TREATMENT
20230054093 · 2023-02-23
Inventors
Cpc classification
A61P29/00
HUMAN NECESSITIES
A61K38/04
HUMAN NECESSITIES
International classification
A61K38/04
HUMAN NECESSITIES
A61K9/00
HUMAN NECESSITIES
Abstract
Disclosed are molecules with affinity for (or an ability to bind to) sialic acid (and in particular sialoglycoconjugates) on cell surfaces (these including sialic acid containing glycoproteins and cell surface sialic acid receptors), for use in treating or preventing of inflammatory diseases and/or conditions with an inflammatory aeitiology. The disclosed molecules may be of particular use in the treatment and/or prevention of diseases and/or conditions characterised by inflammation occurring as a consequence of a cascade of cytokines, inflammation that may occur in and around the tissues and/or structures of the lung and inflammation occurring as a result of an infection.
Claims
1-7. (canceled)
8. A method of treating and/or preventing a lung inflammatory disease, pneumonia, bronchiolitis and/or bronchitis, said method comprising administering a subject in need thereof, a therapeutically effective amount of a sialic acid binding molecule.
9. The method of claim 8, wherein the sialic acid binding molecule comprises or consists essentially of the sequence of SEQ ID NO: 9 or a sequence at least 85% identical thereto.
10. The method of claim 8, wherein the sialic acid binding molecule comprises or consists essentially of, the following sequence: TABLE-US-00023 GAMVIEKEDVETNASNGQRVDLSSELDKLKKLENATVHMEFKPDPKAPAFYNLFSVSSATKKDEYETMAV YNNTATLEGRGSDGKQFYNNYNDAPLKVKPGQWNSVTFTVEKPTAELPKGRARLYVNGGLSRTSLRSGNE IKDMPDVTHVQIGATKRANNTVWGSNLQIRNLTVYNRALTPEEVQKRSGGGSGVIEKEDVETNASNGQRV DLSSELDKLKKLENATVHMEFKPDPKAPAFYNLFSVSSATKKDEYFTMAVYNNTATLEGRGSDGKQFYNN YNDAPLKVKPGQWNSVTFTVEKPTAELPKGRARLYVNGGLSRTSLRSGNFIKDMPDVTHVQIGATKRANN TVWGSNLQIRNLTVYNRALTPEEVQKRSGGSLGVPDFESDWFDVSSNSLYTLSHGLQRSPRRVVVEFARS SSPSTWNIVMPSYFNDGGHKGSGAQVEVGSLNIKLGTGAAVWGTGYFGGIDNSATTRFATGYYRVRAWI.
11. The method of claim 8, wherein the sialic acid binding molecule is administered intranasally.
12. The method of claim 8, wherein the method comprises mucosally administering a composition comprising the sialic acid binding molecule to the subject in need thereof.
13. The method of claim 8, wherein the method is a method of preventing a lung inflammatory disease, pneumonia, bronchiolitis and/or bronchitis and the sialic acid binding molecule is used prophylactically.
14. The method of claim 8, wherein the sialic acid binding molecule does not exhibit sialidase activity.
15. A method of treating and/or preventing a disease selected from the group consisting of: (i) inflammatory diseases; (ii) diseases and/or conditions with an inflammatory aeitiology; (iii) a lung inflammatory disease; (iv) inflammation occurring as a consequence of a cascade of cytokines; (v) pneumonia; (vi) bronchiolitis; and (vii) bronchitis; said method comprising administering to a subject in need thereof, a therapeutically effective amount of a sialic acid binding molecule; wherein the sialic acid binding molecule comprises, or consists essentially of, the sequence of SEQ ID NO: 9 or a sequence at least 85% identical thereto.
Description
DETAILED DESCRIPTION
[0127] The present invention will now be described in detail with reference to the following figures which show:
[0128]
[0129]
[0130]
[0131]
[0132]
[0133]
[0134]
[0135]
[0136]
[0137]
[0138]
[0139]
[0140]
[0141]
[0142]
[0143]
[0144]
[0145]
[0146]
[0147]
[0148]
[0149]
[0150]
[0151]
[0152]
[0153]
[0154]
[0155]
METHODS AND RESULTS
Example 1
Sp2CBMTD: Prediction of Immunogenic Regions
Nordic Biopharma in Silico Screen
[0156] The in silico T-cell epitope screening identified four significant and two borderline immunogenic clusters:
Significant:
[0157]
TABLE-US-00011 Domain Residue range Sequence SpCBM 245 to 254 GVLSRTSLRS PaTD 340 to 349 WFSVSSNSLY PaTD 351 to 359 LSHGLQRSP PaTD 398 to 406 GSLNIRLGT
Borderline:
[0158]
TABLE-US-00012 Domain Residue range Sequence SpCBM 167 to 178 FYNLFSVSSATK SpCBM 239 to 251 VRLYVNGVLSRTS
ProImmune Human Donor T-Cell Proliferation Assay
[0159] The ProImmune study highlighted two regions of high antigenicity and two regions of moderate antigenicity:
High Antigenicity:
[0160]
TABLE-US-00013 Domain Residue range Sequence SpCBM 236 to 250 KGRVRLYVNGVLSRT PaTD 392 to 406 GAQVEVGSLNIRLGT
Moderate Antigenicity:
[0161]
TABLE-US-00014 Domain Residue range Sequence SpCBM 167 to 181 FYNLFSVSSATKKDE PaTD 338 to 352 SDWFSVSSNSLYTLS
ProPred in Silico Analysis
[0162] A further in silico tool, the online ProPred server.sup.4, was also used. The output of the ProPred server is shown in
TABLE-US-00015 Domain Residue range Sequence SpCBM 286 to 294 IRNLTVYNR
Mutations in the Individual CBM and TD Domains
[0163] To guide the design of mutations that might reduce immunogenicity, ProPred was used to test the effect of changing each residue in these peptides to every alternative residue. Those that gave the greatest reduction in predicted number of allele binders were noted. As the crystal structure of both the SpCBM and TD domains are known, these mutations were also modelled to reduce the likelihood of introducing mutations that would obviously disrupt the protein structure.
[0164] Initially, nine single mutations in SpCBM and four single mutations in PaTD were introduced and are listed below (‘Im’ is short for immunogenicity mutant):
TABLE-US-00016 (SpCBM) variants Mutation (PaTD) variants Mutation WTSp — WTTD — Im15 Y168W Im24 S342D Im16 L170A Im25 S345D Im17 L170T Im26 L348D Im18 V173G Im27 R403K Im19 V239A lm20 V239T Im21 V246G Im22 I286A Im23 Y292E Note: Im1 to Im14 (not shown) were introduced by mutagenesis into a non-codon optimized background, before the Prolmmune data were available.
Synthesis of WT and Mutated Constructs
[0165] The genes encoding WT SpCBM, WT PaTD and the variants Im15 to Im27 were codon optimized for E. coli expression and synthesized by GeneArt. The genes were then cloned in-house into the pHISTEV vector for expression as 6His-tagged proteins.
Expression and Biophysical Characterization
[0166] An initial expression test was performed to assess solubility. The results show that all were expressed, but not all were soluble (
[0167] Results of the expression test show that: [0168] Im16 (L170A) is insoluble or very poorly soluble [0169] Im25 (TD, S345D) is insoluble [0170] Im15 (Y168W) and Im17 (L170T) have reduced solubility [0171] Im18 (V173G) and Im22 (I286A) are slightly reduced. [0172] The remainder show soluble expression.
[0173] The 13 soluble proteins were expressed in E. coli and purified by immobilized metal affinity chromatography (IMAC), followed by TEV digestion to remove the 6His-tag, then reverse IMAC and size exclusion chromatography (SEC).
[0174] Ten purified domains (WTSp, Im19, Im20, Im21, Im22, Im23, WTTD, Im24, Im26 and Im27) were further characterized by:
[0175] (i) Thermofluor to measure melting temperature (Tm)
[0176] (ii) Near UV circular dichroism (CD) to compare tertiary structures to WT
[0177] (iii) Dynamic light scattering (DLS) to check oligomeric state in solution
[0178] (iv) Surface plasmon resonance (SPR) to measure binding affinity to sialyllactose
[0179] (v) Measurement of IL-8 cytokine stimulation
[0180] The results are summarized in Table 1.
TABLE-US-00017 TABLE 1 Qualitative summary of the biophysical characterizations of the WT domains and their variants. Colour coding is from green to red (including green’, orange and yellow), where green indicates that the variant closely resembles its WT counterpart for that particular characteristic and pale green (green’) or yellow indicate increasing degrees of differences. Red or orange indicate significant differences. Tm +/− NearUV Cytokine Name Mutation Solubility Purification 6SL CD DLS Biacore stimulation WTSp — Green Green Green Green Green Green Green Im15 Y168W Yellow Orange Red N/A N/A N/A N/A Im16 L170A Red N/A N/A N/A N/A N/A N/A Im17 L170T Yellow Orange N/A N/A N/A N/A N/A Im18 V173G Green’ Orange N/A N/A N/A N/A N/A Im19 V239A Green Green Green Green Green Green N/D Im20 V239T Green Green Green’ Green’ Green Green N/D Im21 V246G Green Green Green’ Green Green Green Green Im22 I286A Green’ Green Green’ Green Green Green Green Im23 Y292E Green Green Green’ Green’ Green Yellow Yellow Im24 S342D Green Green Green Green Green Im25 S345D Red N/A N/A N/A N/A Im26 L348D Green Green Green’ Green Green Im27 R403K Green Green Green Green Green WTTD — Green Green Green Green Green N/A: these characterizations were not performed due to poor solubility/purity of the protein. N/D: not determined.
Sp Peptide 167-181:
[0181] Im15, Im16, Im17, Im18 are all insoluble or poorly soluble (as stated, this does not necessarily impact on protein utility). These are in the ‘moderately’ antigenic region 167-181 (FYNLFSVSSATKKDE). This region is clearly very sensitive to change.
[0182] Earlier results show that M156F, which sits adjacent to L170 (and I286), increases Tm by ˜4° C.
[0183] This could therefore be combined with L170T. M156F does not increase predicted immunogenicity.
[0184] M185I increases Tm by 5° C., and lies parallel to L170 (
Sp Peptide 236-250:
[0185] Im19, Im20, Im21 all behave similarly to WT. These are in the ‘highly’ antigenic region 236-250 (KGRVRLYVNGVLSRT).
[0186] Im19 (V239A) was chosen over the threonine mutation (Im20, V239T). There is no difference in predicted immunogenicity but Im19 is a closer match to WT Thermofluor Tm and Near UV spectrum. This would be combined with Im21 (V246G).
Sp Peptide 286-294:
[0187] Im22 (I286A) is broadly similar to WT while Im23 (Y292E) appears to exhibit reduced ligand affinity. This region, 286-294 IRNLTVYNR, was not flagged up by ProImmune but is strongly predicted by ProPred to be immunogenic.
[0188] There is some indication that Im22 has lower Tm than WT. This residue is adjacent to M156 so may behave differently if M156F was included.
TD Peptide 338-352:
[0189] Im24 (S342D) and Im26 (L348D) show similar characteristics to the WT trimerization domain, but with some suggestion of reduced Tm in Im26. These are in the ‘moderately’ antigenic region 338-352 SDWFSVSSNSLYTLS. The WT sequence was predicted to bind 9 alleles, while Im24 predicts 2 alleles and a Im24/Im26 double mutant predicts 1 allele.
TD Peptide 392-406:
[0190] Im27 (R403K) is similar to WT. It is part of the ‘highly’ antigenic region 392-406 GAQVEVGSLNIRLGT. Predicted alleles are reduced from 21 to 3 when this mutation is introduced.
Synthesis of Multiple Mutation Combinations Im28-34
[0191] The following mutations were introduced:
[0192] i) M156F/L170T
[0193] ii) M156F/L170T/M185I: In ProPred, alleles predicted for this region are reduced from 31 in the WT to 19 for this combination.
[0194] iii) V239A/V246G: In ProPred, alleles for this region are reduced from 44 to 3.
[0195] iv) I286A/Y292E: In ProPred, alleles are reduced from 41 to 1.
[0196] v) V239A/V246G/I286A/Y292E combines the previous two doubles.
[0197] vi) M156F/L170T/M185I/V239A/V246G/I286A/Y292E combines all the Sp mutations
[0198] vii) TD: S342D/L348D/R403K: Predicted alleles are reduced from 9 to 1 for TD peptide 338-352 and alleles for peptide TD peptide 392-406 are reduced from 21 to 3. This triple mutant combines all the TD mutants. They are all surface exposed and distal to the N-terminal end of TD, so would not be expected to interfere with SpCBM in the hexamer form.
[0199] The constructs are named Im28 to Im34:
TABLE-US-00018 (SpCBM) variant Mutations Im28 M156F/L170T Im29 M156F/L170T/M185I lm30 V239A/V246G Im31 I286A/Y292E Im32 V239A/V246G/I286A/Y292E Im33 M156F/L170T/M185I/V239A/V246G/I286A/Y292E (PaTD) variant Mutation Im34 S342D/L348D/R403K
2.5 Expression and Biophysical Characterization of Im28-Im34
[0200] As with the single mutations, the combinations Im28 to Im34 were synthesized by GeneArt and subcloned into pHISTEV for expression analysis. A nickel bead pull-down on the His-tagged soluble extract was also performed (
Hexameric Forms
Design of Hexameric Constructs HEX1 to HEX17
[0201] Genes encoding the hexameric forms (called HEX1 to HEX17) were synthesized by GeneArt:
Sp2CBMTD
[0202]
TABLE-US-00019 variant Mutations HEX1 CBM1(L170T V239A V246G I286A Y292E)-CBM2(L170T V239A V246G I286A Y292E)-TD (S342D L348D R403K) HEX2 CBM1(V239A V246G I286A Y292E)-CBM2(V239A V246G I286A Y292E)- TD (S342D R403K) HEX3 CBM1(V239A V246G I286A)-CBM2(V239A V246G I286A)- TD (S342D R403K) HEX4 CBM1(V239A V246G)-CBM2(V239A V246G)-TD (S342D) HEX5 CBM1(V239A V246G)-CBM2(V239A V246G)-TD(R403K) HEX6 CBM1(V239A V246G)- CBM2(V239A V246G)-TD (S342D R403K) HEX17 CBM1(V239A V246G A162P)- CBM2(V239A V246G A162P)- TD (S342D R403K)
[0203] The hexameric forms were synthesized in two parts to avoid problems associated with synthesising repeat sequences in the tandem CBM copies. The first gene covered the first CBM and the second part encompassed the second CBM plus the TD. These could then be simultaneously cloned into pHISTEV to create the Sp2CBMTD construct that trimerizes upon expression.
[0204] The first hexamer, HEX1, contained the mutations L170T/V239A/V246G/I286A/Y292E in the CBMs and S342D/L348D/R403K in the TD.
[0205] The solubility data of the individual domains indicated that HEX1 was unlikely to be soluble (again, not necessarily a reflection on the utility of the molecule); a further construct, HEX3, was synthesized. Note that HEX2 contained the same mutations as HEX3, but with the addition of Y292E.
[0206] HEX3 was synthesized and subcloned into the pHISTEV vector. Expression was insoluble under all conditions tested (varying temperature, IPTG concentration, cell density at induction, with or without heat shock). The CBM-only domain containing the same three mutations (V239A V246G I286A) is soluble. A double mutant (V239A V246G) behaves very similarly to WT. Therefore, further variants (HEX4, HEX5 and HEX6) were designed and constructed by PCR/ligations, which exclude I286A and contain either one or both of the TD mutations.
[0207] During the work on HEX6 a number of other versions were designed containing different combinations of the HEX6 mutations (numbered HEX7 to HEX16; not characterised).
[0208] HEX17 contains the HEX6 mutations with an additional A162P mutation. This proline mutation has been shown to increase the single CBM Tm by 3-4° C. The proline mutation is not near the other mutations, the N- or C-termini or the ligand binding site.
Characterization of the Hexameric Variants
[0209] The expression, purification and characterization results are shown in Table 2. Based on these results, HEX6 and HEX17 were taken forward. The positions of the HEX17 mutations on the hexamer are shown in
TABLE-US-00020 TABLE 2 Qualitative summary of the biophysical characterizations of the hexameric Sp2CBMTD variants. Colour coding is from green to red, where green indicates that the variant closely resembles its WT counterpart for that particular characteristic and pale green (green’) or yellow indicate increasing degrees of differences. Red or orange indicate significant differences. NearUV IL-8 Name Mutations Solubility Purification Thermostability CD Biacore assay Hex1 L170T/V239A/V246G/I286A/Y292E/ S342D/L348D/R403K Red N/A N/A N/A N/A N/A Hex2 V239A/V246G/I286A/Y292E/S342D/R403K (designed but not made) Hex3 V239A/V246G/I286A/S342D/R403K Red N/A N/A N/A N/A N/A Hex4 V239A/V246G/S342D Yellow Red N/A N/A N/A N/A Hex5 V239A/V246G/R403K Green Yellow Yellow N/A N/A N/A Hex6 V239A/V246G/S342D/R403K Green Green Yellow Green Green Yellow Hex7 Note: These constructs are different combinations of the Hex6 to 16 mutations and were designed as a back-up in case Hex6 failed Hex17 A162P/V239A/V246G/S342D/R403K Green Green Green’ Green Green reduced IL-8 N/A: these characterizations were not performed due to poor solubility/purity of the protein. N/D: not determined.
Example 2: Inflammatory Mediators
[0210] Aim: To Measure the Innate Immune Response of mCBM-Treated Human Lung Epithelial Cells (A549) by Analysing Levels of Inflammatory Mediators Over Time.
[0211] Administration of Sp2CBMTD to mammalian cells stimulated a pro-inflammatory response both in vitro and in vivo.sup.1,2. To determine whether this was still observed with modified hexameric sialic acid binding molecules, mammalian A549 cells were stimulated by the addition of 10 μg of biologic (Sp2CBMTD (aka SpOrig), HEX6 (i.e. a sialic acid binding molecule comprising 3×HEX6 units) or HEX17 (i.e. a sialic acid binding molecule comprising 3×HEX17 units) and cell culture medium was harvested at specific time-points post administration. The concentrations of inflammatory mediators were measured both by ELISA and a multiplex assay.
[0212] Human IL-8 (benchmark cytokine for the study) response using a human 1× Mouse CXCL1/KC Quantikine ELISA Kit (R&D BioSystems). The concentration levels of IL-8 from stimulated A549 cells are shown in
[0213] Inflammatory mediator response using a Human Cytokine 12-plex Assay (Bio-Plex Pro™, Bio-Rad).
Example 3
[0217] The objective of this study was to evaluate the effect of HEX17(aka “Neumifil”) on RSV virus replication, cell accumulation and biomarkers on day 4 post infection in mice. [0218] Mice were treated with either vehicle or Neumifil (100 μg, i.n.) prophylactically on day 3, day 1 and 1 hour pre RSV-A2 infection or 1 hour pre RSV-A2 infection, therapeutically on day 1 and day 3 post RSV-A2 infection or with a combined prophylactic and therapeutic regimen 1 hour pre RSV-A2 infection and day 1 and day 3 post infection. [0219] RSV-A2 infected mice that were vehicle treated showed a significant increase in lung viral load at 4 days post infection when compared to PBS-challenged animals. This was accompanied by a significant pulmonary inflammation as demonstrated by increased cell numbers in bronchoalveolar lavage fluid (BALF), especially neutrophils and lympthocytes. Pro-inflammatory cytokines were also significantly elevated in the BALF fluid. [0220] Treatment with Neumifil in RSV-A2 infected mice resulted in a significant protective effect as evidenced by a reduction in lung tissue viral load and reduced inflammatory cell influx and cytokine concentrations in BALF. This was particularly evident in animals receiving a prophylactic dosing regimen in which animals receiving doses day 3, day 1 and 1 hour pre-infection were offered the greatest protection. [0221] Data from this study demonstrates that Neumifil has a possible protective and therapeutic effect in treating RSV-A2 infection.
Test Vehicle
[0222] Supplied by Pneumagen. Quantity: 10×1 mL aliquots of phosphate buffered saline (10×) diluted to 1× using MilliQ water pH 7.2. Manufacturer: Life Technologies. Product Number: 70013-016. Storage: Room temperature or 20° C.
Test Agent (HEX17: Neumifil)
[0223] Supplied by Pneumagen (Batch Number: 20190410A; Certificate Number: PGN0030/290419). Quantity: 11×100 μL aliquots of protein at a concentration of 10 mg/mL storage: −20° C.
RSV Infection
[0224] Non-fasted mice (female BALB/c, 17-20 g) were weighed, individually identified on the tail with a permanent marker and then infected intranasally with RSV or virus diluent (DMEM, 2% v/v FCS, 12.5% w/v Sucrose) under isoflurane (5% in O.sub.2) anesthesia. The A2 strain of RSV (50 μL of 5×10.sup.6 PFU) was instilled into each nostril in a drop-wise fashion, alternating between the two until a volume of 50 μL has been delivered. At the outset of the study, the A2 strain of RSV was back-titrated to determine viability of the virus.
Test Agent Formulation
[0225] Throughout the study the test vehicle and test agent were formulated as detailed below.
For Test Vehicle (PBS) Preparation:
[0226] On each day of dosing, an aliquot (1 mL vial) of the test vehicle was diluted from 10× to 1× to a volume of 10 mL using endotoxin-free water. 1×PBS was then used for Neumifil dilution and also for dosing the vehicle control group.
For Test Agent (Neumifil) Preparation:
[0227] On each day of dosing, an aliquot of Neumifil (100 μL per vial at 10 mg/mL) was thawed and transferred into a new sterile 0.5 mL Eppendorf tube and centrifuge at 13,000 rpm for 5 min. The supernatant was transferred into new sterile 1.5 mL Eppendorf tubes and diluted to a volume of 400 μL using 1×PBS to formulate a concentration of 2.5 mg/mL (equivalent to 100 μg/40 μL). Neumifil tubes were clearly labelled and kept at RT. Prior to dosing, the formulation contents were gently mixed using a pipette, avoiding bubbles.
[0228] A new vial of Neumifil or vehicle was used for each group and day of dosing. Remaining formulations (both diluted and non-diluted Neumifil) were stored at −20° C. and shipped back to Pneumagen at the end of the study.
Dosing
[0229] Test agent (Neumifil) or vehicle (PBS) were administered intranasally (40 μL) as the first dose either 3 days before infection or 1 hour before infection or 1 day after infection (see dosing table below for more detail). First dose of 40 μL PBS (vehicle) will be given 1 hour before infection for both vehicle control (group 1) and virus only control (group 2).
Treatment Group Dosing
[0230]
TABLE-US-00021 Grp Day −3 Day −1 Hour −1 Hour 0 Day 1 Day 2 Day 3 1 PBS PBS PBS PBS (Vehicle) (i.n. dosing.) 2 PBS RSV-A2 PBS PBS (Vehicle) (i.n. 5 X 10.sup.6 PFU dosing.) 3 Neumifil RSV-A2 (100 μg, 5 X 10.sup.6 PFU i.n.dosing.) 4 Neumifil Neumifil Neumifil RSV-A2 (100 μg, (100 μg, (100 μg, 5 X 10.sup.6 PFU i.n.dosing.) i.n.dosing.) i.n.dosing.) 5 Neumifil RSV-A2 Neumifil Neumifil (100 μg, 5 X 10.sup.6 PFU (100 μg, (100 μg, i.n.dosing.) i.n.dosing.) i.n.dosing.) 6 RSV-A2 Neumifil Neumifil 5 X 10.sup.6 PFU (100 μg, (100 μg, i.n.dosing.) i.n.dosing.)
Clinical Evaluation
[0231] Clinical signs for each animal were recorded once a day from Day −3. These included details on piloerection, respiration, activity, body posture, ocular/nasal discharge, body condition and ataxia. These variables were scored with the following severity bands: [0232] 0.—Normal [0233] 1.—Mild [0234] 2.—Laboured [0235] 3.—Severe (Cull point)
[0236] Daily measurement of each animal's body weight was also recorded from Day −3.
[0237] Animals showing two or more of any of the limiting clinical signs (based on Home Office guidelines) equivalent to the protocol severity limit, were removed from the study and were culled by a schedule 1 method (cervical dislocation) at the establishment. Where an animal reached the limit of either or both of the first two signs with or without any other signs, it was removed from the study and culled by a schedule 1 method at the establishment.
[0238] Body weight loss greater than 20% of the highest measured individual body weight. [0239] Food and water consumption less than 40% of normal for 3 days or anorexia (total inappetence for 72 hrs). [0240] Marked piloerection with other signs of dehydration such as skin tenting. [0241] Unresponsive to activity and provocation. [0242] Hunched persistently (frozen). [0243] Distressed—persistent vocalization. [0244] Oculo-nasal discharge persistent and copious. [0245] Laboured respiration. [0246] Persistent tremors. [0247] Persistent convulsions.
[0248] In this study, no animals were removed from the study on grounds of welfare issues.
Sample Collection
[0249] 4 days after infection, all animals were overdosed intraperitoneally with pentobarbitone, and blood samples were collected by venepuncture into Eppendorf-tubes (0.5 mL). Each sample was mixed gently and kept at room temperature for 30 min to allow clotting, before centrifugation (1500 rpm, 10 min at 4° C.) to prepare the serum. 2 aliquots (50 μL) of each sample were stored at −80° C. Immediately after collecting the blood, the trachea was isolated by a midline incision in the neck and separation of the muscle layers. A small incision was made into the trachea and a plastic cannula was inserted and secured in place with a suture. The airway was then lavaged by flushing out the lungs using 1 mL of phosphate buffered saline. This procedure was then repeated until the recovered volume was 1.6 mL. The isolated BALF was then be centrifuged at 1500 rpm for 10 mins at 4° C. and the supernatant was aliquoted (400 μL) at −80° C. for future cytokine analysis. The cell pellets were then re-suspended in 0.8 mL of 0.2% w/v NaCl to induce haemolysis of any erythrocytes. After isotonization with the same volume of 1.6% w/v NaCl, the BAL cells were analysed for total and differential numbers.
[0250] Total and differential cell counts of the BAL fluid samples were measured using a XT-2000iV analyser (Sysmex). Results are expressed as cells/mL (total and differential). Cell types differentially classified will be neutrophils, eosinophils or mononuclear cells (macrophages and lymphocytes).
Lung Tissue Removal
[0251] Following BALF collection, the left and right lung lobes were removed and separated from each animal and homogenised in the volume of ×10 gram-lung weight (if 0.11 g, use 1.1 mL) of ice-cold Dulbecco's modified Eagles medium (DMEM containing 1% w/v BSA and 25% w/v sucrose) for 2×20 second bursts. The homogenate was transferred into a sterile tube and spun at 4° C. at 2000 rpm for 5 minutes. The clarified homogenate was then transferred to a chilled cryovial and snap frozen in liquid nitrogen and stored at −80° C.
Plaque Assay
[0252] HEp2 cells were grown in 24-well plates prior to infection in DMEM containing 10% v/v FBS until they attain 100% confluency. Lung homogenates were thawed out at room temperature and ten-fold serial dilutions were prepared in serum-free DMEM. The growth medium from HEp2 cells was aspirated and replaced with 300 μL of serially diluted lung homogenate (along with stock RSV only positive control) and left to infect at 37° C./5% CO.sub.2 for four hours. The infectious media was then aspirated and replaced with 500 μL Plaque Assay Overlay (1% w/v methylcellulose in MEM, 2% v/v FBS, 1% w/v pen/strep, 0.5 μg/ml amphotericin B), and left for 7 days at 37° C./5% CO.sub.2. Cells were fixed with ice-cold methanol for 10 minutes after which they were washed twice with sterile PBS. Anti-RSV F-protein antibody [2F7] was diluted to a 1:150 concentration in blocking buffer (5% w/v powdered milk (Marvel) in 0.05% v/v PBS-Tween 20) and 150 μL were added to cells for 2 hours at room temperature with shaking. Cells were washed 2× using PBS before 150 μl of secondary antibody (goat anti-mouse/HRP conjugate) diluted 1:400 in blocking buffer were added to cells for 1 hour at room temperature, with shaking. The secondary antibody solution was removed and cells were washed twice with PBS before the metal-enhanced development substrate DAB will be prepared in ultra-pure water (according to manufacturer's instructions). Each well received 150 μL of development substrate until plaques are visible. Plaques were counted by eye and confirmed using light microscopy, allowing the calculation of plaque-forming units per mL.
Biomarker Analysis
[0253] Cytokine levels (see below for details of cytokines evaluated) of BALF supernatant were measured in duplicate using magnetic multiplex assays as per the manufacturers' instructions. Levels were measured using a Magpix system (Luminex Corp.)
[0254] Data are reported as cytokine (pg/mL), mean±S.E.M. (standard error of the mean).
TABLE-US-00022 Mouse cytokine magnetic 23 plex panel (Biotechne) GM-CSF IFN-γ IL-1β IL-2 IL-4 IL-5 IL-6 IL-10 IL-12p40/p70 TNFα IL-1α IL-13 IL-17 IP-10 KC MCP-1 G-CSF MIP-1α VEGF RANTES MIP-2 MIP-1β IL-33
Data Analysis
[0255] Data are reported as total and differential number of cells per mL of BALF, cytokine concentration (pg/mL) or plaque forming units (pfu) per treatment group, ±(standard error of the mean).
[0256] Inter-group deviations were statistically analyzed by a one-way analysis of variance (ANOVA). In the case of significant difference in the mean values among the different levels of treatment, comparisons versus the vehicle group will be carried out using the Dunnett's test. In case the equal variance test fails, a Kruskal-Wallis one-way analysis of variance on ranks followed by a Dunn's test will be proposed. p<0.05 were considered statistically significant.
CONCLUSIONS
[0257] Prophylactic treatment with Neumifil (HEX17) in RSV-A2 challenged mice resulted in a significant protective effect as evidenced by a reduction in lung tissue viral load. A strong effect was seen in mice which received a regimen of three doses of Neumifil on day 3, day 1 and 1 hour pre-challenge. Also, mice that received a single prophylactic dose 1 hour pre-challenge showed a statistically significant reduction in viral load. Mice that did not receive prophylactic treatment but were only treated post-challenge also showed a statistically significant reduction in lung tissue viral load albeit less than mice that received prophylactic treatment.
[0258] RSV-A2 infection in mice resulted in a strong immune response evidenced by changes in BAL fluid cell counts (total cell count, neutrophils and lymphocytes) and cytokines measured in BAL fluid. Groups of mice treated with Neumifil showed statistically significant improvements in a number of immune parameters; these results correlated well with the observed reductions in lung tissue viral loads.