 0.153 111 0.00002200 105 S55T 0.109 100 0.00001300 171 N26L 0.131 103 0.00004400 78 S55H 0.122 111 0.00000400 103 N26P 0.099 100 0.00005100 101 S55P 0.109 99 0.00003200 174 N26V 0.118 106 0.00003500 114 S55C 0.244 91 0.00006300 123 N26E 0.106 106 0.00007200 86 S55G 0.128 104 0.00003500 179 N26K 0.143 104 0.00000010 106 S55N 0.141 111 0.00001700 142 N26D 0.123 101 0.00005600 37 S55E 0.141 106 0.00003800 141 N26I 0.113 110 0.00006300 90 S55R 0.143 100 0.00004900 185 N26Q 0.119 109 0.00000010 37 S55Y 0.126 113 0.00001800 74 N26C 0.146 103 0.00000010 96 S55F 0.095 97 0.00002400 158 N26W 0.129 105 0.00006700 87 S55L 0.126 97 0.00008400 137 N26S 0.118 101 0.00000010 114 Q88P 0.238 99 na 32 I27K 0.127 99 0.00005300 73 Q88M 0.104 90 0.00009900 101 I27L 0.124 110 0.00006200 97 Q88L 0.134 107 0.00009900 32 I27G 0.123 111 0.00003000 82 Q88R na 2 na 113 I27E 0.121 98 0.00004600 69 Q88A 0.133 108 0.00011000 105 I27S 0.141 106 0.00004900 63 Q88S 0.112 104 0.00003900 96 I27D 0.107 107 0.00004600 124 Q88G 0.129 110 0.00017000 26 I27V 0.136 104 0.00003300 115 Q88W 1.290 67 0.00028000 27 I27F 0.118 104 0.00002000 133 Q88D 1.950 66 na 46 I27N 0.162 96 0.00004500 97 Q88C 0.364 100 0.00007300 62 I27Q 0.144 103 0.00006100 144 Q88H 0.117 100 0.00007800 171 I27T 0.152 97 0.00003300 115 Q88I 0.275 105 0.00005400 60 I27H 0.098 100 0.00003300 135 Q88Y 0.224 97 0.00018000 106 I27R 0.131 105 0.00002200 104 Q88V 0.219 94 0.00004900 45 I27Y 0.116 96 0.00004200 101 Q88F 0.227 88 na 14 I27A 0.111 107 0.00005300 97 Q88K 0.182 96 0.00003100 41 I27P 0.145 107 0.00000350 127 V89W 0.127 110 0.00009700 176 I27W 0.156 104 0.00006500 169 V89C 0.165 100 0.00006400 190 I27C 0.160 106 0.00003800 79 V89Q 0.090 100 0.00006300 59 I27M 0.087 97 0.00006000 137 V89H 0.194 106 0.00009900 132 G28A 0.123 92 0.00003300 60 V89F 0.116 110 0.00004600 178 G28Y 0.131 109 0.00005300 112 V89K 0.120 107 0.00005700 159 G28T 0.187 110 0.00000150 108 V89R 0.122 104 0.00003800 118 G28R 0.138 102 0.00008500 38 V89L na 31 na 0 G28I 0.132 112 0.00003300 101 V89M 0.100 103 0.00005000 91 G28S 0.140 109 0.00000230 69 V89I 0.130 113 0.00006800 156 G28D 0.126 107 0.00004000 56 V89A 0.122 106 0.00007900 73 G28E 0.120 105 0.00001800 99 V89T 0.150 115 0.00011000 46 G28N 0.111 113 0.00001800 91 V89P na 11 0.00003000 122 G28L 0.137 104 0.00000610 59 V89G 0.212 99 na 67 G28P 0.132 103 0.00006200 56 V89N 0.113 113 0.00013000 54 G28K 0.149 108 0.00003300 117 V89S 0.168 97 0.00012000 145 G28H 0.165 108 0.00001800 71 W90L 0.295 92 na 153 G28F 0.124 102 0.00003900 156 W90C 1.770 72 na 250 G28V 0.112 97 0.00004600 119 W90G na 1 na 3 G28Q 0.112 104 0.00001900 92 W90M 1.540 69 na 147 G28C 0.103 100 0.00000910 153 W90T na 36 0.00005000 32 G28W 0.142 96 0.00003700 182 W90N 3.070 64 0.00022000 176 S29P 0.174 105 0.00005200 112 W90F 0.255 88 na 63 S29K 0.146 96 0.00001500 77 W90R na 1 0.00028000 114 S29M 0.133 106 0.00002300 147 W90S na 39 0.00006100 56 S29L 0.108 100 0.00001100 105 W90I 0.768 78 0.00033000 169 S29H 0.119 100 0.00004900 119 W90V 0.156 87 na 138 S29R 0.184 105 0.00000670 51 W90Y 0.137 99 0.00003400 155 S29A 0.153 100 0.00001000 106 W90H 7.920 46 0.00000010 78 S29N 0.034 51 na 0 D91Q 0.129 108 0.00005100 115 S29F 0.190 116 0.00001900 106 D91E 0.138 115 0.00005100 197 S29G 0.090 98 0.00003500 105 D91W 0.149 110 0.00011000 287 S29T 0.096 102 0.00002200 101 D91M 0.146 99 0.00010000 215 S29V 0.109 107 0.00001300 109 D91R 0.187 105 0.00014000 169 S29Q 0.114 102 0.00002200 42 D91G 0.141 99 0.00025000 150 S29I 0.140 107 0.00003000 163 D91C 0.120 102 0.00003900 137 S29Y 0.100 102 0.00004200 82 D91L 0.141 99 0.00011000 44 S29E 0.102 114 0.00002300 56 D91H 0.130 100 0.00009200 127 S29D 0.136 109 0.00004500 105 D91N 0.133 100 0.00005000 147 S29C 0.172 108 0.00005000 86 D91T 0.186 102 0.00009100 64 E30D 0.118 96 0.00003600 96 D91F 0.149 105 0.00011000 38 E30S 0.132 114 0.00001600 36 D91I 0.136 93 0.00005300 142 E30I 0.136 108 0.00007300 135 D91V 0.222 95 0.00000010 159 E30G 0.138 94 0.00004800 108 D91S 0.167 94 0.00010000 53 E30M 0.120 100 0.00003800 160 D91A 0.186 105 0.00007500 150 E30L 0.160 96 0.00006900 101 D91K 0.184 104 0.00004200 160 E30V 0.140 108 0.00004100 164 G92Q 0.121 107 0.00012000 178 E30F 0.107 92 0.00009700 97 G92H 0.115 100 0.00015000 147 E30T 0.105 100 0.00004900 136 G92D 0.163 112 0.00013000 176 E30R 0.162 96 0.00003700 100 G92L 0.102 102 0.00028000 29 E30N 0.163 110 0.00002400 68 G92F 0.125 92 na 36 E30A 0.146 103 0.00005100 137 G92K 0.209 97 0.00009300 68 E30Y 0.152 107 0.00007600 133 G92R 0.188 100 0.00015000 114 E30C 0.114 92 0.00009600 104 G92M 0.104 99 0.00015000 136 E30Q 0.123 99 0.00000010 96 G92T 0.099 97 0.00017000 27 S31C 0.128 100 0.00017000 110 G92V 0.152 102 0.00008900 91 S31D 0.077 99 0.00019000 64 G92S 0.117 98 0.00009900 88 S31G 0.111 109 0.00005500 169 G92W 0.122 100 0.00008100 123 S31M 0.151 97 0.00030000 183 G92P 0.104 100 0.00016000 92 S31W 0.178 103 0.00034000 147 G92A 0.110 101 0.00011000 76 S31I 0.089 93 0.00015000 108 G92N 0.119 99 0.00004500 47 S31V 0.106 100 0.00006600 138 N93I 0.114 104 0.00004300 56 S31F 0.205 93 na 113 N93L 0.145 102 0.00000690 51 S31A 0.099 100 0.00005800 108 N93E 0.114 110 0.00003100 168 S31T 0.108 101 0.00011000 85 N93M 0.120 100 0.00006500 118 S31E 0.111 98 0.00031000 110 N93G 0.109 102 0.00002100 138 S31P 0.104 103 0.00006600 117 N93W 0.159 102 0.00006500 69 S31R 0.166 102 0.00004200 59 N93P 0.221 109 0.00001400 147 S31H 0.158 110 0.00004500 133 N93R 0.186 100 0.00005000 91 S31N 0.124 99 0.00007600 150 N93D 0.123 108 0.00003800 150 V32R 0.135 112 0.00000230 140 N93C 0.148 107 0.00005800 54 V32P 0.164 85 na 154 N93Y 0.108 105 0.00006500 41 V32M 0.135 103 0.00009500 191 N93A 0.108 101 0.00000750 115 V32K 0.158 101 0.00002600 122 N93S 0.105 101 0.00003400 122 V32F 0.102 100 0.00004100 138 N93V 0.139 108 0.00004000 217 V32A 0.144 108 0.00004700 140 N93T 0.161 103 0.00003100 142 V32L 0.126 104 0.00004900 138 N93F 0.165 100 0.00000220 31 V32Y 0.103 106 0.00001900 142 S94G 0.146 100 0.00006800 210 V32N 0.123 104 0.00004400 128 S94V 0.119 108 0.00002800 112 V32T 0.107 107 0.00007000 190 S94I 0.126 106 0.00004300 124 V32G 0.240 103 0.00006500 71 S94K 0.185 104 0.00000010 197 V32H 0.147 100 0.00007300 155 S94A 0.107 99 0.00004600 174 V32I 0.133 113 0.00002000 33 S94D 0.122 103 0.00003400 59 V32Q 0.166 91 0.00025000 112 S94L 0.169 103 0.00004400 71 V32W 0.145 102 0.00023000 104 S94Y 0.098 100 0.00006200 213 V32S 0.124 102 0.00005100 79 S94R 0.123 104 0.00005700 65 V32D 0.141 92 0.00025000 85 S94E 0.122 100 0.00001400 147 V32C 0.108 99 0.00000510 106 S94N 0.133 103 0.00003300 195 H33Y 0.120 98 0.00007500 129 S94T 0.116 109 0.00003200 149 H33P 0.253 90 na 310 S94W 0.159 103 0.00004300 146 H33C 0.123 108 0.00006800 194 S94M 0.117 101 0.00001200 146 H33T 0.114 99 0.00014000 163 S94F 0.132 100 0.00000010 50 H33N 0.165 113 0.00011000 105 S94C 0.138 99 0.00000010 171 H33V 0.147 104 0.00018000 164 D95P na 4 na 204 H33S 0.112 103 0.00000460 171 D95C na 4 na 154 H33A 0.121 96 0.00013000 126 D95H 29.70 33 0.00000810 127 H33M 0.107 102 0.00005200 173 D95G 6.560 47 na 87 H33G 0.120 102 0.00009600 164 D95W na 5 na 209 H33L 0.115 114 0.00005500 201 D95L na 6 0.00010000 224 H33Q 0.131 101 0.00004400 97 D95Y na 4 0.00013000 62 H33I 0.121 104 0.00009700 142 D95S na 37 0.00003500 97 H33W 0.666 80 na 136 D95I na 4 0.00016000 127 H33R 2.190 68 na 92 D95R na 4 na 44 H33D 0.166 99 0.00006800 42 D95A na 12 0.00020000 62 H33E 0.121 100 0.00003600 126 D95V na 3 na 67 H33F 0.122 113 0.00010000 50 D95E 8.040 44 na 147 H33K 0.174 96 na 145 D95M na 8 0.00001400 151 D49H 0.183 90 na 314 D95N 1.030 78 na 263 D49N 0.190 108 na 155 D95F na ?1 na 124 D49Y 0.151 99 na 136 H96E 0.122 100 0.00001100 136 D49E 0.193 87 na 94 H96W 0.155 103 0.00012000 45 D49T 0.107 89 na 142 H96G 0.130 95 0.00015000 91 D49C 0.789 85 na 135 H96Y 0.134 103 0.00006900 222 D49A 0.106 100 0.00018000 178 H96N 0.143 112 0.00004400 113 D49F 0.256 94 na 22 H96L 0.176 98 0.00013000 50 D49V 0.206 97 na 47 H96K 0.179 98 0.00006400 160 D49K 1.340 83 na 150 H96Q 0.106 104 0.00005000 135 D49L 0.529 92 na 263 H96R 0.095 102 0.00014000 146 D49M 0.224 85 na 138 H96T 0.110 110 0.00001800 113 D49G 0.102 102 0.00029000 60 H96S 0.097 102 0.00003000 105 D49R 1.860 72 na 142 H96D 0.111 100 0.00002200 223 D49S 0.098 98 0.00009900 99 H96P 7.300 50 na 185 D49W 0.126 101 0.00032000 33 H96V 0.130 91 0.00004100 173 D49P 0.195 96 na 35 V97F 3.020 45 0.00002100 28 D49I 0.149 83 na 92 V97W na 1 0.00032000 226 D50S 0.118 100 0.00000410 108 V97A 2.090 68 na 77 D50Q 0.171 107 0.00007900 133 V97R na ?1 na 32 D50G 0.136 107 0.00001700 164 V97I 0.120 110 0.00001700 138 D50P 0.124 77 na 195 V97K 0.444 96 na 109 D50V 0.106 105 0.00002200 136 V97H 1.470 71 na 69 D50E 0.123 91 0.00016000 58 V97S 0.308 84 na 24 D50W 0.145 108 0.00017000 140 V97L 0.129 110 0.00005900 118 D50L 0.095 106 0.00013000 181 V97E 0.150 92 na 32 D50T 0.120 104 0.00003900 158 V97G 0.510 75 na 121 D50I 0.114 109 0.00008200 119 V97M 0.214 103 0.00003300 104 D50M 0.125 110 0.00013000 214 V97P 2.550 65 na 100 D50H 0.126 94 0.00019000 121 V97D 0.375 67 na 113 D50A 0.211 105 0.00007600 103 V97N 0.206 95 0.00033000 153 D50R 0.122 110 0.00013000 165 V97T 0.142 99 0.00010000 129 D50K 0.200 109 0.00017000 19 V97C 0.190 104 0.00023000 155 D50F 0.124 113 0.00010000 151 V98M 0.114 108 0.00007200 46 D50Y 0.157 113 0.00016000 36 V98N 0.111 112 0.00002100 97 D50C 0.153 109 0.00003900 117 V98I 0.105 116 0.00003300 186 S51I 0.097 102 0.00005000 51 V98F 0.161 102 0.00001600 117 S51Q 0.115 107 0.00006500 158 V98P 0.131 89 0.00007300 108 S51R 0.103 98 0.00012000 172 V98C 0.105 100 0.00006400 117 S51N 0.113 100 0.00005300 51 V98Q 0.121 111 0.00003700 123 S51T 0.121 102 0.00002500 183 V98S 0.094 107 0.00003900 53 S51L 0.099 97 0.00009600 90 V98R 0.099 99 0.00011000 160 S51F 0.120 100 0.00000010 54 V98T 0.088 99 0.00003100 114 S51P 0.329 101 na 146 V98G 0.118 105 0.00001100 73 S51A 0.123 109 0.00004700 68 V98W 0.099 99 0.00005600 32 S51E 0.108 107 0.00007200 67 V98Y 0.109 100 0.00005900 94 S51D 0.098 97 0.00003700 72 V98K 0.111 106 0.00009000 147 S51C 0.147 112 0.00004700 32 V98A 0.139 99 0.00004600 44 S51V 0.139 110 0.00002000 123 V98L 0.121 105 0.00013000 27 S51G 0.129 104 0.00010000 29 V98H 0.107 103 0.00001800 100 D52F 0.105 102 0.00000790 453 S51G 0.129 104 0.00010000 29 D52E 0.114 123 0.00000010 12 D52F 0.105 102 0.00000790 453 D52N 0.124 115 0.00000069 100 D52E 0.114 123 0.00000010 12 D52G 0.125 109 0.00003700 424 D52N 0.124 115 0.00000069 100 D52Q 0.107 101 0.00002700 131 D52G 0.125 109 0.00003700 424 D52Y 0.110 102 0.00009100 32 D52Q 0.107 101 0.00002700 131 D52V 0.125 114 0.00006900 171 D52Y 0.110 102 0.00009100 32 D52M 0.144 105 0.00002400 227 D52V 0.125 114 0.00006900 171 D52H 0.109 97 0.00003600 74 D52M 0.144 105 0.00002400 227 D52I 0.140 110 0.00002800 54 D52H 0.109 97 0.00003600 74 D52K 0.117 101 0.00009200 41 D52I 0.140 110 0.00002800 54 D52R 0.091 96 0.00002900 73 D52K 0.117 101 0.00009200 41 D52S 0.098 108 0.00004000 19 D52R 0.091 96 0.00002900 73 D52T 0.109 100 0.00001800 158 D52S 0.098 108 0.00004000 19 D52P 0.117 90 na 145 D52T 0.109 100 0.00001800 158 D52A 0.163 101 0.00004800 13 D52P 0.117 90 na 145 D52L 0.107 106 0.00005700 63 D52A 0.163 101 0.00004800 13 R53Q 0.131 100 0.00024000 181 D52L 0.107 106 0.00005700 63 R53L 0.151 106 0.00002000 117 R53Q 0.131 100 0.00024000 181 R53D 0.192 74 na 64 R53L 0.151 106 0.00002000 117 R53V 0.112 101 0.00001700 88 R53D 0.192 74 na 64 R53I 0.151 100 0.00001700 28 R53V 0.112 101 0.00001700 88 R53P 0.126 92 0.00028000 40 R53I 0.151 100 0.00001700 28 R53T 0.134 109 0.00008700 128 R53P 0.126 92 0.00028000 40 R53S 0.113 105 0.00029000 82 R53T 0.134 109 0.00008700 128 R53W 0.094 92 na 150 R53S 0.113 105 0.00029000 82 R53H 0.153 103 0.00015000 212 R53W 0.094 92 na 150 R53G 0.128 96 na 179 R53H 0.153 103 0.00015000 212 R53C 0.147 107 0.00044000 50 R53G 0.128 96 na 179 R53M 0.099 95 0.00018000 146 R53C 0.147 107 0.00044000 50 R53A 0.132 89 0.00020000 191 R53M 0.099 95 0.00018000 146 R53F 0.125 98 na 131 R53A 0.132 89 0.00020000 191 R53Y 0.183 88 na 219 R53F 0.125 98 na 131 R53K 0.114 98 0.00004000 153 R53Y 0.183 88 na 219 R53N 0.080 100 0.00015000 28 R53K 0.114 98 0.00004000 153 P54R 0.111 104 0.00011000 41 R53N 0.080 100 0.00015000 28 P54A 0.112 105 0.00002600 223 P54R 0.111 104 0.00011000 41 P54D 0.115 96 0.00028000 195 P54A 0.112 105 0.00002600 223 P54I 0.115 112 0.00003500 121 P54D 0.115 96 0.00028000 195 P54V 0.110 109 0.00004100 154 P54I 0.115 112 0.00003500 121 P54W 0.091 98 0.00017000 53 P54V 0.110 109 0.00004100 154 P54L 0.133 108 0.00009600 156 P54W 0.091 98 0.00017000 53 P54G 0.141 114 0.00005100 156 P54L 0.133 108 0.00009600 156 P54N 0.150 105 0.00014000 187 P54G 0.141 114 0.00005100 156 P54M 0.087 98 0.00003200 167 P54N 0.150 105 0.00014000 187 P54H 0.111 100 0.00014000 124 P54M 0.087 98 0.00003200 167 P54C 0.116 100 0.00012000 17 P54H 0.111 100 0.00014000 124 P54E 0.126 99 na 59 P54C 0.116 100 0.00012000 17 P54K 0.131 100 0.00016000 163 P54E 0.126 99 na 59 P54T 0.113 108 0.00018000 45 P54K 0.131 100 0.00016000 163 P54Y 0.150 110 0.00008300 91 P54T 0.113 108 0.00018000 45 P54S 0.103 102 0.00007900 162 P54Y 0.150 110 0.00008300 91 P54F 0.143 105 0.00012000 177 P54S 0.103 102 0.00007900 162 S55A 0.112 110 0.00004200 209 P54F 0.143 105 0.00012000 177 S55D 0.146 109 0.00003600 105 S55A 0.112 110 0.00004200 209 S55I 0.133 110 0.00001300 169 S55D 0.146 109 0.00003600 105 S55V 0.131 100 0.00004400 109 S55I 0.133 110 0.00001300 169 S55T 0.109 100 0.00001300 171 S55V 0.131 100 0.00004400 109 S55H 0.122 111 0.00000400 103 S55T 0.109 100 0.00001300 171 S55P 0.109 99 0.00003200 174 S55H 0.122 111 0.00000400 103 S55C 0.244 91 0.00006300 123 S55P 0.109 99 0.00003200 174 S55G 0.128 104 0.00003500 179 S55C 0.244 91 0.00006300 123 S55N 0.141 111 0.00001700 142 S55G 0.128 104 0.00003500 179 S55E 0.141 106 0.00003800 141 S55N 0.141 111 0.00001700 142 S55R 0.143 100 0.00004900 185 S55E 0.141 106 0.00003800 141 S55Y 0.126 113 0.00001800 74 S55R 0.143 100 0.00004900 185 S55F 0.095 97 0.00002400 158 S55Y 0.126 113 0.00001800 74 S55L 0.126 97 0.00008400 137 S55F 0.095 97 0.00002400 158 Q88P 0.238 99 na 32 S55L 0.126 97 0.00008400 137 Q88M 0.104 90 0.00009900 101 Q88P 0.238 99 na 32 Q88L 0.134 107 0.00009900 32 Q88M 0.104 90 0.00009900 101 Q88R na 2 na 113 Q88L 0.134 107 0.00009900 32 Q88A 0.133 108 0.00011000 105 Q88R na 2 na 113 Q88S 0.112 104 0.00003900 96 Q88A 0.133 108 0.00011000 105 Q88G 0.129 110 0.00017000 26 Q88S 0.112 104 0.00003900 96 Q88W 1.290 67 0.00028000 27 Q88G 0.129 110 0.00017000 26 Q88D 1.950 66 na 46 Q88W 1.290 67 0.00028000 27 Q88C 0.364 100 0.00007300 62 Q88D 1.950 66 na 46 Q88H 0.117 100 0.00007800 171 Q88C 0.364 100 0.00007300 62 Q88I 0.275 105 0.00005400 60 Q88H 0.117 100 0.00007800 171 Q88Y 0.224 97 0.00018000 106 Q88I 0.275 105 0.00005400 60 Q88V 0.219 94 0.00004900 45 Q88Y 0.224 97 0.00018000 106 Q88F 0.227 88 na 14 Q88V 0.219 94 0.00004900 45 Q88K 0.182 96 0.00003100 41 Q88F 0.227 88 na 14 V89W 0.127 110 0.00009700 176 Q88K 0.182 96 0.00003100 41 V89C 0.165 100 0.00006400 190 V89W 0.127 110 0.00009700 176 V89Q 0.090 100 0.00006300 59 V89C 0.165 100 0.00006400 190 V89H 0.194 106 0.00009900 132 V89Q 0.090 100 0.00006300 59 V89F 0.116 110 0.00004600 178 V89H 0.194 106 0.00009900 132 V89K 0.120 107 0.00005700 159 V89F 0.116 110 0.00004600 178 V89R 0.122 104 0.00003800 118 V89K 0.120 107 0.00005700 159 V89L na 31 na 0 V89R 0.122 104 0.00003800 118 V89M 0.100 103 0.00005000 91 V89L na 31 na 0 V89I 0.130 113 0.00006800 156 V89M 0.100 103 0.00005000 91 V89A 0.122 106 0.00007900 73 V89I 0.130 113 0.00006800 156 V89T 0.150 115 0.00011000 46 V89A 0.122 106 0.00007900 73 V89P na 11 0.00003000 122 V89T 0.150 115 0.00011000 46 V89G 0.212 99 na 67 V89P na 11 0.00003000 122 V89N 0.113 113 0.00013000 54 V89G 0.212 99 na 67 V89S 0.168 97 0.00012000 145 V89N 0.113 113 0.00013000 54 W90L 0.295 92 na 153 V89S 0.168 97 0.00012000 145 W90C 1.770 72 na 250 W90L 0.295 92 na 153 W90G na 1 na 3 W90C 1.770 72 na 250 W90M 1.540 69 na 147 W90G na 1 na 3 W90T 36 0.00005000 32 W90M 1.540 69 na 147 W90N 3.070 64 0.00022000 176 W90T 36 0.00005000 32 W90F 0.255 88 na 63 W90N 3.070 64 0.00022000 176 W90R na 1 0.00028000 114 W90F 0.255 88 na 63 W90S na 39 0.00006100 56 W90R na 1 0.00028000 114 W90I 0.768 78 0.00033000 169 W90S na 39 0.00006100 56 W90V 0.156 87 na 138 W90I 0.768 78 0.00033000 169 W90Y 0.137 99 0.00003400 155 W90V 0.156 87 na 138 W90H 7.920 46 0.00000010 78 W90Y 0.137 99 0.00003400 155 D91Q 0.129 108 0.00005100 115 W90H 7.920 46 0.00000010 78 D91E 0.138 115 0.00005100 197 D91Q 0.129 108 0.00005100 115 D91W 0.149 110 0.00011000 287 D91E 0.138 115 0.00005100 197 D91M 0.146 99 0.00010000 215 D91W 0.149 110 0.00011000 287 D91R 0.187 105 0.00014000 169 D91M 0.146 99 0.00010000 215 D91G 0.141 99 0.00025000 150 D91R 0.187 105 0.00014000 169 D91C 0.120 102 0.00003900 137 D91G 0.141 99 0.00025000 150 D91L 0.141 99 0.00011000 44 D91C 0.120 102 0.00003900 137 D91H 0.130 100 0.00009200 127 D91L 0.141 99 0.00011000 44 D91N 0.133 100 0.00005000 147 D91H 0.130 100 0.00009200 127 D91T 0.186 102 0.00009100 64 D91N 0.133 100 0.00005000 147 D91F 0.149 105 0.00011000 38 D91T 0.186 102 0.00009100 64 D91I 0.136 93 0.00005300 142 D91F 0.149 105 0.00011000 38 D91V 0.222 95 0.00000010 159 D91I 0.136 93 0.00005300 142 D91S 0.167 94 0.00010000 53 D91V 0.222 95 0.00000010 159 D91A 0.186 105 0.00007500 150 D91S 0.167 94 0.00010000 53 D91K 0.184 104 0.00004200 160 D91A 0.186 105 0.00007500 150 G92Q 0.121 107 0.00012000 178 D91K 0.184 104 0.00004200 160 G92H 0.115 100 0.00015000 147 G92Q 0.121 107 0.00012000 178 G92D 0.163 112 0.00013000 176 G92H 0.115 100 0.00015000 147 G92L 0.102 102 0.00028000 29 G92D 0.163 112 0.00013000 176 G92F 0.125 92 na 36 G92L 0.102 102 0.00028000 29 G92K 0.209 97 0.00009300 68 G92F 0.125 92 na 36 G92R 0.188 100 0.00015000 114 G92K 0.209 97 0.00009300 68 G92M 0.104 99 0.00015000 136 G92R 0.188 100 0.00015000 114 G92T 0.099 97 0.00017000 27 G92M 0.104 99 0.00015000 136 G92V 0.152 102 0.00008900 91 G92T 0.099 97 0.00017000 27 G92S 0.117 98 0.00009900 88 G92V 0.152 102 0.00008900 91 G92W 0.122 100 0.00008100 123 G92S 0.117 98 0.00009900 88 G92P 0.104 100 0.00016000 92 G92W 0.122 100 0.00008100 123 G92A 0.110 101 0.00011000 76 G92P 0.104 100 0.00016000 92 G92N 0.119 99 0.00004500 47 G92A 0.110 101 0.00011000 76 N93I 0.114 104 0.00004300 56 G92N 0.119 99 0.00004500 47 N93L 0.145 102 0.00000690 51 N93I 0.114 104 0.00004300 56 N93E 0.114 110 0.00003100 168 N93L 0.145 102 0.00000690 51 N93M 0.120 100 0.00006500 118 N93E 0.114 110 0.00003100 168 N93G 0.109 102 0.00002100 138 N93M 0.120 100 0.00006500 118 N93W 0.159 102 0.00006500 69 N93G 0.109 102 0.00002100 138 N93P 0.221 109 0.00001400 147 N93W 0.159 102 0.00006500 69 N93R 0.186 100 0.00005000 91 N93P 0.221 109 0.00001400 147 N93D 0.123 108 0.00003800 150 N93R 0.186 100 0.00005000 91 N93C 0.148 107 0.00005800 54 N93D 0.123 108 0.00003800 150 N93Y 0.108 105 0.00006500 41 N93C 0.148 107 0.00005800 54 N93A 0.108 101 0.00000750 115 N93Y 0.108 105 0.00006500 41 N93S 0.105 101 0.00003400 122 N93A 0.108 101 0.00000750 115 N93V 0.139 108 0.00004000 217 N93S 0.105 101 0.00003400 122 N93T 0.161 103 0.00003100 142 N93V 0.139 108 0.00004000 217 N93F 0.165 100 0.00000220 31 N93T 0.161 103 0.00003100 142 S94G 0.146 100 0.00006800 210 N93F 0.165 100 0.00000220 31 S94V 0.119 108 0.00002800 112 S94G 0.146 100 0.00006800 210 S94I 0.126 106 0.00004300 124 S94V 0.119 108 0.00002800 112 S94K 0.185 104 0.00000010 197 S94I 0.126 106 0.00004300 124 S94A 0.107 99 0.00004600 174 S94K 0.185 104 0.00000010 197 S94D 0.122 103 0.00003400 59 S94A 0.107 99 0.00004600 174 S94L 0.169 103 0.00004400 71 S94D 0.122 103 0.00003400 59 S94Y 0.098 100 0.00006200 213 S94L 0.169 103 0.00004400 71 S94R 0.123 104 0.00005700 65 S94Y 0.098 100 0.00006200 213 S94E 0.122 100 0.00001400 147 S94R 0.123 104 0.00005700 65 S94N 0.133 103 0.00003300 195 S94E 0.122 100 0.00001400 147 S94T 0.116 109 0.00003200 149 S94N 0.133 103 0.00003300 195 S94W 0.159 103 0.00004300 146 S94T 0.116 109 0.00003200 149 S94M 0.117 101 0.00001200 146 S94W 0.159 103 0.00004300 146 S94F 0.132 100 0.00000010 50 S94M 0.117 101 0.00001200 146 S94C 0.138 99 0.00000010 171 S94F 0.132 100 0.00000010 50 D95P na 4 na 204 S94C 0.138 99 0.00000010 171 D95C na 4 na 154 D95P na 4 na 204 D95H 29.700 33 0.00000810 127 D95C na 4 na 154 D95G 6.560 47 na 87 D95H 29.700 33 0.00000810 127 D95W na 5 na 209 D95G 6.560 47 na 87 D95L na 6 0.00010000 224 D95W na 5 na 209 D95Y na 4 0.00013000 62 D95L na 6 0.00010000 224 D95S na 37 0.00003500 97 D95Y na 4 0.00013000 62 D95I na 4 0.00016000 127 D95S na 37 0.00003500 97 D95R na 4 na 44 D95I na 4 0.00016000 127 D95A na 12 0.00020000 62 D95R na 4 na 44 D95V na 3 na 67 D95A na 12 0.00020000 62 D95E 8.040 44 na 147 D95V na 3 na 67 D95M na 8 0.00001400 151 D95E 8.040 44 na 147 D95N 1.030 78 na 263 D95M na 8 0.00001400 151 D95F na ?1 na 124 D95N 1.030 78 na 263 H96E 0.122 100 0.00001100 136 D95F na ?1 na 124 H96W 0.155 103 0.00012000 45 H96E 0.122 100 0.00001100 136 H96G 0.130 95 0.00015000 91 H96W 0.155 103 0.00012000 45 H96Y 0.134 103 0.00006900 222 H96G 0.130 95 0.00015000 91 H96N 0.143 112 0.00004400 113 H96Y 0.134 103 0.00006900 222 H96L 0.176 98 0.00013000 50 H96N 0.143 112 0.00004400 113 H96K 0.179 98 0.00006400 160 H96L 0.176 98 0.00013000 50 H96Q 0.106 104 0.00005000 135 H96K 0.179 98 0.00006400 160 H96R 0.095 102 0.00014000 146 H96Q 0.106 104 0.00005000 135 H96T 0.110 110 0.00001800 113 H96R 0.095 102 0.00014000 146 H96S 0.097 102 0.00003000 105 H96T 0.110 110 0.00001800 113 H96D 0.111 100 0.00002200 223 H96S 0.097 102 0.00003000 105 H96P 7.300 50 na 185 H96D 0.111 100 0.00002200 223 H96V 0.130 91 0.00004100 173 H96P 7.300 50 na 185 V97F 3.020 45 0.00002100 28 H96V 0.130 91 0.00004100 173 V97W na 1 0.00032000 226 V97F 3.020 45 0.00002100 28 V97A 2.090 68 na 77 V97W na 1 0.00032000 226 V97R na ?1 na 32 V97A 2.090 68 na 77 V97I 0.120 110 0.00001700 138 V97R na ?1 na 32 V97K 0.444 96 na 109 V97I 0.120 110 0.00001700 138 V97H 1.470 71 na 69 V97K 0.444 96 na 109 V97S 0.308 84 na 24 V97H 1.470 71 na 69 V97L 0.129 110 0.00005900 118 V97S 0.308 84 na 24 V97E 0.150 92 na 32 V97L 0.129 110 0.00005900 118 V97G 0.510 75 na 121 V97E 0.150 92 na 32 V97M 0.214 103 0.00003300 104 V97G 0.510 75 na 121 V97P 2.550 65 na 100 V97M 0.214 103 0.00003300 104 V97D 0.375 67 na 113 V97P 2.550 65 na 100 V97N 0.206 95 0.00033000 153 V97D 0.375 67 na 113 V97T 0.142 99 0.00010000 129 V97N 0.206 95 0.00033000 153 V97C 0.190 104 0.00023000 155 V97T 0.142 99 0.00010000 129 V98M 0.114 108 0.00007200 46 V97C 0.190 104 0.00023000 155 V98N 0.111 112 0.00002100 97 V98M 0.114 108 0.00007200 46 V98I 0.105 116 0.00003300 186 V98N 0.111 112 0.00002100 97 V98F 0.161 102 0.00001600 117 V98I 0.105 116 0.00003300 186 V98P 0.131 89 0.00007300 108 V98F 0.161 102 0.00001600 117 V98C 0.105 100 0.00006400 117 V98P 0.131 89 0.00007300 108 V98Q 0.121 111 0.00003700 123 V98C 0.105 100 0.00006400 117 V98S 0.094 107 0.00003900 53 V98Q 0.121 111 0.00003700 123 V98R 0.099 99 0.00011000 160 V98S 0.094 107 0.00003900 53 V98T 0.088 99 0.00003100 114 V98R 0.099 99 0.00011000 160 V98G 0.118 105 0.00001100 73 V98T 0.088 99 0.00003100 114 V98W 0.099 99 0.00005600 32 V98G 0.118 105 0.00001100 73 V98Y 0.109 100 0.00005900 94 V98W 0.099 99 0.00005600 32 V98K 0.111 106 0.00009000 147 V98Y 0.109 100 0.00005900 94 V98A 0.139 99 0.00004600 44 V98K 0.111 106 0.00009000 147 V98L 0.121 105 0.00013000 27 V98A 0.139 99 0.00004600 44 V98H 0.107 103 0.00001800 100 V98L 0.121 105 0.00013000 27 na. not available

(405) TABLE-US-00025 TABLE D2 16H7 variants with single point mutations in the heavy chain Mean Mean Mean Rel. Mean Mean Mean Rel. EC50 E max koff Expression EC50 E max koff Expression Substitution (nM) (%) (1/s) (%) Substitution (nM) (%) (1/s) (%) G26D 0.179 104 0.000041 126 S60P 1.03 77 na 120 G26M 0.147 102 0.000049 109 S60V 1.67 71 na 103 G26Y 0.148 101 0.0000001 114 S60R na 15 0.00016 119 G26N 0.219 95 0.000079 154 S60M 7.89 46 na 118 G26Q 0.154 97 0.000031 145 Y61A 0.086 100 0.00002 114 G26E 0.257 105 0.000018 137 Y61I 0.137 100 0.000042 121 G26T 0.114 98 0.0001 88 Y61D 0.109 100 0.000045 41 G26V 0.166 99 na 99 Y61G 0.163 101 0.000073 127 G26I 0.241 97 0.000038 85 Y61V 0.172 104 0.00004 136 G26A 0.15 115 0.000042 85 Y61W 0.103 99 0.00009 101 G26S 0.205 122 0.00006 133 Y61P 0.134 111 0.000076 81 G26P 0.198 106 0.000098 176 Y61E 0.106 105 0.00011 131 G26R 0.201 133 0.000064 152 Y61L 0.122 100 0.000056 99 G26L 0.2 107 0.000057 128 Y61S 0.09 96 0.000036 106 G26K 0.121 117 0.000054 145 Y61H 0.094 105 0.000032 107 G26F 0.168 115 0.000055 133 Y61T 0.099 103 0.000039 92 G26W 0.215 106 0.000043 124 Y61M 0.133 100 0.000031 97 F27D 0.162 100 0.0000081 85 Y61N 0.682 86 na 98 F27K 0.198 115 0.000075 119 Y61C 0.105 106 0.000041 123 F27E 0.182 113 0.000019 122 Y61K 0.129 109 0.00003 119 F27Y 0.177 97 0.00005 162 Y61R 0.158 115 0.000073 137 F27M 0.218 105 0.000078 158 Y61F 0.143 105 0.000012 142 F27I 0.146 101 0.000037 138 S62T 0.111 103 0.000099 117 F27A 0.164 101 0.000036 102 S62Q 0.095 97 0.000021 113 F27N 0.199 91 0.0000051 157 S62V 0.12 100 0.00011 120 F27L 0.157 102 0.00006 159 S62E 0.122 103 0.000075 127 F27Q 0.222 106 0.0000017 150 S62M 0.159 103 0.000047 143 F27S 0.287 112 0.000034 147 S62R 0.127 106 0.000029 96 F27W 0.168 120 0.000018 153 S62N 0.122 103 0.000042 82 F27P 0.233 102 0.000077 141 S62W 0.797 83 0.000063 84 F27T 0.16 103 na 142 S62G 0.134 105 0.000011 134 F27G 0.183 108 0.000022 149 S62Y 0.106 102 0.00003 135 F27V 0.215 118 0.000027 150 S62P 0.183 104 0.000012 89 F27R 0.218 114 0.00011 172 S62F 0.163 109 0.000029 121 S28Q 0.116 100 0.00005 129 S62H 0.115 105 0.000045 132 S28D 0.127 97 0.000041 131 S62L 0.108 104 0.000015 99 S28N 0.122 105 0.000024 153 S62D 0.134 101 0.000034 123 S28C 0.186 98 0.000036 143 S62C 0.142 106 0.000062 102 S28V 0.203 105 0.000043 150 T63Y 0.12 102 0.000026 112 S28I 0.113 105 0.000064 143 T63V 0.154 103 0.000028 122 S28K 0.098 118 0.000042 146 T63W 0.121 105 0.000029 76 S28Y 0.168 107 0.000019 167 T63M 0.119 99 0.000034 115 S28L 0.103 105 0.000032 146 T63C 0.124 98 0.000045 108 S28W 0.093 101 0.000034 102 T63Q 0.118 105 0.000021 113 S28P 0.118 100 0.000062 135 T63F 0.1 98 0.000025 83 S28F 0.158 103 0.000044 140 T63K 0.138 99 0.000013 114 S28R 0.12 119 0.000059 155 T63I 0.107 107 0.000021 123 S28G 0.164 114 0.000011 144 T63G 0.162 100 0.000031 49 S28H 0.136 106 0.000053 156 T63S 0.091 103 0.000065 80 S28E 0.19 101 0.000075 125 T63H 0.105 101 0.0000001 140 L29K 0.274 89 na 138 T63R 0.133 101 0.00002 123 L29S 0.201 95 0.00024 133 T63L 0.13 114 0.000019 120 L29T 0.166 106 0.000086 102 T63A 0.12 105 0.000041 102 L29P 0.201 100 0.00017 129 S64C 0.115 106 0.000017 120 L29G 0.303 93 0.00024 105 S64G 0.148 101 0.000043 104 L29M 0.12 99 0.000053 124 S64A 0.113 104 0.000045 150 L29W 0.195 100 0.00028 156 S64P 0.163 107 0.000034 147 L29F 0.214 98 0.000086 166 S64H 0.127 109 0.00004 132 L29Y 0.247 98 0.00028 153 S64M 0.113 104 0.000026 141 L29N 0.263 99 na 121 S64W 0.18 99 0.0000052 146 L29I 0.108 95 0.000082 130 S64F 0.167 103 0.000035 95 L29A 0.231 101 0.00023 129 S64E 0.117 107 0.00003 101 L29D 0.303 72 na 34 S64R 0.104 99 0.000032 98 L29R 0.326 98 0.00037 157 S64Y 0.131 100 0.0000062 128 L29H 0.434 116 0.00025 149 S64K 0.213 103 0.000017 149 L29V 0.202 109 0.000033 123 S64Q 0.124 107 0.000017 135 L29E 0.28 76 na 143 S64V 0.101 100 0.000046 127 L29Q 0.313 91 0.00025 153 S64L 0.095 98 0.000034 115 L29C 1.63 78 na 138 S64T 0.128 111 0.000064 11 N30K 0.134 118 0.000029 145 S64N 0.134 103 0.000038 88 N30C 0.124 108 0.000051 154 L65N 0.102 105 0.000051 127 N30D 0.172 107 0.000037 138 L65M 0.086 102 0.000046 136 N30M 0.148 110 0.000041 136 L65C 0.122 109 0.000039 98 N30P 0.154 97 0.00015 136 L65S 0.104 101 0.000041 117 N30A 0.106 98 0.00004 98 L65G 0.094 104 0.000022 142 N30L 0.132 107 0.000041 140 L65W 0.141 102 0.000046 113 N30W 0.186 110 0.000048 115 L65T 0.104 105 0.000054 117 N30S 0.159 102 0.000056 163 L65K 0.124 105 0.000028 138 N30V 0.191 112 0.000055 144 L65P 0.179 99 0.0000063 127 N30H 0.154 106 0.000046 158 L65F 0.097 107 0.000051 88 N30T 0.102 105 0.000054 140 L65I 0.136 103 0.000037 146 N30I 0.115 105 0.000084 150 L65Q 0.129 107 0.000024 115 N30F 0.158 113 0.000065 139 L65V 0.174 104 0.00003 103 N30R 0.146 105 0.000029 162 L65H 0.092 103 0.000031 125 N30G 0.162 100 0.00007 149 L65D 0.114 112 0.000023 119 N31W 0.144 95 0.00009 132 L65A 0.137 106 0.000058 141 N31G 0.142 92 0.0001 135 L65Y 0.118 108 0.000049 136 N31E 0.153 97 0.000053 138 L65R 0.097 100 0.00002 80 N31D 0.155 109 0.000056 147 L65E 0.172 93 0.000095 128 N31F 0.145 93 0.0003 139 K66C 0.124 106 0.000057 126 N31R 0.231 107 0.00016 156 K66Q 0.117 102 0.000084 138 N31L 0.134 112 0.00012 139 K66D 0.116 106 0.000053 134 N31Y 0.103 105 0.00014 115 K66N 0.127 100 0.000041 127 N31M 0.098 104 0.0001 72 K66L 0.085 100 0.000064 99 N31Q 0.146 104 0.00011 148 K66E 0.097 105 0.000083 95 N31P 0.884 74 na 121 K66F 0.133 100 0.00006 140 N31I 0.167 108 0.00013 117 K66M 0.096 98 0.00009 114 N31A 0.124 105 0.00013 137 K66R 0.1 99 0.000082 111 N31T 0.139 103 0.00006 133 K66H 0.127 110 0.000063 113 N31K 0.193 111 0.00021 170 K66V 0.115 95 0.000047 124 N31S 0.157 106 0.000049 131 K66G 0.12 103 0.000043 137 A32C 0.158 102 0.00012 92 K66W 0.197 103 0.000073 142 A32S 0.192 92 0.000022 92 K66S 0.095 99 0.000064 104 A32W 0.113 108 0.000053 169 K66I 0.187 104 0.000028 135 A32I 0.205 124 0.00005 107 K66P 0.161 100 0.000034 138 A32T 0.135 70 0.0000087 120 K66Y 0.187 100 0.000057 110 A32K 0.122 116 0.00017 150 S67N 0.085 101 0.000044 125 A32G 0.139 96 0.000073 88 S67M 0.1 98 0.000063 140 A32R 0.144 118 0.00026 137 S67L 0.14 101 0.000061 51 A32F 0.124 108 0.000018 74 S67C 0.101 100 0.000029 116 A32V 0.102 93 0.000043 138 S67F 0.095 96 0.000049 145 A32H 0.151 97 0.000034 154 S67K 0.137 104 0.000011 114 A32Q 0.089 111 0.000071 153 S67G 0.097 110 0.00004 122 A32L 0.149 112 0.00016 140 S67Y 0.104 106 0.000046 127 A32Y 0.111 105 0.000027 91 S67T 0.164 104 0.000016 155 A32E 0.177 113 0.00029 157 S67Q 0.171 104 0.000026 137 A32N 0.099 110 0.000013 152 S67A 0.155 97 0.000056 102 A32D 0.164 100 0.00016 142 S67P 0.135 96 0.000055 99 R33D 0.104 102 0.000042 135 S67I 0.138 107 0.000029 120 R33K 0.12 107 0.000087 145 S67E 0.11 100 0.000051 101 R33F 0.177 107 0.000033 94 S67V 0.135 105 0.0000001 121 R33V 0.119 98 0.000036 148 S67W 0.1 101 0.000039 121 R33E 0.102 102 0.000031 145 S67H 0.139 116 0.000034 126 R33L 0.124 106 0.000074 127 S100N 0.121 103 0.00012 133 R33P 0.186 99 0.00021 171 S100L 0.122 100 0.000084 154 R33A 0.12 102 0.0000001 137 S100G 0.191 99 0.00023 160 R33I 0.16 99 0.00007 143 S100D 0.087 100 0.00011 130 R33G 0.143 109 0.000063 146 S100R na 3 na 124 R33Q 0.152 101 0.0000037 139 S100T 0.097 96 0.00018 108 R33T 0.281 101 0.0000029 136 S100F na 6 0.000059 101 R33C 0.205 104 0.000027 78 S100C 0.095 100 0.00011 86 R33N 0.179 91 0.000039 151 S100I 0.091 99 0.000049 150 R33M 0.16 99 0.000013 114 S100A 0.099 102 0.000027 117 R33S 0.226 94 0.000025 75 S100V 0.105 97 0.000042 132 M34F 0.109 97 0.000029 92 S100Q 0.131 98 0.00021 126 M34N 0.189 116 0.00008 154 S100E 0.119 107 0.000042 140 M34Y 0.125 112 0.000013 166 S100W na 5 0.000021 124 M34P 0.643 86 0.00027 122 S100Y na 36 0.000091 137 M34S 0.116 100 0.000024 129 V101T 0.146 103 0.000062 119 M34Q 0.147 97 0.000041 160 V101A 0.162 99 0.000064 121 M34H 0.105 97 0.000074 71 V101Q 0.109 100 0.000054 157 M34G 0.221 98 0.000076 148 V101R 0.142 103 0.000081 147 M34D 0.14 100 0.000035 141 V101G 0.316 99 0.00019 117 M34I 0.146 107 0.000038 142 V101P 0.222 61 na 118 M34L 0.163 107 0.000046 57 V101L 0.232 101 0.000068 117 M34R 0.118 113 0.000062 73 V101S 0.12 100 0.000081 126 M34W 0.124 104 0.000034 152 V101Y 0.123 105 0.000031 115 M34V 0.121 107 0.000045 131 V101C 0.102 100 0.000075 129 M34T 0.146 102 0.000047 84 V101W 0.16 100 0.000091 119 G35M na 2 na 110 V101K 0.117 112 0.000059 114 G35C na 4 0.00042 158 V101I 0.118 108 0.000055 135 G35A na 8 na 143 V102D na 2 na 113 G35Q na 3 na 136 V102M 0.099 100 0.000033 132 G35P na 1 na 154 V102C na ?3 na 139 G35T na 3 na 166 V102N na 6 na 2 G35H na 1 na 155 V102W na 8 na 129 G35V na 3 na 135 V102E na 5 na 118 G35L na 4 na 118 V102I 0.152 105 0.000051 139 G35S na 4 0.00016 141 V102A 0.257 114 0.000065 108 G35F na 3 na 143 V102T 0.166 95 0.00041 123 G35I na 4 na 148 V102Y na 6 na 76 G35W na 2 na 109 V102L 0.116 103 0.000058 112 G35D na 6 na 159 V102S 0.349 90 na 140 G35R na 10 na 158 V102P na 23 na 98 V36R 0.477 44 na 1 V102R na 2 na 111 V36Y 0.196 103 0.00016 148 V102F na 23 0.000054 133 V36F 0.169 101 0.00013 154 V102Q 5.01 55 na 147 V36A 0.215 107 0.000015 148 V102G na 5 na 127 V36P 0.134 101 0.00056 5 T103Y 0.171 98 0.00024 127 V36W 0.112 105 0.00011 149 T103M 0.153 100 0.00018 121 V36K 0.145 87 na 2 T103W 0.274 98 0.00027 213 V36N 0.143 83 0.000098 10 T103C 1.12 89 0.00048 69 V36M 0.126 109 0.000074 126 T103A 0.162 106 0.00017 121 V36L 0.138 99 0.000045 101 T103N 0.262 96 na 144 V36T 0.13 98 0.000033 147 T103F 0.181 100 0.00025 156 V36H 0.153 96 0.0001 22 T103L 0.33 90 0.00021 94 V36C 0.126 112 0.000065 101 T103V 0.14 100 0.00026 154 V36S 0.124 105 0.0000001 59 T103P 0.384 95 na 148 V36Q 0.1 102 0.000071 18 T103R 0.307 89 na 166 V36D 0.42 94 na 4 T103Q 0.223 98 0.00032 129 V36G 0.13 100 0.000078 77 T103S 0.111 101 0.00012 142 V36E 0.129 96 0.000067 7 T103G 0.62 88 na 133 S37F na 4 0.000084 125 G104N 0.187 89 0.0003 152 S37T 0.1 100 0.000035 162 G104R na 10 na 157 S37A 0.191 113 0.000035 146 G104A 0.156 88 na 133 S37P 0.153 101 0.00015 5 G104L na 5 na 150 S37R na 9 0.00019 96 G104E 0.335 86 na 127 S37H na 9 0.000072 140 G104P na 11 na 153 S37W na 3 0.000068 113 G104D 0.159 97 0.00021 142 S37D 0.18 102 na 135 G104V na 5 0.00014 138 S37G 0.182 95 0.0001 110 G104Q na 12 na 73 S37V 0.18 104 0.000072 149 G104S 0.268 96 0.00025 141 S37Q 0.802 83 na 124 G104K na 4 na 138 S37N 0.125 101 0.00019 166 G104C 7.32 49 0.000089 92 S37I 6.6 43 na 144 G104Y na 7 0.000076 136 S37E 0.133 100 0.00028 158 G104H na 18 na 148 S37M 1.43 80 na 91 G104F na 7 0.00006 150 S37L na 8 0.00021 135 G104T na 34 na 156 H52L 0.287 79 na 118 G105E 1.71 76 na 129 H52D 1.27 76 na 141 G105L na 6 0.00012 155 H52Q 0.101 104 0.00012 142 G105K na 22 na 146 H52W 0.113 100 0.00012 155 G105S 0.183 99 0.000029 143 H52Y 5.49 56 0.000096 162 G105D 2.2 67 na 126 H52I 0.229 76 na 154 G105C 1.18 83 0.00028 89 H52M 0.208 99 0.00021 151 Y106W 0.144 107 0.00016 124 H52T 0.168 101 0.00025 146 Y106T 0.184 83 na 141 H52K 0.922 89 na 96 Y106L 0.192 95 na 143 H52S 0.108 106 0.000058 129 Y106A 0.22 95 0.00017 160 H52G 0.279 108 0.00021 130 Y106G 3.74 59 na 124 H52V 0.275 99 na 130 Y106V 0.15 93 0.00031 146 H52N 0.164 103 0.00034 111 Y106D 0.439 81 na 135 H52R na 3 na 130 Y106M 0.089 100 0.0002 139 H52P na 3 na 72 Y106F 0.143 105 0.000064 127 H52A 0.202 103 0.00015 146 Y106C na 14 0.00014 125 H52F 0.15 100 0.00018 120 Y106K na 4 na 155 H52C 0.349 110 0.00024 122 Y106R na 9 na 133 I53W 0.155 109 0.00021 146 Y106S 0.154 90 0.00042 115 I53A 0.128 106 0.00016 144 Y106N 5.73 54 na 126 I53N 0.156 100 0.000043 142 Y107K 0.146 100 0.00026 146 I53E 0.161 100 0.00017 116 Y107T 0.149 97 0.00037 139 I53Y 0.245 85 na 130 Y107C 0.126 97 0.00014 133 I53L 0.154 98 0.00011 142 Y107F 0.102 101 0.000065 151 I53C 0.184 96 0.00015 103 Y107E 0.215 91 na 109 I53R 0.115 108 0.000085 136 Y107R 0.254 91 na 135 I53T 0.103 94 0.000084 123 Y107M 0.131 95 0.00033 131 I53F 0.349 94 na 150 Y107D 0.153 99 na 141 I53V 0.136 103 0.000053 129 Y107H 0.187 107 0.00009 145 I53D 0.313 98 0.00022 152 Y107N 0.213 92 0.00025 124 I53G 0.241 114 0.000082 164 Y107I 0.123 99 0.00013 125 I53M 0.167 116 0.00011 144 Y107W 0.119 100 0.000047 119 I53S 0.152 107 0.000093 131 Y107S 0.105 96 0.00028 98 F54H 2.92 64 na 154 Y107L 0.143 100 0.00011 144 F54G na 4 0.000066 137 Y107G 0.18 65 na 121 F54Y 0.128 99 0.00019 154 Y107Q 0.206 97 0.00034 129 F54R na 4 na 148 Y107V 0.17 99 0.00019 97 F54W 1.5 74 na 139 Y108C na 4 na 143 F54D na ?1 na 125 Y108V na 5 na 152 F54K na 4 na 119 Y108L na 5 na 121 F54L 7.55 30 0.00011 142 Y108M na 19 na 150 F54M 0.275 97 na 135 Y108F 0.137 102 0.00004 136 F54T na 6 0.00027 148 Y108N 5.5 57 na 138 F54P na 5 na 122 Y108W 0.118 95 0.0003 149 F54N na 1 na 138 Y108A 0.784 81 na 129 F54I na 2 na 142 Y108K na 5 na 109 F54S na 15 0.000039 133 Y108T na 17 0.00017 133 F54V na 5 na 155 Y108R na 3 na 131 F54C na 3 na 148 Y108P 0.206 91 na 120 S55I 0.115 103 0.00023 140 Y108S 2.8 66 0.0002 143 S55Y 0.381 92 na 103 Y108D 0.314 88 na 113 S55A 0.125 103 0.000061 144 D109Y 0.283 86 na 167 S55W 6.7 52 na 136 D109T 0.15 97 0.00023 175 S55L 0.18 102 0.00022 135 D109F 0.385 85 na 156 S55D 0.26 89 na 140 D109N 0.218 100 na 124 S55E 0.16 102 0.00024 141 D109P na 7 na 159 S55V 0.13 107 0.00011 137 D109W 0.654 83 na 150 S55G 0.201 96 na 124 D109L 0.214 89 na 167 S55C 0.211 94 0.00021 116 D109Q 0.2 95 na 135 S55N 0.262 102 0.00014 107 D109S 0.138 93 na 39 S55R 0.134 114 0.00012 154 D109V 0.21 85 0.00025 103 S55K 0.157 104 0.00013 113 D109G 3.37 61 na 135 S55H 0.133 91 na 75 D109I 0.136 91 0.00025 152 S55T 0.125 101 0.00014 73 D109M 0.183 87 na 146 S55F 0.24 101 na 117 D109R 1.82 68 na 163 N56L 0.126 106 0.0002 144 D109K 5.15 57 na 164 N56E 0.205 110 na 129 D109H 1.24 78 na 103 N56I 0.215 105 na 120 D109E 0.149 98 0.0002 57 N56R 0.15 105 na 152 G110H na 3 na 144 N56V 0.202 80 na 134 G110M na 1 na 132 N56P 0.726 83 na 127 G110N na 3 na 135 N56K 0.101 98 0.00024 86 G110W na 6 na 143 N56Y 0.146 100 0.000062 107 G110V na 4 na 131 N56S 0.137 109 0.0002 92 G110S 3.74 65 na 138 N56D 0.69 86 na 93 G110F na 3 na 148 N56G 0.21 94 0.00014 124 G110I na 4 na 124 N56A 0.127 100 0.00016 75 G110K na 4 na 128 N56H 0.126 102 0.000041 101 G110A 0.14 93 na 123 N56T 0.176 96 na 88 G110L na 5 na 135 D57I 0.153 108 0.00035 112 G110R na 5 na 134 D57S 0.109 103 0.000066 162 G110Y na 4 na 92 D57K 0.178 105 0.00011 103 G110P na ?2 na 142 D57Y 0.121 105 0.000051 148 G110T na 1 na 112 D57P 0.185 110 na 111 G110D na 4 na 107 D57T 0.153 106 0.00012 135 M111L 0.159 106 0.00008 120 D57M 0.11 109 0.000063 133 M111E 0.124 106 0.00012 125 D57L 0.133 100 0.00011 131 M111C 0.234 110 0.00013 133 D57C 0.134 101 0.000072 107 M111N 0.103 97 0.000039 121 D57N 0.096 101 0.000047 132 M111W 0.33 97 0.0003 117 D57G 0.138 98 0.000084 126 M111I 0.196 107 0.00012 135 D57A 0.135 109 0.000075 65 M111P na 4 0.0000001 112 D57R 0.13 105 0.00011 78 M111D 0.133 91 0.00011 123 D57W 0.126 104 0.000057 113 M111H 0.183 97 0.000042 142 D57F 0.101 102 0.000062 116 M111V 0.199 100 0.00019 135 D57V 0.114 100 0.00022 103 M111R na 4 na 79 E58S na 6 na 145 M111T 0.126 99 0.00007 110 E58I 0.254 82 na 149 M111G 0.362 97 0.00015 106 E58M 3.7 62 na 164 M111F 7.16 47 0.000068 150 E58P na 29 na 152 M111S 0.163 103 0.00012 120 E58N na 6 0.00014 153 M111A 0.188 103 0.000065 132 E58T na 4 0.000091 137 D112A 0.159 92 0.00031 130 E58V 0.451 76 na 152 D112I 0.316 107 0.00013 115 E58A 6.79 52 na 123 D112V 0.205 97 0.00021 110 E58F na 32 0.00025 117 D112Q 0.31 106 0.00019 144 E58R na 3 na 162 D112E 0.13 104 0.00017 120 E58C na 5 0.000074 132 D112Y 0.305 108 0.00015 82 E58Y 7.89 32 0.000077 167 D112S 0.124 105 0.00024 116 E58L 0.126 102 0.00031 145 D112H 0.174 102 0.00021 120 E58G na 9 0.000026 93 D112C 0.133 94 0.00025 38 E58W na 6 0.000034 102 D112M 0.275 95 0.00025 132 K59M 0.144 106 0.000075 118 D112K 0.419 91 na 133 K59F 0.139 112 0.000067 100 D112N 0.147 100 0.000061 133 K59C 0.107 105 0.000056 123 D112L 0.225 92 0.00015 119 K59N 0.114 99 0.000048 113 D112R 0.427 100 na 127 K59G 0.159 98 na 117 D112G 0.344 103 0.00035 117 K59W 0.135 109 0.00019 51 D112F 0.946 92 0.0003 127 K59T 0.13 105 0.00004 129 D112W 0.336 101 0.000064 130 K59Q 0.23 109 0.000045 115 D112T 0.19 101 0.00013 140 K59E 0.141 102 0.00012 135 V113P 0.146 101 0.000031 116 K59S 0.139 106 0. 000099 93 V113G 0.169 108 0.000036 119 K59A 0.081 99 0.000098 129 V113W 0.097 105 0.000039 117 K59R 0.142 108 0.000012 96 V113Q 0.1 100 0.000025 127 K59L 0.116 100 0.000037 126 V113R 0.169 114 0.000039 141 K59I 0.158 103 0.000056 136 V113Y na 0 na 0 K59V 0.119 95 0.000063 123 V113F 0.106 106 0.000024 126 S60W na 4 na 132 V113C 0.144 105 0.000048 128 S60L na 5 0.000076 87 V113E 0.112 96 0.000054 123 S60N 0.235 89 0.00029 88 V113M 0.13 109 0.00003 121 S60Y na 3 na 117 V113S 0.135 111 0.000025 136 S60T 0.178 99 0.0003 125 V113I 0.161 100 0.000023 121 S60F na 5 0.00016 113 V113H 0.1 104 0.000052 114 S60G 0.196 99 0.000043 122 V113L 0.143 116 0.000039 104 S60C Na 36 0.000093 104 V113N 0.117 103 0.000046 117 S60H na 16 0.00019 94 V113K 0.182 110 0.000052 129 S60D 0.16 105 0.00021 127 V113T 0.163 107 0.000059 104 S60A 0.177 95 0.00032 117 na: not available

(406) The results show that amino acid residues at many positions of 16H7 could be substituted with other amino acid residues without having an impact on the activity 16H7. Thus, the EC50 value, the Emax value and koff value of antibodies with substitutions at these positions were within two standard deviations of the mean values for 16H7. However, substitution of certain amino acids at certain positions, in particular of G35, F54, E58, S60, G104 and Y108 in the heavy chain and D95 in the light chain of 16H7 resulted in antibodies which had modulated activity as compared to 16H7.

Example 4: Analysis of 16H7 Variants with Multiple Mutations in the Light and Heavy Chain

(407) In addition to the 16H7 variants with single mutations, variants with multiple mutations were generated. The generated variants with multiple mutations are shown in Table A1. Predominantly, variants with multiple substitutions of critical amino acids within the CDRs in the light chain and heavy chain identified in Example 2 were analyzed (see Table C above). However, further amino acids were mutated, such as D95. In addition, many tested variants had an 183T substitution in the heavy chain. Further information on tested mutations in the light chain and the heavy chain of 16H7 can be found in Table A1 above, see columns LC Variant and HC Variant, respectively.

(408) Cellular activity of monoclonal antibodies was analyzed with a Luciferase gene reporter assay assessing FGF21-like signaling. Thereby, EC50 values and Emax values were determined (mean?SEM, n=3-7). Binding of the antibodies to human KLB was assessed via SPR. Thereby, rate constants for dissociation (koff) and affinities (KD) were determined (mean?SEM, n=3).

(409) As controls, 16H7 (Ab0004) and human FGF21 (huFGF21, SEQ ID NO: 58) were used. The results are shown in FIG. 5 and in Table E. In Table E, the antibody number of the antibodies which have an EC50 value of 0.20 or lower is highlighted in bold (with the exception of Ab0001 to Ab0007 which comprise the heavy and light chain variable domains of 16H7).

(410) TABLE-US-00026 TABLE E Analysis of 16H7 variants with multiple mutations HEK293 HEK293 hFGFR1c + HEK293 koff hFGFR1c + HEK293 koff KLB (iLite) hFGFR1c + human KLB (iLite) hFGFR1C + human EC50 KLB (iLite) KLB EC50 KLB (iLite) KLB AB No (nmol/L) Emax (%). (1/sec) AB-No (nmol/L) Emax (%). (1/sec) huFGF21 0.35 4000.08 na Ab0375 >100 na no binding Ab0001 0.05 2557.87 0.0000596 Ab0376 >100 na no binding Ab0002 0.06 2624.22 0.0000562 Ab0377 >100 na no binding Ab0003 0.04 2532.69 0.0000536 Ab0378 >100 na no binding Ab0004 0.08 1854.36 0.0000339 Ab0379 >100 170.88 no binding Ab0006 0.06 2546.99 0.0000724 Ab0380 >100 na no binding Ab0007 0.09 2500.32 0.0000617 Ab0381 >100 na no binding Ab0179 0.05 2185.75 0.0000586 Ab0382 >100 na no binding Ab0187 0.04 2782.42 0.0001560 Ab0383 >100 na no binding Ab0188 0.06 2412.44 0.0008400 Ab0386 >100 na no binding Ab0189 0.06 2761.63 0.0003870 Ab0389 >100 na no binding Ab0190 0.05 2370.37 0.0001950 Ab0390 >100 na no binding Ab0191 0.04 2472.87 0.0001440 Ab0391 >100 na no binding Ab0192 3.67 1613.15 invalid fit Ab0392 >100 na no binding Ab0194 0.06 2550.38 0.0004020 Ab0393 >100 na no binding Ab0195 0.14 2032.04 0.0026700 Ab0394 >100 na no binding Ab0196 0.12 2054.53 0.0019400 Ab0395 >100 na no binding Ab0197 0.08 1997.15 0.0016700 Ab0396 >100 na no binding Ab0198 0.05 2766.68 0.0003460 Ab0397 >100 na no binding Ab0199 >100 735.90 invalid fit Ab0398 >100 na no binding Ab0201 0.05 2487.26 0.000336 Ab0399 >100 na no binding Ab0202 0.07 1514.25 0.0016100 Ab0400 >100 na no binding Ab0203 0.05 1600.17 0.0015100 Ab0401 >100 na no binding Ab0204 0.04 1417.70 0.0013300 Ab0402 >100 na no binding Ab0205 0.02 2122.68 0.0003340 Ab0403 >100 na no binding Ab0206 0.69 2640.32 na Ab0404 >100 na no binding Ab0208 0.27 1274.73 0.0021000 Ab0405 >100 na no binding Ab0209 15.30 1964.50 invalid fit Ab0406 >100 na no binding Ab0210 5.31 2390.76 invalid fit Ab0407 >100 na no binding Ab0211 12.04 1599.03 invalid fit Ab0408 >100 na no binding Ab0212 0.07 1638.95 0.0018500 Ab0409 >100 na no binding Ab0213 >100 122.40 invalid fit Ab0410 >100 na no binding Ab0215 0.04 2003.02 0.0012500 Ab0411 >100 na no binding Ab0216 0.27 1176.33 0.0098400 Ab0415 0.30 673.88 na Ab0217 0.07 1972.05 0.0020000 Ab0416 0.05 862.64 0.0010700 Ab0218 2.13 1056.41 0.0066800 Ab0417 0.06 1110.27 0.0003027 Ab0219 0.02 2494.34 0.0009150 Ab0326 0.07 1007.80 0.0017500 Ab0220 22.20 1185.08 invalid fit Ab0327 0.05 995.29 0.0003459 Ab0180 0.05 2714.81 0.0002400 Ab0328 4.11 420.72 invalid fit Ab0181 0.03 2113.57 0.0012100 Ab0329 4.59 443.02 invalid fit Ab0182 0.02 2287.94 0.0005770 Ab0330 0.15 931.80 invalid fit Ab0183 0.03 2537.76 0.0001850 Ab0331 0.04 1086.11 0.0004167 Ab0184 0.05 2643.37 0.0001800 Ab0332 0.05 994.85 0.0014300 Ab0185 0.06 2350.90 na Ab0333 0.20 769.49 0.0002507 Ab0186 0.06 2570.28 0.0001040 Ab0334 1.02 717.86 invalid fit Ab0193 0.03 2474.84 0.0003370 Ab0335 0.04 1219.31 0.0002998 Ab0200 0.03 2615.63 0.000369 Ab0336 2.91 575.87 invalid fit Ab0207 0.07 1175.65 0.0018800 Ab0337 0.06 1027.88 0.0005296 Ab0214 0.05 2258.30 0.0012100 Ab0338 0.06 970.91 0.0004292 Ab0221 0.09 1995.71 0.0001100 Ab0339 2.16 544.82 invalid fit Ab0222 0.13 2023.85 0.0003090 Ab0340 0.05 912.10 0.0017600 Ab0223 0.06 2050.90 0.0002400 Ab0341 1.40 528.45 invalid fit Ab0224 0.05 2257.45 0.0002010 Ab0342 0.34 774.99 invalid fit Ab0225 0.09 1792.35 0.0010400 Ab0343 1.37 482.23 invalid fit Ab0226 0.11 1968.82 0.0010100 Ab0344 0.07 958.00 0.0016800 Ab0227 0.06 2343.07 0.0002140 Ab0345 0.07 907.98 0.0018800 Ab0228 0.04 1379.18 0.0002580 Ab0346 2.25 531.66 invalid fit Ab0229 0.04 1445.00 0.0003940 Ab0347 0.24 694.89 invalid fit Ab0230 0.06 1612.85 0.0001110 Ab0348 0.53 640.85 invalid fit Ab0231 0.06 1824.39 0.0001250 Ab0349 10.74 511.30 invalid fit Ab0232 0.04 1768.14 0.0000563 Ab0350 1.46 493.40 invalid fit Ab0233 0.06 1759.00 0.0000809 Ab0351 0.03 1037.85 0.0005710 Ab0234 0.04 1841.78 0.0001100 Ab0352 0.07 1005.74 0.0004194 Ab0235 0.06 2085.28 0.0001530 Ab0353 0.08 895.23 0.0003799 Ab0236 0.05 2193.69 0.0001510 Ab0354 0.07 878.23 0.0015800 Ab0237 >100 666.99 invalid fit Ab0355 0.07 829.07 0.0019500 Ab0238 15.22 855.90 invalid fit Ab0356 5.35 619.56 invalid fit Ab0313 0.04 1131.82 na Ab0357 0.08 893.24 0.0018500 Ab0312 0.07 1006.28 0.0005302 Ab0358 0.07 858.12 0.0004541 Ab0295 0.07 1312.82 0.0015700 Ab0359 2.53 550.50 invalid fit Ab0296 0.06 1293.89 0.0013700 Ab0360 0.08 844.74 0.0019200 Ab0297 0.07 1213.94 0.0015600 Ab0361 0.07 985.98 0.0016300 Ab0298 0.08 1184.67 0.0016000 Ab0362 11.59 661.51 invalid fit Ab0299 0.10 1243.35 na Ab0363 0.48 736.38 invalid fit Ab0300 2.63 605.47 invalid fit Ab0364 0.11 990.76 0.0016900 Ab0301 21.54 696.75 invalid fit Ab0365 0.85 583.24 invalid fit Ab0302 3.94 794.51 invalid fit Ab0428 0.03 1275.44 0.0004580 Ab0303 19.23 809.46 invalid fit Ab0429 0.04 1288.67 0.0003820 Ab0304 11.42 686.36 invalid fit Ab0430 0.03 1099.02 0.0006300 Ab0305 208.39 646.98 invalid fit Ab0423 0.05 1514.40 na Ab0306 0.05 1327.06 0.0002880 Ab0424 0.07 1392.24 na Ab0307 0.06 1153.50 0.0011800 Ab0431 0.05 1446.86 na Ab0308 0.06 1066.17 0.0013000 Ab0453 0.03 1399.14 na Ab0309 0.04 1209.35 0.0010300 Ab0454 0.03 1390.22 na Ab0310 0.05 1084.32 0.0011600 Ab0455 0.07 1019.36 na Ab0311 0.05 1083.66 0.0013000 Ab0456 0.07 1077.83 na Ab0314 0.05 1113.20 0.0004020 Ab0457 0.02 1521.70 na Ab0315 0.37 806.39 invalid fit Ab0458 0.02 1432.27 na Ab0316 0.45 730.24 invalid fit Ab0459 0.04 1110.76 na Ab0317 0.17 968.48 invalid fit Ab0460 0.05 1053.95 na Ab0318 0.30 817.40 invalid fit Ab0461 0.02 1388.66 na Ab0319 0.30 698.29 invalid fit Ab0462 0.03 1336.88 na Ab0320 1.29 698.91 invalid fit Ab0463 0.05 950.78 na Ab0366 0.03 821.35 0.0018700 Ab0464 0.02 909.99 na Ab0367 >100 na no binding Ab0420 0.58 2296.53 0.0000378 Ab0368 0.05 822.30 0.0020700 Ab0421 >100 na 0.0000541 Ab0369 >100 na no binding Ab0286 79.08 489.01 0.000611 Ab0370 >100 490.05 na Ab0287 0.56 638.10 0.000136 Ab0371 >100 na no binding Ab0288 1.00 894.80 0.000116 Ab0372 >100 na no binding Ab0425 0.22 1204.83 na Ab0373 >100 na no binding Ab0426 0.16 1352.61 0.0000004 Ab0374 >100 na no binding Ab0427 0.16 1250.40 0.0000639 na: not available

(411) When compared to 16H7, three multiple mutant variants turned out to have comparable cellular activity in the Luciferase gene reporter assay and at the same time comparable affinity to human KLB and were chosen for further characterization in chemical stability experiments: Ab0331, Ab0335, Ab0351, all having an IgG4PE Fc backbone, In addition to these, the 16H7 variants Ab0428, Ab0429, Ab0430 were included in the subsequent chemical stability experiments in order to evaluate the IgG1-NNAS Fc backbone variants of the aforementioned antibodies.

Example 5: Chemical Stability of Selected 16H7 Variants

(412) In this Example, an in-depth characterization of the stabilized 16H7 variants Ab0331, Ab0335, Ab0351, Ab0428, Ab0429, and Ab0430 was carried out. The mAbs were stressed at 40? C. and different pH values for 21 days. Physicochemical properties of the stressed mAbs and corresponding untreated controls (d0) were analyzed extensively as outlined in the method descriptions. Three different pH values were tested, the results are shown in Table F1 (pH 5), Table F2 (pH 6), Table F3 (pH8) as well as in FIG. 6.

(413) TABLE-US-00027 TABLE F1 Stability at pH 5 after 21 days Chemical Stability at pH 5 Ab0331 Ab0335 Ab0351 Ab0428 Ab0429 Ab0430 Method Result d 0 d 21 d 0 d 21 d 0 d 21 d 0 d 21 d 0 d 21 d 0 d 21 SEC % HMW 1 1 1 0 2 1 2 1 2 1 1 1 % LMW 0 0 0 0 0 0 0 2 0 2 0 2 DLS Hydrodynamic 5.5 5.3 5.3 5.2 5.4 5.6 5.4 5.5 5.4 5.4 5.4 5.4 radius (nm) Polydispersity index 8.2 0 1.5 0.2 3.2 12 1.7 4.2 1.7 0.6 3.3 0.3 (%) intact Identity confirmed Yes Yes Yes Yes Yes Yes mass Peak intensity post 84 84 90 84 95 80 stress (%) HIC % Main peak 100 100 100 100 100 100 100 100 100 100 100 100 Number of peaks 1 1 1 1 1 1 1 1 1 1 1 1 cIEF % Main peak 73 59 70 59 72 59 21 15 21 20 22 21 Number of peaks 5 5 5 4 4 5 8 8 8 9 9 8 DSF Tonset (? C.) 54 44 51 45 50 45 50 51 51 51 45 46 Tm (? C.) 61 61 61 62 61 61 59 59 58 60 62 62 SPR rel. active fraction 97 93 95 94 94 94 (%) AA Stress-induced liabilities PTM detected Abbreviations: SEC = size-exclusion chromatography, cGE = capillary gel electrophoresis, HIC = hydrophobic interaction chromatography, cIEF = capillary isoelectric focusing, DSF = differential scanning fluorimetry, SPR = surface plasmon resonance, DLS = dynamic light scattering, HMW= high molecular weight, LMW = low molecular weight, Tm = melting temperature, PTM = post-translational modification, mm = multimodal

(414) TABLE-US-00028 TABLE F2 Stability at pH 6 after 21 days Chemical Stability at pH 6 Ab0331 Ab0335 Ab0351 Ab0428 Ab0429 Ab0430 d 0 d 21 d 0 d 21 d 0 d 21 d 0 d 21 d 0 d 21 d 0 d 21 SEC % HMW 1 0 1 0 0 1 1 0 0 0 1 0 % LMW 0 0 0 0 0 0 0 2 0 1 0 2 DLS Hydrodynamic 5 5.2 5.2 5.1 5.2 5.2 5.4 5.3 5.4 5.5 5.4 5.4 radius (nm) Polydispersity index 2.1 12 0 0.3 1.2 5.1 1.4 1.1 4.3 8.5 0.5 0.1 (%) intact Identity confirmed Yes Yes Yes Yes Yes Yes mass Peak intensity post 97 85 96 87 83 81 stress (%) HIC % Main peak 100 100 100 100 100 100 100 100 100 100 100 100 Number of peaks 1 1 1 1 1 1 1 1 1 1 1 1 cIEF % Main peak 73 57 71 59 73 58 20 21 21 23 22 20 Number of peaks 5 4 4 4 4 4 8 8 9 8 8 9 DSF Tonset (? C.) 53 50 52 50 53 52 48 47 50 48 45 46 Tm (? C.) 63 62 63 62 62 62 62 62 62 62 62 62 SPR rel. active fraction 91 92 92 93 92 92 (%) AA Stress-induced liabilities PTM detected Abbreviations: see Table F1

(415) TABLE-US-00029 TABLE F3 Stability at pH 8 after 21 days Chemical Stability at pH 8 Ab0331 Ab0335 Ab0351 Ab0428 Ab0429 Ab0430 d 0 d 21 d 0 d 21 d 0 d 21 d 0 d 21 d 0 d 21 d 0 d 21 SEC % HMW 2 1 2 5 1 2 1 1 2 1 2 1 % LMW 0 1 0 1 0 1 0 3 0 3 0 4 DLS Hydrodynamic 5.6 5.9 5.3 6.1 5.6 8.1 5.4 6.1 5.3 6.3 5.4 6.3 radius (nm) Polydispersity index 13 40 10 mm 20 mm 0.3 42 0 mm 3.6 57 (%) intact Identity confirmed Yes Yes Yes Yes Yes Yes mass Peak intensity post 75 53 77 56 68 54 stress (%) HIC % Main peak 100 100 100 100 100 100 100 100 100 100 100 100 Number of peaks 1 1 1 1 1 1 1 1 1 1 1 1 cIEF % Main peak 72 14 68 12 71 15 21 11 21 9.7 22 4.4 Number of peaks 5 6 5 5 4 5 9 9 8 10 9 11 DSF Tonset (? C.) 58 57 57 57 58 57 54 56 53 55 56 56 Tm (? C.) 68 67 68 68 66 66 68 67 63 69 66 66 SPR rel. active fraction 78 73 75 79 77 75 (%) AA Stress-induced Yes Yes Yes Yes Yes Yes liabilities PTM detected Abbreviations: see Table F1

Example 6: Binding Analysis of 16H7 and Selected Variants to Human and Monkey Beta-Klotho

(416) In this Example, the binding of 16H7 and selected variants to human and monkey beta-klotho was analyzed. For interaction analysis with human beta-klotho, mAbs were captured via an anti-human Fc antibody immobilized on a series S CM5 sensor chip (human antibody capture kit, GE Healthcare). Human KLB (R&D Systems), diluted into HBS-EP+ buffer with 10% non-specific binding reducer (GE Healthcare), was injected in a 1:2 dilution series from 0.78 nmol/L to 12.5 nmol/L at a flow rate of 60 ?L/min. Binding kinetics data were evaluated with a 1:1 binding model using the Biacore 8K Evaluation Software version 1.1.1.7442 (GE Healthcare). For interaction analysis with Cynomolgus monkey beta-klotho, mAbs were captured via an anti-human Fc antibody immobilized on a series S CM5 sensor chip (human antibody capture kit, GE Healthcare). Cynomolgus monkey KLB (R&D Systems), diluted into HBS-EP+ buffer with 10% non-specific binding reducer (GE Healthcare), was injected in a 1:2 dilution series from 0.78 nmol/L to 12.5 nmol/L at a flow rate of 60 ?L/min. Binding kinetics data were evaluated with a 1:1 binding model using the Biacore 8K Evaluation Software version 1.1.1.7442 (GE Healthcare). Exemplary sensorgrams for the interaction are shown in FIG. 7 (human KLB) and 8 (monkey KLB), as well as in Table G.

(417) TABLE-US-00030 TABLE G Binding affinities of stabilized 16H7 variants to human and monkey KLB determined by SPR. k.sub.on k.sub.off K.sub.D k.sub.on k.sub.off K.sub.D human human human monkey monkey monkey KLB KLB KLB KLB KLB KLB Antibody (1/s) (1/s) (nmol/L) (1/s) (1/s) (nmol/L) 16H7 (Ab0004) 1.28E+06 3.39E?05 0.026 6.90E+05 2.95E?04 0.428 Ab0331 2.17E+06 4.45E?04 0.206 8.69E+05 3.03E?03 3.490 Ab0335 2.20E+06 3.47E?04 0.158 4.94E+05 1.46E?03 2.950 Ab0351 2.30E+06 5.71E?04 0.248 9.59E+05 3.78E?03 3.940 Ab0428 2.24E+06 4.58E?04 0.205 9.93E+05 2.52E?03 2.540 Ab0429 2.06E+06 3.82E?04 0.186 9.73E+05 2.14E?03 2.200 Ab0430 2.20E+06 6.30E?04 0.286 1.09E+06 3.23E?03 2.960

Example 7: Analysis of Cellular Activity of 16H7 and Optimized Variants in Primary Human Visceral and Subcutaneous Adipocytes

(418) Cellular activity of 16H7 and optimized variants in primary human visceral and subcutaneous adipocytes was analyzed via In-Cell Western PERK as described in the Materials and Methods section. Specifically, dose-response curves of ERK phosphorylation after a 5 minutes stimulation with FGF21, 16H7, or variants were established in primary human visceral adipocytes and subcutaneous adipocytes. Furthermore, the EC50 values were calculated. The results are shown in Table H and in FIG. 9.

(419) TABLE-US-00031 TABLE H Cellular activity of stabilized 16H7 variants on primary human visceral and subcutaneous adipocytes was analyzed via In-Cell Western pERK as outlined in the Method section. Compound Mean ? SEM (nmol/L) N FGF21 0.206 ? 0.039 7 16H7 0.112 ? 0.028 7 Ab0331 0.101 ? 0.028 7 Ab0335 0.142 ? 0.043 6 Ab0351 0.156 ? 0.072 7 Ab0428 0.072 ? 0.024 7 Ab0429 0.078 ? 0.017 7 Ab0430 0.116 ? 0.028 7 Shown are derived mean EC50 values ? SEM (N = Number of experiments).

Example 8: Analysis of Cellular Activity of 16H7 with Various Fc Backbones

(420) In the Example, the cellular activity of 16H7 with various Fc backbones was assessed via Luciferase gene reporter assay (Ab0001 to Ab0004, Ab0006 and Ab0007, see Table A1). Specifically, the EC50 values were determined. In addition to the IgG2 backbone which is present in 16H7, five Fc backbones were tested. Information on the tested backbones can be found in Tables A1 and A2 above. The results are shown in Table E and in FIG. 10. The IgG2 backbone was associated with the lowest cellular activity.

Example 9: Fab Structure Determination

(421) In addition to the Fab structure of 16H7 (see Example 2 or FIG. 3), the Fab structures of Ab0331, Ab0335, Ab0442 and Ab0443 were determined after crystallization. The Fab structures of Ab0331, Ab0335, Ab0442 and Ab0443 revealed only minor differences between the chemically stabilized antibodies and 16H7 (not shown).

Example 10: Analysis of Cellular Activity of Fab Fragment of 16H7

(422) The monoclonal antibody 16H7, its monovalent Fab fragment and human FGF21 were assessed via Luciferase gene reporter assay. The results are shown in FIG. 11. Monovalent 16H7-Fab is inactive. However, the bivalent antibody shows FGF21-like activity.

Example 11: In-Depth Characterization of the Stabilized 16H7 Variants

(423) In this Example, an in-depth characterization of the stabilized 16H7 variants Ab0331, Ab0335, Ab0351, Ab0428, Ab0429, and Ab0430 was carried out. Antibodies were expressed either in transiently transfected HEK293 or CHO cells and purified via protein A affinity chromatography. Physicochemical properties and biological activity were analyzed extensively as outlined in the method descriptions. The results are shown in Table I.

(424) TABLE-US-00032 TABLE I In-depth characterization of the stabilized 16H7 variants IgG4-PE IgG1-NNAS Attribute Method Result Ab0331 Ab0335 Ab0351 Ab0428 Ab0429 Ab0430 Physicochemical Characterization Homogeneity SEC % Monomer 100 100 100 100 100 100 cGE % Monomer 77 79 83 71 66 62 DLS Hydrodynamic 5.3 5.2 5.3 5.4 5.3 5.4 radius (nm) Polydispersity index 2.1 0 1.2 1.4 4.3 0.5 (%) Identity, correct intact Identity confirmed Yes Yes Yes Yes Yes Yes pairing mass Hydrophobic HIC % Main peak 100 100 100 100 100 100 variance Number of peaks 1 1 1 1 1 1 Charge cIEF % main peak 73 71.4 72.6 20.4 21.3 21.7 homogeneity Number of peaks 5 4 4 8 9 8 pI 6.9 7.1 6.7 7.3-8.0 7.5-8.5 7.2-7.9 Thermal DSF Tonset (? C.) 53 52 53 48 50 45 stability Tm (? C.) 63 63 62 62 62 62 Biological Activity Affinity SPR KD (nM) 0.21 0.16 0.25 0.21 0.19 0.29 Deviceability Colloidal kD DLS kD (mL/g) ?22 ?23 ?29 ?2 ?11 ?7 stability pH 6

Example 12: In Vivo Studies

(425) a) In Vivo PK Studies in Mice

(426) In vivo PK studies were conducted in transgenic humanized FcRn mice (Tg32). For these studies, no GLP compliance was claimed. Naive transgenic humanized FcRn mice (Tg32) received a 0.3 mg/kg single intravenous administration of Ab0314, Ab0331, Ab0335, Ab0351, Ab0428, Ab0429, Ab0430 and 16H7. The results of the pharmacokinetic analysis are shown in Table J and FIG. 12.

(427) TABLE-US-00033 TABLE J Pharmacokinetic characteristics of 16H7 and stabilized 16H7 variants in transgenic mice expressing the human neonatal Fc receptor (FcRn). The mAbs were single dosed intravenously at 0.3 mg/kg and in vivo half-lives in plasma were analyzed. The half-lives were determined using noncompartmental analysis (NCA) except for Ab0335 where the half-life was calculated via a compartment model. Antibody Animal Dose Route t? (h) 16H7 transgenic humanized FcRn 0.3 mg/kg IV 313 mice (Tg32) Ab0314 transgenic humanized FcRn 0.3 mg/kg IV 433 mice (Tg32) Ab0331 transgenic humanized FcRn 0.3 mg/kg IV 358 mice (Tg32) Ab0335 transgenic humanized FcRn 0.3 mg/kg IV 300* mice (Tg32) Ab0351 transgenic humanized FcRn 0.3 mg/kg IV 341 mice (Tg32) Ab0428 transgenic humanized FcRn 0.3 mg/kg IV 331 mice (Tg32) Ab0429 transgenic humanized FcRn 0.3 mg/kg IV 333 mice (Tg32) Ab0430 transgenic humanized FcRn 0.3 mg/kg IV 377 mice (Tg32) Abbreviations: IV = intravenously, *= t? calculated with compartment model

(428) b) In Vivo PK Studies in Cynomolgus Monkeys

(429) Naive cynomolgus monkeys received a single intravenous dose of mAb according to the following table:

(430) TABLE-US-00034 Antibody Dose level 16H7 0.1 mg/kg, 0.3 mg/kg and 1 mg/kg Ab0331 3 mg/kg Ab0335 3 mg/kg Ab0429 3 mg/kg

(431) In all investigations, the animals were evaluated twice daily for post-dose mortality/moribundity and cage side clinical observations were carried out after each study blood collection time. Studies were Non-GLP, nevertheless, these studies have been conducted in a GLP compliant facility using practices detailed in Standard Operating Procedures consistent with the principles of GLP (Test facility: Sanofi and Charles River Laboratories). Plasma concentrations and pharmacokinetic parameters of the tested antibodies were investigated after single intravenous administration.

(432) The results are shown in Table K and FIGS. 13 and 14. FIG. 13 shows the results of the PK analysis of 16H7 at different dose levels in Cynomolgus monkeys. FIG. 14 shows the results of PK analysis of 16H7 variants Ab0331, Ab0335 and Ab0429 in Cynomolgus monkeys.

(433) TABLE-US-00035 TABLE K Pharmacokinetic characteristics of 16H7 and stabilized 16H7 variants in non-human primates. The mAbs were single dosed intravenously in Cynomolgus monkey at 0.1, 0.3, 1.0, or 3.0 mg/kg and in vivo half-lives in plasma were analyzed. Antibody Animal Dose Route t? (h) 16H7 Macaca fascicularis 0.1 mg/kg IV 145 16H7 Macaca fascicularis 0.3 mg/kg IV 151 16H7 Macaca fascicularis 1.0 mg/kg IV 269 Ab0331 Macaca fascicularis 3.0 mg/kg IV 259 Ab0335 Macaca fascicularis 3.0 mg/kg IV 306 Ab0429 Macaca fascicularis 3.0 mg/kg IV 183 Abbreviations: IV = intravenously

(434) c) In Vivo Data/NHP (Non-Human Primate) Study

(435) 16H7 (SAR16) and the chemically stabilized Ab0335 (SAR18) were tested in obese cynomolgus monkeys to analyze the alteration in body weight. Other parameters were also measured during the study, including food intake, body fat, plasma ketone bodies, as well as, on blood glucose control (glucose profile, fed, fasting plasma glucose and during ivGTT). One group received the vehicle. The compounds were administered subcutaneously (SC) (12 weeks evaluation phase plus run-out) to obese male cynomolgus macaques (Macaca fascicularis).

(436) The SAR16-treated monkeys were dosed 3 times on day+1, day+19, and day+37 at 1 mg/kg. The SAR18-treated monkeys were dosed in a low-dose group 3 times at 1 mg/kg on day+1, day+19, and day+37 and in a high-dose group 3 times at 3 mg/kg on day+1, day+19, and day+37.

(437) The results are shown in FIGS. 15 to 19.

(438) No abnormal clinical signs were observed in the vehicle treated group. Reduction of food intake was observed in the SAR16- and SAR18-treated groups, especially on lunch (apple) and to a lesser impact on dinner (HFD). Total energy intake (TEI) was reduced by all treatments except for the vehicle group. Body weights were stable in the vehicle treated group. Significant reductions in body weight were recorded for the SAR16, SAR18 low- and high-dose treated groups. While vehicle treated monkeys maintained body weight at 98.3?1.6% of value prior start of treatment, SAR16 treated monkeys decreased to 86.5?1.6%, SAR18 low to 94.5?1.8% and SAR18 high to 89.9?1.7% compared to baseline values.

(439) Plasma profile showed that triglyceride (TG) levels were slightly increased over the study period in the vehicle treated group. TG values were quite robustly reduced in the SAR16 and SAR18 to the same degree and over the whole study period.

(440) d) Further In Vivo Data/NHP (Non-Human Primate) Study

(441) 16H7 and the chemically stabilized Ab0335 were further tested in obese cynomolgus monkeys. Specifically, plasma concentrations and pharmacokinetic parameters were analyzed during a treatment of three subsequent subcutaneous administrations of 1 and 3 mg/kg in solution to male obese Cynomolgus monkeys. The exposure to both tested antibodies after subcutaneous doses of 1 mg/kg IV were similar. Moreover, plasma concentrations of both compounds were detected up to the end of sampling (i.e. 336 and 504 hours after the 2.sup.nd and the 3.sup.rd dose, respectively). Thus, the experiments further show that Ab0335 retained the favorable activity and specificity of 16H7.

(442) Summary of Examples 1 to 12: In Examples 1 to 12, antibodies were generated which have an improved stability as compared to 16H7 and which retained the favorable activity and specificity of 16H7. Thus, stable agonistic antibodies were developed which target the FGFR1c/KLB receptor complex.

Example 13: Assessment of 16H7 as a Standalone Treatment and in Combination with a GLP-1 Receptor Agonist in DIO Non-Human Primates

(443) The effects of SAR16 (16H7, Ab0004, FGFR1 mAb) and SAR10 (dulaglutide, GLP-1R agonist) were studied with highest priority to analyze the liver fat fraction change concomitant with alteration in body weight. Other parameters were also measured during the study, including food intake, body fat, plasma ketone bodies, as well as blood glucose control (glucose profile, fed, fasting plasma glucose and during ivGTT). One group received the vehicle. The compounds were administered subcutaneously (SC) (12 weeks evaluation phase plus run-out) to obese and NASH male cynomolgus macaques (Macaca fascicularis).

(444) The SAR10-treated monkeys were dosed every 3rd day at 60 ?g/kg initiated by dose ramping (3 dose steps, week 1: 20 ?g/kg, week 2: 40 ?g/kg, week 3 to runout: 60 ?g/kg). The SAR16-treated monkeys were dosed at 1 mg/kg on day+1, 3 mg/kg on day+16, and then repeat maintenance dose of 3 mg/kg on day+46. The Combo-treated monkey were dosed with both SAR10 and SAR16 at the same pattern of the SAR10 and SAR16 treated monkeys.

(445) No abnormal clinical signs were observed in the vehicle treated group. Reduction of food intake was observed in the SAR10, SAR16, and combo-treated groups. Body weights were stable in the vehicle treated group. Significant reductions in body weight were recorded for the SAR10, SAR16, and combo-treated groups. In addition, body weight reductions were based predominantly on reduced body fat mass in all animals as measured by DEXA technique.

(446) The MRI measurement data showed that the baseline (day ?46 to ?43) liver fat fraction values were comparable in all groups. Liver fat fraction was stable for the vehicle treated group during the study (+4.8%). Significant reduction of liver fat fraction was observed in the SAR10 (?25.2%), SAR16 (?30.0%), and combo (?49.6%) treated groups, measured on days+81/+82/+83/+84 compared to vehicle treated group.

(447) NASH analysis showed that more monkeys showed improved steatosis score in the SAR10, SAR16, and combo-treated groups compared to vehicle treated group. No obvious change was observed for NASH ballooning, inflammation and fibrosis in all groups.

(448) No significant change of the fasting glucose, as well as fed glucose levels (at 12:30 and 18:30 clock-time) were observed in the SAR10, SAR16, and combo-treated groups compared to the vehicle treated group.

(449) Plasma profile for glucose and insulin were also measured on day-27 (baseline) and on day+76. Blood glucose was quite stable in the vehicle treated group on the 2 study days, demonstrating an increase during the day due to the feeding procedures. For the SAR10, SAR16 and combo treated groups, appreciable decreases in the blood glucose levels were recorded on day+76 compared to baseline levels (day?27). Insulin was increased on day+76 compared to baseline levels (day?27) in the vehicle treated group. Insulin decreased on day+76 compared to baseline levels (day?27) in the SAR10, SAR16 and combo treated groups.

(450) Plasma profile showed that the overall baseline T-ketones were physiologically low (<100 ?mol/L) in all groups. T-ketones levels were quite stable in the vehicle and SAR10 groups during the 2 study days. For the SAR16 and combination treated groups, T-ketones levels were comparable on day-27 (baseline). However, increased T-ketones levels were observed on day+76 in the SAR16 group, and significantly higher levels were recorded on day+76 in the combo treated group. The HO-butyrate showed the same pattern of changes as T-ketones during the profile days for all study groups.

(451) Plasma profile for TC, LDL, HDL and TG were also measured on day-27 (baseline) and on day+76. The baseline TC, LDL, and HDL levels were comparable in all groups. TC and LDL levels were quite stable in the vehicle and SAR16 groups on the 2 study days. For the SAR10 and combo treated groups, TC and LDL levels were decreased on day+76. HDL levels were quite stable in the vehicle treated group on all 2 study days. For the SAR10, SAR16 and combo treated groups, HDL levels were slightly increased on day+76. TG levels were slightly increased on day+76 in the vehicle treated group. TG values were quite stable in the SAR10 groups on the 2 study days while lower TG values were recorded for the SAR16 and combo treated groups on day+76. The ivGTT glucose and insulin AUC data in the vehicle treated monkeys were stable during the study. The ivGTT glucose AUC data was significantly decreased in the SAR10, SAR16, and combination treated groups compared to the vehicle treated group. In addition, the ivGTT glucose AUC data was significantly decreased in the combo treated group compared to the SAR16 treated group. A significant increase of plasma insulin AUC was also observed in the SAR10 treated group compared to the vehicle treated group.

(452) The results are also shown in FIGS. 27 to 38.

Example 14: In Vitro Cellular Characterization of GLP-1R Agonistic Peptides

(453) GLP-1R Agonistic Peptides with Reduced Potency at the Human GLP-1 Receptor:

(454) For the dual GLP-1 anti-FGFR1/KLB monoclonal antibody fusion proteins, in order to manage nausea at the dose required to efficiently activate the hFGFR1c+KLB complex, the GLP-1 receptor agonist peptides typically have a reduced potency at the GLP-1R compared to human GLP-1.

(455) To reduce the potency of the GLP-1 like peptides, mutations were introduced at various positions in the peptide. A total of 29 peptides were synthesized as single peptidic agonists via SPPS and tested for activity at the human GLP-1 receptor, human GIP receptor and human glucagon (GCG) receptor as described in the Materials and Methods section.

(456) Agonism of the peptides in Table A3 for human GLP-1, GIP and glucagon receptor was determined by functional assays measuring the CAMP responses in a HEK-293 cell line stably over-expressing either human GLP-1, GIP or glucagon receptor as described in the Materials and Methods section. Thereby, EC50 values and Emax values were determined (Emax values not shown). The results are summarized in Table L.

(457) TABLE-US-00036 TABLE L EC50 values of human GLP-1(7-36) (P003, control) and several single GLP-1R agonistic peptides measured via HTRF cAMP assay in HEK-293 cells. PEP HTRF cAMP EC50 (pmol/L) ID NO Human GLP-1R Human GIPR Human GCGR P003 0.77 >10000 >10000 P005 3.1 n.d. n.d. P006 14.7 n.d. n.d. P008 23.2 >10000 >10000 P010 3.5 n.d. n.d. P013 9.9 >10000 >10000 P014 10.5 >10000 5400 P015 15.6 >10000 >10000 P017 8.5 >10000 >10000 P019 27.6 n.d. n.d. P020 205.7 n.d. n.d. P021 27.6 >10000 >10000 P023 1.7 >10000 >10000 P024 2.6 10000 >10000 P025 1.6 1597 545 P026 2.0 2477 3904 P027 0.58 225 >10000 P028 0.61 390 >10000 P029 0.41 1368 >10000 P030 0.43 2760 >10000 P031 0.59 271 >10000 P032 0.44 2370 >10000 P033 0.31 24 >10000 P034 0.42 257 >10000 P035 20.3 >10000 >10000 P036 124.8 >10000 >10000 P037 157.8 >10000 >10000 P038 52.4 >10000 >10000 P039 29.8 >10000 >10000 P040 62.7 >10000 >10000 P041 32.5 >10000 >10000 n.d.: not determined

(458) The peptides exemplified in Table L all show a high agonistic potency on the human GLP-1 receptor, someas the peptides with Peptide No PO23 to P034 with the E16K and E17R modificationsin the low picomolar range, someespecially peptides P013 to P022, and P036 to P041 with an additional amino acid at the N-terminus compared to natural GLP-1in the high picomolar range. Sequences to be fused to the mAb backbones could be chosen based on the ideal ratio compared to the FGF21-like activity measured via a Luciferase reporter gene assay. The peptides show a sufficient split towards related GPCRs: the activity split towards the closely related human GIP receptor is at least 75, towards the closely related human Glucagon receptor at least 300.

(459) These data demonstrate that the GLP-1R agonistic activity of GLP-1-like peptides can be modulated to achieve a desired potency reduction. Peptides with suitable GLP-1R agonistic profile were selected for fusion with the mAb and expressed as antibody fusion proteins. In addition, new mutations were expressed as full-length proteins.

Example 15: In Vitro Cellular Characterization of Fusion Antibodies

(460) The dual activity monoclonal antibody fusion proteins were tested in a cell-based assay to determine their potency on the GLP-1R and the hFGFR1c+KLB complex, respectively. Agonism of antibody fusion proteins on the human GLP-1R, human GIPR and human GlucagonR (GCGR) was measured via HTRF CAMP assay in HEK-293 cells. Thereby, EC50 values and Emax values were determined (Emax values not shown).

(461) A GLP-1 like peptide sequence (either previously identified as active by synthesis and characterization of single GLP-1R agonistic peptides (see Example 14) or by experimental mutation of known GLP-1R agonistic sequences) was fused to an mAb with confirmed activity on the hFGFR1c+KLB complex.

(462) The cellular activity of the monoclonal antibody fusion proteins on the hFGFR1c+KLB complex was analyzed with a Luciferase gene reporter assay assessing FGF21-like signaling. Thereby, EC50 values and Emax values were determined.

(463) As controls, antibodies Ab0001, Ab0003, Ab0004, Ab0006 and Ab0505 (see Table A1), as well as human GLP-1(7-36) (P003) were used. The results are shown in FIGS. 22 to 25 and Table M.

(464) TABLE-US-00037 TABLE M EC50 values of human GLP-1(7-36) (P0003) and several GLP-1 anti-FGFR1/KLB monoclonal antibody fusion proteins on the human GLP-1R, human GIPR and human GlucagonR (GCGR), as well as on the hFGFR1c + KLB complex. HEK293 HEK293 hFGFR1c + hFGFR1c + KLB (iLite) KLB (iLite) HTRF cAMP EC50 (pmol/L) AB No or EC50 Emax Human Human Human Fu No (nmol/L) (%) GLP-1R GIPR GCGR P003 n.d. n.d. 0.77 >10000 >10000 Ab0001 0.05 2327.03 >10000 >10000 n.d. Ab0003 0.04 2532.69 n.d. n.d. n.d. Ab0006 0.06 2546.99 n.d. n.d. n.d. Ab0004 0.08 1854.36 n.d. n.d. n.d. Ab0505 0.21 2263.44 >10000 n.d. n.d. Fu0008 0.10 2123.70 1.45 >10000 >10000 Fu0009 0.09 2322.99 0.91 >10000 n.d. Fu0010 0.09 1288.27 259.51 >10000 >10000 Fu0012 0.13 2796.58 1216.68 >10000 >10000 Fu0013 0.07 1484.61 293.45 >10000 >10000 Fu0014 0.22 1928.21 221.86 >10000 >10000 Fu0015 0.11 1546.75 185.93 >10000 >10000 Fu0016 n.d. n.d. 103.41 >10000 >10000 Fu0017 n.d. n.d. 238.78 >10000 >10000 Fu0018 0.15 3902.64 424.00 >10000 >10000 Fu0020 0.42 2054.91 80.30 >10000 >10000 Fu0022 3.34 2599.04 5.10 >10000 >10000 Fu0023 n.d. n.d. 232.98 >10000 >10000 Fu0024 n.d. n.d. 184.39 >10000 >10000 Fu0025 0.13 2285.33 236.41 >10000 >10000 Fu0026 0.54 1859.91 212.43 >10000 >10000 Fu0027 n.d. n.d. 110.71 >10000 >10000 Fu0028 n.d. n.d. 174.97 >10000 >10000 Fu0031 0.23 2409.65 8.06 1530.00 >10000 Fu0032 0.17 2198.69 1.76 >10000 >10000 Fu0033 0.15 2015.93 1.30 >10000 >10000 Fu0034 0.09 4261.55 1.32 >10000 >10000 Fu0035 0.12 2912.57 5.41 >10000 >10000 Fu0036 0.16 2241.80 1.49 >10000 >10000 Fu0037 n.d. n.d. 1.65 >10000 >10000 Fu0038 0.11 1854.65 2.13 >10000 >10000 Fu0039 0.14 2289.90 1.27 >10000 >10000 Fu0040 0.15 1128.04 1.75 >10000 >10000 Fu0041 0.03 2418.80 0.82 >10000 >10000 Fu0042 0.15 1235.92 837.39 >10000 >10000 Fu0044 0.24 2151.21 1471.26 >10000 >10000 Fu0045 0.23 1340.59 163.48 >10000 >10000 Fu0047 0.24 1837.58 100.92 >10000 >10000 Fu0048 n.d. n.d. 65.83 >10000 >10000 Fu0049 n.d. n.d. 163.31 >10000 >10000 Fu0050 0.19 2331.62 347.90 >10000 >10000 Fu0052 2.29 2890.62 212.85 >10000 >10000 Fu0053 n.d. n.d. 13.75 >10000 >10000 Fu0054 n.d. n.d. 9.05 >10000 >10000 Fu0057 0.33 1953.17 105.44 >10000 >10000 Fu0059 0.31 2389.18 135.48 >10000 >10000 Fu0060 0.23 2005.36 102.00 >10000 >10000 Fu0063 0.20 2065.47 4.07 1320.00 >10000 Fu0064 n.d. n.d. 3.43 >10000 >10000 Fu0065 n.d. n.d. 1.24 >10000 >10000 Fu0067 0.12 3537.75 2.62 >10000 >10000 Fu0068 0.16 2597.93 2.16 >10000 >10000 Fu0069 n.d. n.d. 1.69 >10000 >10000 Fu0070 n.d. n.d. 1.83 >10000 >10000 Fu0071 n.d. n.d. 1.96 >10000 >10000 Fu0072 0.14 1314.98 3.00 9816.31 >10000 Fu0073 0.07 1103.09 0.98 44400.00 >10000 Fu0074 0.14 1149.43 14.73 >10000 >10000 Fu0076 0.38 1629.42 224.47 >10000 >10000 Fu0077 1.45 2244.94 2822.66 >10000 >10000 Fu0079 n.d. n.d. 263.32 >10000 >10000 Fu0081 0.30 2290.53 110.47 >10000 >10000 Fu0082 n.d. n.d. 90.60 >10000 >10000 Fu0087 2.62 2161.76 1448.31 >10000 >10000 Fu0089 0.88 2222.56 520.69 >10000 >10000 Fu0090 n.d. n.d. 5974.08 >10000 >10000 Fu0092 0.29 2923.02 125.98 >10000 >10000 Fu0095 1.38 2259.22 4.98 1070.00 >10000 Fu0096 0.43 2546.69 8.33 >10000 >10000 Fu0097 0.14 1821.59 2.46 >10000 >10000 Fu0098 0.16 2053.15 2.18 >10000 >10000 Fu0099 1.28 2617.59 9.73 1380.00 >10000 Fu0100 0.43 1679.73 4.27 >10000 >10000 Fu0101 0.16 1308.34 1.58 >10000 >10000 Fu0102 0.27 2012.31 2.14 2510.00 >10000 Fu0103 0.11 2560.03 2.72 >10000 >10000 Fu0104 0.11 1932.75 3.58 >10000 >10000 Fu0105 0.25 2126.08 3.06 >10000 >10000 Fu0106 0.27 3453.44 937.93 >10000 >10000 Fu0107 0.21 3593.40 651.99 >10000 >10000 Fu0108 0.37 2481.32 193.00 >10000 >10000 Fu0109 0.34 2856.74 129.90 >10000 >10000 Fu0110 0.17 1915.29 624.33 >10000 >10000 Fu0111 0.24 2023.55 651.53 >10000 >10000 Fu0112 0.68 1866.30 4.22 >10000 >10000 Fu0113 0.15 2148.68 3.21 >10000 >10000 Fu0114 0.44 3473.08 665.18 >10000 >10000 Fu0119 2.21 2481.56 491.99 >10000 >10000 Fu0120 0.27 3113.90 5.54 >10000 >10000 Fu0121 9.76 3689.53 11.53 >10000 >10000 Fu0122 0.29 1516.91 33.15 >10000 >10000 Fu0123 1.48 2389.92 4132.25 >10000 >10000 Fu0126 1.02 3441.34 2602.33 >10000 >10000 Fu0127 1.11 3754.30 810.85 >10000 >10000 Fu0128 0.09 2835.15 2.47 >10000 >10000 Fu0129 0.28 2387.69 2.28 >10000 >10000 Fu0130 0.07 1958.33 505.58 >10000 >10000 Fu0131 0.19 2489.54 366.86 >10000 >10000 Fu0132 0.36 2189.25 119.73 >10000 >10000 Fu0133 0.46 2655.04 116.37 >10000 >10000 Fu0134 0.28 2427.87 389.98 >10000 >10000 Fu0135 0.24 2825.81 319.94 >10000 >10000 Fu0136 0.50 2485.13 5.29 >10000 >10000 Fu0137 0.18 1754.92 82.40 >10000 >10000 Fu0138 0.11 2706.77 664.85 >10000 >10000 Fu0139 0.37 2854.62 142.97 >10000 >10000 Fu0140 0.62 2407.72 464.96 >10000 >10000 Fu0141 2.80 2535.39 207.73 >10000 >10000 Fu0142 0.55 1978.22 209.37 >10000 >10000 Fu0143 0.45 2572.23 120.13 >10000 >10000 Fu0144 0.43 1974.09 4.48 >10000 >10000 Fu0147 3.21 4471.68 4636.24 >10000 >10000 Fu0148 7.65 2945.43 353.48 >10000 >10000 Fu0150 1.80 2543.23 2318.25 >10000 >10000 Fu0151 0.91 3178.72 788.20 >10000 >10000 Fu0176 0.07 1954.74 1.90 >10000 >10000 Fu0177 0.09 1989.54 206.33 >10000 >10000 Fu0178 0.12 1954.25 212.50 >10000 >10000 Fu0239 0.09 1032.91 0.75 >10000 >10000 Fu0240 0.06 1076.34 3.97 >10000 >10000 Fu0242 0.05 923.81 161.69 >10000 >10000 Fu0243 0.05 800.32 5.60 >10000 >10000 Fu0244 0.04 896.99 96.47 >10000 >10000 Fu0245 0.07 887.31 15.35 >10000 >10000 Fu0246 0.06 1086.25 1.74 >10000 >10000 Fu0247 0.02 945.17 2.51 >10000 >10000 Fu0248 0.09 802.39 9.87 >10000 >10000 Fu0249 0.09 871.29 648.87 >10000 >10000 Fu0250 0.07 707.32 610.31 >10000 >10000 Fu0251 0.24 768.87 169.41 8205.85 >10000 Fu0252 0.03 884.28 1.01 >10000 >10000 Fu0253 0.09 814.45 5.42 >10000 >10000 Fu0254 0.09 791.02 5.46 5584.84 >10000 Fu0259 0.03 891.48 0.95 >10000 >10000 Fu0262 0.00 823.85 101.82 >10000 >10000 Fu0263 0.06 780.25 628.19 >10000 >10000 Fu0265 0.67 617.24 8.46 7602.74 >10000 Fu0272 0.04 589.92 3.74 3180.94 >10000 Fu0275 0.04 578.86 77.56 >10000 >10000 Fu0276 0.06 762.00 34.21 >10000 >10000 Fu0507 0.36 2139.65 153.14 n.d. n.d. Fu0508 0.49 2209.26 246.57 n.d. n.d. Fu0506 0.60 2150.70 1.74 n.d. n.d. n.d.: not determined

(465) FGF21-like activity and GLP-1R agonism were retained in the fusion antibodies. No residual activity on the Glucagon receptor was determined. All fusion antibodies showed a high split towards the human GIPR (at least 100-fold) with the exception of Fu0251.

(466) This data demonstrates that there was no significant loss of FGF21-like activity or GLP-1R agonistic activity following the fusion of the GLP-1 like peptide sequence to the light chain, the heavy chain, or both, the light and the heavy chain, of the anti-FGFR1/KLB monoclonal antibody.

(467) Fusion of peptide sequence P005, P010, P019, P020, P026, P028-P032, and P036-P038 led to a very good conservation of the GLP-1R agonistic activity of the single peptides to the respective fusion antibody, irrespective of the fusion format (LC, HC or LC+HC), see Fu0017, Fu0018, Fu0022, Fu0028, Fu0033, Fu0034, Fu0036-Fu0038, Fu0049, Fu0050, Fu0054, Fu0060, Fu0065, Fu0068-Fu0070, Fu0081, Fu0082, Fu0092, Fu0097, Fu0098, Fu0100-Fu0102, Fu0240, Fu0242, Fu0243, Fu0253, and Fu0254.

(468) To conclude, fusion proteins were generated which are able to activate the hFGFR1c+KLB complex as well as activate the human GLP-1 receptor. Those fusion molecules consisting of a GLP-1 like peptide compound and an anti-FGFR1/KLB monoclonal antibody compound display dual activity and can be used to provide combined pharmacology.