(AZA)PYRIDOPYRAZOLOPYRIMIDINONES AND INDAZOLOPYRIMIDINONES AND THEIR USE
20180344739 · 2018-12-06
Inventors
- Jorma HAßFELD (Düsseldorf, DE)
- Tom Kinzel (Düsseldorf, DE)
- Johannes KÖBBERLING (Neuss, DE)
- Yolanda Cancho-Grande (Leverkusen, DE)
- Kristin Beyer (Mainz, DE)
- Susanne RÖHRIG (Hilden, DE)
- Maria KÖLLNBERGER (Velbert, DE)
- Michael Sperzel (Kierspe, DE)
- Nils Burkhardt (Velbert, DE)
- Karl-Heinz Schlemmer (Wuppertal, DE)
- Christian Stegmann (Berlin, DE)
- Joachim Schuhmacher (Wuppertal, DE)
- Matthias Werner (Wuppertal, DE)
- Manuel Ellermann (Wuppertal, DE)
Cpc classification
A61P7/04
HUMAN NECESSITIES
A61K31/519
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
A61P7/00
HUMAN NECESSITIES
International classification
A61K31/519
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
Abstract
The present application relates to novel substituted (aza)pyridopyrazolopyrimidinones and indazolopyrimidinones, to processes for their preparation, the compounds for use alone or in combinations in a method for the treatment and/or prophylaxis of diseases, in particular for the treatment and/or prophylaxis of acute and recurrent bleeding in patients with or without underlying hereditary or acquired bleeding disorders, wherein the bleeding is associated with a disease or medical intervention selected from the group consisting of menorrhagia, postpartum hemorrhage, hemorrhagic shock, trauma, surgery, transplantation, stroke, liver diseases, hereditary angioedema, nosebleed, and synovitis and cartilage damage following hemarthrosis.
Claims
1-13. (canceled)
14. A method of prophylaxis of bleeding in a human or animal, the method comprising administering an effective amount of a compound of a formula (I-A) ##STR00339## in which R.sup.1 is selected from hydrogen and C.sub.1-C.sub.4 alkyl; X.sup.1 is selected from nitrogen and CR.sup.2; X.sup.2 is selected from nitrogen and CR.sup.3; X.sup.3 is selected from nitrogen and CR.sup.4; X.sup.4 is selected from nitrogen and CR.sup.5; with a proviso that 0, 1 or 2 of X.sup.1 to X.sup.4 are nitrogen; and R.sup.2, R.sup.3, R.sup.4, and R.sup.5 are independently from each other selected from hydrogen, halogen, C.sub.1-C.sub.4 alkyl, C.sub.1-C.sub.4 alkenyl, C.sub.1-C.sub.4 haloalkyl, C.sub.1-C.sub.4 alkoxy, C.sub.1-C.sub.4 haloalkoxy, cyano, amino, nitro, mono- or dialkylamino, hydroxy, thiol, carboxyl, C.sub.3-C.sub.7 cycloalkyl, 5 to 6 membered heteroaryl, the 5 to 6 membered heteroaryl being optionally substituted with one, two, or three substituents selected from C.sub.1-C.sub.4 alkyl, and phenyl, the phenyl being optionally substituted with one, two, or three substituents selected from halogen, C.sub.1-C.sub.4 alkyl, C.sub.1-C.sub.4 haloalkyl, C.sub.1-C.sub.4 alkoxy, and C.sub.1-C.sub.4 haloalkoxy, or a group of a formula selected from CONR.sup.7R.sup.8, NHCOR.sup.9, COOR.sup.9, COR.sup.9, SO.sub.2R.sup.10, SO.sub.2NR.sup.11R.sup.12, SR.sup.10, CH.sub.2CN, CH.sub.2NR.sup.11R.sup.12, CH.sub.2OR.sup.10, wherein R.sup.7 and R.sup.8 independently from each other represent hydrogen, C.sub.1-C.sub.4 alkyl, C.sub.6 aryl, and 5-6 membered heteroaryl; R.sup.9 represents, C.sub.1-C.sub.4 alkyl, C.sub.6 aryl, and 5-6 membered heteroaryl; R.sup.10 represents C.sub.1-C.sub.4 alkyl; R.sup.11 and R.sup.12 independently from each other represent hydrogen, and C.sub.1-C.sub.4 alkyl; with a proviso that zero, one, two, or three of R.sup.2 to R.sup.5 are different from hydrogen, and salts thereof.
15. The method of claim 14, wherein in the compound of the formula (I-A): R.sup.1 is selected from hydrogen and C.sub.1-C.sub.4 alkyl; X.sup.1 is selected from nitrogen and CR.sup.2; X.sup.2 is selected from nitrogen and CR.sup.3; X.sup.3 is selected from nitrogen and CR.sup.4; X.sup.4 is selected from nitrogen and CR.sup.5; with a proviso that 0, 1 or 2 of X.sup.1 to X.sup.4 are nitrogen; and R.sup.2, R.sup.3, R.sup.4, and R.sup.5 are independently from each other selected from hydrogen, halogen, C.sub.1-C.sub.4 alkyl, C.sub.1-C.sub.4 alkenyl, C.sub.1-C.sub.4 haloalkyl, C.sub.1-C.sub.4 alkoxy, C.sub.1-C.sub.4 haloalkoxy, cyano, amino, nitro, mono- or dialkylamino, hydroxy, carboxyl, C.sub.3-C.sub.7 cycloalkyl, 5 to 6 membered heteroaryl, the 5 to 6 membered heteroaryl being optionally substituted with one, two, or three substituents selected from C.sub.1-C.sub.4 alkyl, and phenyl, the phenyl being optionally substituted with one, two, or three substituents selected from halogen, C.sub.1-C.sub.4 alkyl, C.sub.1-C.sub.4 haloalkyl, C.sub.1-C.sub.4 alkoxy, and C.sub.1-C.sub.4 haloalkoxy; with a proviso that zero, one, two, or three of R.sup.2 to R.sup.5 are different from hydrogen, and salts thereof.
16. The method of claim 14, wherein in the compound of the formula (I-A): R.sup.1 is selected from hydrogen and methyl; X.sup.1 is CR.sup.2 X.sup.2 is CR.sup.3 X.sup.3 is CR.sup.4 X.sup.4 is CR.sup.5; and R.sup.2, R.sup.3, and R.sup.4, are independently from each other selected from hydrogen and fluorine; R.sup.5 is selected from hydrogen, halogen, C.sub.1-C.sub.4 alkyl, C.sub.1-C.sub.4 haloalkyl, C.sub.1-C.sub.4 alkoxy, C.sub.1-C.sub.4 haloalkoxy, cyano, amino, nitro, dialkylamino, hydroxy, carboxyl, C.sub.3-C.sub.7 cycloalkyl, triazolyl (bonded via N), thiazolyl, thienyl, pyridyl, imidazolyl, pyrrolyl, pyrazolyl (bonded via N or C), the pyrazolyl being optionally substituted with one or two substituents selected from C.sub.1-C.sub.4 alkyl, and phenyl, the phenyl being optionally substituted with one or two substituents selected from halogen, C.sub.1-C.sub.4 alkyl, C.sub.1-C.sub.4 haloalkyl, C.sub.1-C.sub.4 alkoxy, and C.sub.1-C.sub.4 haloalkoxy; with a proviso that zero, one, or two of R.sup.2 to R.sup.5 are different from hydrogen, and salts thereof.
17. The method of claim 14, wherein in the compound of the formula (I-A): R.sup.1 is hydrogen; X.sup.1 is CR.sup.2 X.sup.2 is CR.sup.3 X.sup.3 is CR.sup.4 X.sup.4 is CR.sup.5 R.sup.2 to R.sup.4 are hydrogen, and R.sup.5 is chlorine; and salts thereof.
18. The method of claim 14, wherein the bleeding is associated with a disease or medical intervention selected from the group consisting of: menorrhagia, postpartum hemorrhage, hemorrhagic shock, trauma, surgery, otolaryngological surgery, dental surgery, urinary surgery, prostatic surgery, gynaecological surgery, cardiovascular surgery, and spinal surgery.
19. The method of claim 18, wherein the bleeding is associated with a medical intervention selected from the group consisting of: gynaecological surgery, cardiovascular surgery, and spinal surgery.
20. The method of claim 14, wherein the bleeding is associated with a disease or medical intervention selected from the group consisting of: liver or lung transplantation, stroke, liver diseases, hereditary angioedema, nosebleed, and synovitis and cartilage damage following hemarthrosis.
21. A method of prophylaxis of bleeding in a human or animal, the method comprising administering an effective amount of a compound of a formula (I-B) ##STR00340## in which R.sup.1, X.sup.1, X.sup.2, X.sup.3, and X.sup.4 are as defined in claim 1, and salts thereof.
22. The method of claim 21, wherein in the compound of the formula (I-B): R.sup.1 is selected from hydrogen and C.sub.1-C.sub.4 alkyl; X.sup.1 is selected from nitrogen and CR.sup.2; X.sup.2 is selected from nitrogen and CR.sup.3; X.sup.3 is selected from nitrogen and CR.sup.4; X.sup.4 is selected from nitrogen and CR.sup.5; with a proviso that 0, 1 or 2 of X.sup.1 to X.sup.4 are nitrogen; and R.sup.2, R.sup.3, R.sup.4, and R.sup.5 are independently from each other selected from hydrogen, halogen, C.sub.1-C.sub.4 alkyl, C.sub.1-C.sub.4 alkenyl, C.sub.1-C.sub.4 haloalkyl, C.sub.1-C.sub.4 alkoxy, C.sub.1-C.sub.4 haloalkoxy, cyano, amino, nitro, mono- or dialkylamino, hydroxy, carboxyl, C.sub.3-C.sub.7 cycloalkyl, 5 to 6 membered heteroaryl, the 5 to 6 membered heteroaryl being optionally substituted with one, two, or three substituents selected from C.sub.1-C.sub.4 alkyl, and phenyl, the phenyl being optionally substituted with one, two, or three substituents selected from halogen, C.sub.1-C.sub.4 alkyl, C.sub.1-C.sub.4 haloalkyl, C.sub.1-C.sub.4 alkoxy, and C.sub.1-C.sub.4 haloalkoxy; with a proviso that zero, one, two, or three of R.sup.2 to R.sup.5 are different from hydrogen, and salts thereof.
23. The method of claim 21, wherein in the compound of the formula (I-B): R.sup.1 is selected from hydrogen and methyl; X.sup.1 is CR.sup.2 X.sup.2 is CR.sup.3 X.sup.3 is CR.sup.4 X.sup.4 is CR.sup.5; and R.sup.2, R.sup.3, and R.sup.4, are independently from each other selected from hydrogen and fluorine; R.sup.5 is selected from hydrogen, halogen, C.sub.1-C.sub.4 alkyl, C.sub.1-C.sub.4 haloalkyl, C.sub.1-C.sub.4 alkoxy, C.sub.1-C.sub.4 haloalkoxy, cyano, amino, nitro, dialkylamino, hydroxy, carboxyl, C.sub.3-C.sub.7 cycloalkyl, triazolyl (bonded via N), thiazolyl, thienyl, pyridyl, imidazolyl, pyrrolyl, pyrazolyl (bonded via N or C), the pyrazolyl being optionally substituted with one or two substituents selected from C.sub.1-C.sub.4 alkyl, and phenyl, the phenyl being optionally substituted with one or two substituents selected from halogen, C.sub.1-C.sub.4 alkyl, C.sub.1-C.sub.4 haloalkyl, C.sub.1-C.sub.4 alkoxy, and C.sub.1-C.sub.4 haloalkoxy; with a proviso that zero, one, or two of R.sup.2 to R.sup.5 are different from hydrogen, and salts thereof.
24. The method of claim 21, wherein in the compound of the formula (I-B): R.sup.1 is hydrogen; X.sup.1 is CR.sup.2 X.sup.2 is CR.sup.3 X.sup.3 is CR.sup.4 X.sup.4 is CR.sup.5 R.sup.2 to R.sup.4 are hydrogen, and R.sup.5 is chlorine; and its salts thereof.
25. The method of claim 21, wherein the bleeding is associated with a disease or medical intervention selected from the group consisting of menorrhagia, postpartum hemorrhage, hemorrhagic shock, trauma, surgery, otolaryngological surgery, dental surgery, urinary surgery, prostatic surgery, gynaecological surgery, cardiovascular surgery, and spinal surgery.
26. The method of claim 25, wherein the bleeding is associated with a medical intervention selected from the group consisting of gynaecological surgery, cardiovascular surgery, and spinal surgery.
27. The method of claim 21, wherein the bleeding is associated with a disease or medical intervention selected from the group consisting of: liver or lung transplantation, stroke, liver diseases, hereditary angioedema, nosebleed, and synovitis and cartilage damage following hemarthrosis.
Description
EXPLANATION OF THE FIGURES
[0190]
[0191]
[0192]
[0193] The compounds of formula (I-A) or (I-B) according to the invention have useful pharmacological properties and can be employed for the prevention and treatment of disorders in humans and animals.
[0194] The compounds of formula (I-A) or (I-B) according to the invention open up a further treatment alternative and are therefore an enrichment of pharmacy.
[0195] The compounds of formula (I-A) or (I-B) according to the invention bring about an inhibition of clot lysis (fibrinolysis), lead to an increase in clot stability (clot firmness) and thereby to a reduction of bleeding, re-bleeding and blood loss. These effects are due to direct inhibition of plasminogen, the central precursor of plasmin, a potent serine protease involved in the dissolution of fibrin blood clots.
[0196] The compounds of formula (I-A) or (I-B) according to the invention are suitable for the treatment and/or prophylaxis of acute and recurrent bleeding in patients with or without underlying hereditary or acquired bleeding disorders. The compounds of formula (I-A) or (I-B) according to the invention are also suitable for the treatment and/or prophylaxis of acute and recurrent bleeding in patients with or without underlying hereditary or acquired hemostatic disorders. The compounds of formula (I-A) or (I-B) according to the invention are also suitable for the treatment and/or prophylaxis of acute and recurrent bleeding in patients with or without underlying hereditary rare bleeding disorders. The compounds of formula (I-A) or (I-B) according to the invention are also suitable for the treatment and/or prophylaxis of hereditary or acquired bleeding disorders, hereditary or acquired hemostatic disorders, and rare bleeding disorders.
[0197] Within the meaning of the present invention, the term underlying hereditary or acquired bleeding disorders comprises von Willebrand's disease, platelet disorders/dysfunctions like Glantzmann's thrombasthenia and thrombocytopenia, and vitamin K deficiency, PAI-1 deficiency, mild and moderate hemophilia, including hemophilia A (factor VIII deficiency), hemophilia B (factor IX deficiency), and hemophilia C (factor XI deficiency), symptomatic carriers of hemophilia and other hereditary bleeding disorders, autoimmune disorders that lead to the formation of antibodies against the coagulation factor, blood cancers, bone marrow diseases, infections, kidney failure, liver disease, medications, medications, including heparin, low molecular weight heparin, and coumarin derivatives, like warfarin, accidental injuries and surgical interventions leading to massive blood loss and resulting in a critical reduction in the level of coagulation factors which can lead to additional non-surgical bleeding complications (e.g. coagulopathic bleeding), acquired von Willebrand syndrome (AVWS), characterized by structural or functional defects of von Willebrand factor (VWF) that are secondary to autoimmune, lymphoproliferative or myeloproliferative, malignant, cardiovascular, or other disorders.
[0198] Within the meaning of the present invention, the term mild hemophilia is defined as a level of clotting factor activity of the respective deficient factor of 5% to 50% of the normal level, the term moderate hemophilia is defined as a level of clotting factor activity of the respective deficient factor of 1% to 5% of the normal level.
[0199] Within the meaning of the present invention, the term underlying hereditary or acquired hemostatic disorders is defined as pathological processes resulting in abnormal bleeding or clotting.
[0200] Within the meaning of the present invention, the term underlying hereditary rare bleeding disorders (RBD) is defined as bleeding disorders caused by hereditary disorders, that are less common than e.g. hemophilia A and B or von Willebrand disease. Rare bleeding disorders include deficiency of fibrinogen, prothrombin, factors V, combined factors V+VIII, factor VII, factor X, factor XI or factor XIII.
[0201] The compounds of formula (I-A) or (I-B) according to the invention can be used in a wide range of hemorrhagic conditions like upper gastrointestinal bleeding, hemorrhages caused by antifibrinolytics, and gynecological bleeding indications including menorrhagia (heavy menstrual bleeding, HMB), placental bleeding, postpartum hemorrhage and conisation of the cervix.
[0202] Within the meaning of the present invention, menorrhagia (heavy menstrual bleeding, HMB) is defined as menstrual blood loss of 60 ml or more per cycle, for example 60 to 80 ml per cycle, in particular more than 80 ml per cycle. Also within the meaning of the present invention and according to National Institute for Clinical Excellence (NICE) guidelines, menorrhagia is defined for clinical purposes as excessive menstrual blood loss which interferes with the woman's physical, emotional, social and material quality of life, and which can occur alone or in combination with other symptoms.
[0203] In particular, the compounds of formula (I-A) or (I-B) according to the invention can be used in menorrhagia (heavy menstrual bleeding, HMB) caused by underlying bleeding disorders, for example hereditary or acquired bleeding disorders, such as von Willebrand's disease, platelet disorders/dysfunctions like Glantzmann's thrombasthenia and thrombocytopenia, and vitamin K deficiency, PAI-1 deficiency, mild and moderate hemophilia, including hemophilia A (factor VIII deficiency), hemophilia B (factor IX deficiency), and hemophilia C (factor XI deficiency), symptomatic carriers of hemophilia and other hereditary bleeding disorders, such as deficiency of fibrinogen, prothrombin, factors V, combined factors V+VIII, factor VII, factor X, factor XI, or factor XIII, autoimmune disorders, blood cancers, bone marrow diseases, infections, kidney failure, liver disease, medications, including heparin, low molecular weight heparin, and coumarin derivatives, like warfarin, accidental injuries and surgical interventions leading to massive blood loss and resulting in a critical reduction in the level of coagulation factors, and acquired von Willebrand syndrome (AVWS).
[0204] The compounds of formula (I-A) or (I-B) according to the invention can also be used for reducing peri- and postoperative blood loss and rebleeding during and after different surgical interventions, including cardiovascular surgery, including coronary artery bypass surgery, spinal surgery, trauma surgery, transplantation, including orthotopic liver transplantation, and hysterectomy, as well as transfusion requirements in patients with or without underlying bleeding disorders. Moreover, the compounds of formula (I-A) or (I-B) according to the invention can be used for the prevention of recurrence of bleeding in patients after elective minor surgery like prostatic surgery including prostatectomy and transurethral prostatic surgery, gynaecological surgery, urinary surgery, otolaryngological (ENT) surgery including tonsillectomy, and adenoidectomy, oral surgery, and dental surgery, in patients with or without underlying hereditary or acquired bleeding disorders.
[0205] The compounds of formula (I-A) or (I-B) according to the invention can also be used for treatment and/or prophylaxis of acute and recurrent bleeding in patients with liver diseases, including patients with end-stage liver diseases in patients with or without underlying bleeding disorders.
[0206] The compounds of formula (I-A) or (I-B) according to the invention can also be used for treatment and/or prophylaxis of acute and recurrent bleeding in patients with trauma and/or traumatic hyphaema, hemorrhagic stroke, acute promyelocytic leukaemia, and to block plasmin-induced proteolysis which may be of biological relevance during athero-thrombosis and inflammatory states, cancer and other diseases in patients with or without underlying hereditary or acquired bleeding disorders.
[0207] The compounds of formula (I-A) or (I-B) according to the invention can also be used for the treatment and/or prophylaxis of hereditary or acquired bleeding disorders in patients including von Willebrand's disease, platelet disorders/dysfunctions like Glantzmann's thrombasthenia and thrombocytopenia, and vitamin K deficiency, PAI-1 deficiency, mild and moderate hemophilia, including hemophilia A (factor VIII deficiency), hemophilia B (factor IX deficiency), and hemophilia C (factor XI deficiency), symptomatic carriers of hemophilia and other hereditary bleeding disorders, such as deficiency of fibrinogen, prothrombin, factors V, combined factors V+VIII, factor VII, factor X, factor XI or factor XIII, autoimmune disorders, blood cancers, bone marrow diseases, infections, kidney failure, liver disease, medications, medications, including heparin, low molecular weight heparin, and coumarin derivatives, like warfarin, accidental injuries and surgical interventions leading to massive blood loss and resulting in a critical reduction in the level of coagulation factors, and acquired von Willebrand syndrome (AVWS).
[0208] The compounds of the present invention can be used either alone as monotherapy or in combination with other therapies to address a bleeding disorder. For instance, co-administration of one or more compounds of the invention with a plasma-derived or recombinant coagulation factor such as factor VIIa, factor VIII, factor IX or desmopressin is believed useful for treating hemophilia.
[0209] The compounds of formula (I-A) or (I-B) according to the invention can also be used for treating synovitis, wherein the synovitis may be associated with cartilage damage and is associated with hemarthrosis in patients with or without underlying hereditary or acquired bleeding disorders.
[0210] The compounds of formula (I-A) or (I-B) according to the invention can also be used for the treatment of nosebleed (epistaxis) caused by trauma or other causes in patients with or without underlying hereditary or acquired bleeding disorders.
[0211] The compounds of formula (I-A) or (I-B) according to the invention can also be used for the treatment and/or prophylaxis of hereditary or acquired bleeding disorders in patients.
[0212] The present invention further relates to the use of the compounds of formula (I-A) or (I-B) according to the invention for the treatment and/or prophylaxis of diseases, in particular the aforementioned diseases.
[0213] An embodiment of the present invention is also a compound of formula (I-A) or (I-B) according to the invention for use in a method for the treatment and/or prophylaxis of diseases.
[0214] An embodiment of the present invention is also a compound of formula (I-A) or (I-B) according to the invention for use in a method for the treatment and/or prophylaxis of acute and recurrent bleeding in patients with or without underlying hereditary or acquired bleeding disorders.
[0215] An embodiment of the present invention is also a compound of formula (I-A) or (I-B) according to the invention for use in a method for the treatment and/or prophylaxis of acute and recurrent bleeding in patients with underlying hereditary or acquired bleeding disorders.
[0216] An embodiment of the present invention is also a compound of formula (I-A) or (I-B) according to the invention for use in a method for the treatment and/or prophylaxis of acute and recurrent bleeding in patients with or without underlying hereditary or acquired bleeding disorders, wherein the bleeding is associated with a disease or medical intervention selected from the group consisting of menorrhagia, postpartum hemorrhage, hemorrhagic shock, trauma, surgery, including otolaryngological, cardiovascular, and spinal surgery, liver or lung transplantation, stroke, liver diseases, hereditary angioedema, nosebleed, and synovitis.
[0217] An embodiment of the present invention is also a compound of formula (I-A) or (I-B) according to the invention for use in a method for the treatment and/or prophylaxis of acute and recurrent bleeding in patients with underlying hereditary or acquired bleeding disorders, wherein the bleeding is associated with a disease or medical intervention selected from the group consisting of menorrhagia, postpartum hemorrhage, hemorrhagic shock, trauma, surgery, including otolaryngological, cardiovascular, and spinal surgery, liver or lung transplantation, stroke, liver diseases, hereditary angioedema, nosebleed, and synovitis.
[0218] An embodiment of the present invention is also a medicament comprising a compound of the formula (I-A) or (I-B) according to the invention in combination with an inert, non-toxic, pharmaceutically suitable auxiliary.
[0219] An embodiment of the present invention is also a medicament comprising a compound of the formula (I-A) or (I-B) according to the invention in combination with a further active compound selected from the group consisting of Factor VIII, Factor IX, Factor VIIa, activated prothrombin complex concentrates (aPCC) or prothrombin complex concentrates (PCCs), -aminocaproic acid, ethamsylate, paraaminobutyl benzoic acid, tranexamic acid, desmopressin, danazol, combined oral contraceptive pills (COCPs), progestin intrauterine system, glucocorticoid receptor agonists, analgesics, and nonsteroidal anti-inflammatory drugs (NSAIDs).
[0220] An embodiment of the present invention is also a medicament comprising a compound of the formula (I-A) or (I-B) according to the invention as described above for the treatment and/or prophylaxis of acute and recurrent bleeding in patients with or without underlying hereditary or acquired bleeding disorders.
[0221] An embodiment of the present invention is also a medicament comprising a compound of the formula (I-A) or (I-B) according to the invention as described above for the treatment and/or prophylaxis of acute and recurrent bleeding in patients with underlying hereditary or acquired bleeding disorders.
[0222] An embodiment of the present invention is also a medicament comprising a compound of the formula (I-A) or (I-B) according to the invention as defined above for the treatment and/or prophylaxis of acute and recurrent bleeding in patients with or without underlying hereditary or acquired bleeding disorders, wherein the bleeding is associated with a disease or medical intervention selected from the group consisting of menorrhagia, postpartum hemorrhage, hemorrhagic shock, trauma, surgery, otolaryngological surgery, dental surgery, urinary surgery, prostatic surgery, gynaecological surgery, cardiovascular surgery, spinal surgery, liver or lung transplantation, stroke, liver diseases, hereditary angioedema, nosebleed, and synovitis and cartilage damage following hemarthrosis.
[0223] An embodiment of the present invention is also a medicament comprising a compound of the formula (I-A) or (I-B) according to the invention as defined above for the treatment and/or prophylaxis of acute and recurrent bleeding in patients with underlying hereditary or acquired bleeding disorders, wherein the bleeding is associated with a disease or medical intervention selected from the group consisting of menorrhagia, postpartum hemorrhage, hemorrhagic shock, trauma, surgery, otolaryngological surgery, dental surgery, urinary surgery, prostatic surgery, cardiovascular surgery, spinal surgery, liver or lung transplantation, stroke, liver diseases, hereditary angioedema, nosebleed, and synovitis and cartilage damage following hemarthrosis.
[0224] An embodiment of the present invention is also a method for the treatment and/or prophylaxis of acute and recurrent bleeding in patients with or without underlying hereditary or acquired bleeding disorders in humans and animals using an effective amount of at least one compound of the formula (I-A) or (I-B) according to the invention or a medicament comprising a compound of the formula (I-A) or (I-B) according to the invention as defined above.
[0225] An embodiment of the present invention is also a method for the treatment and/or prophylaxis of acute and recurrent bleeding in patients with underlying hereditary or acquired bleeding disorders in humans and animals using an effective amount of at least one compound of the formula (I-A) or (I-B) according to the invention or a medicament comprising a compound of the formula (I-A) or (I-B) according to the invention as defined above.
[0226] An embodiment of the present invention is also a method for the treatment and/or prophylaxis of acute and recurrent bleeding in patients with or without underlying hereditary or acquired bleeding disorders in humans and animals using an effective amount of at least one compound of the formula (I-A) or (I-B) according to the invention or a medicament comprising a compound of the formula (I-A) or (I-B) according to the invention as defined above, wherein the bleeding is associated with a disease or medical intervention selected from the group consisting of menorrhagia, postpartum hemorrhage, hemorrhagic shock, trauma, surgery, otolaryngological surgery, dental surgery, urinary surgery, prostatic surgery, cardiovascular surgery, spinal surgery, liver or lung transplantation, stroke, liver diseases, hereditary angioedema, nosebleed, and synovitis and cartilage damage following hemarthrosis.
[0227] An embodiment of the present invention is also a method for the treatment and/or prophylaxis of acute and recurrent bleeding in patients with underlying hereditary or acquired bleeding disorders in humans and animals using an effective amount of at least one compound of the formula (I-A) or (I-B) according to the invention or a medicament comprising a compound of the formula (I-A) or (I-B) according to the invention as defined above, wherein the bleeding is associated with a disease or medical intervention selected from the group consisting of menorrhagia, postpartum hemorrhage, hemorrhagic shock, trauma, surgery, otolaryngological surgery, dental surgery, urinary surgery, prostatic surgery, cardiovascular surgery, spinal surgery, liver or lung transplantation, stroke, liver diseases, hereditary angioedema, nosebleed, and synovitis and cartilage damage following hemarthrosis.
[0228] The efficacy of the compounds of formula (I-A) and (I-B) according of the invention for the treatment and/or prophylaxis of hereditary or acquired bleeding disorders, and of acute and recurrent bleeding in patients with or without underlying hereditary or acquired bleeding disorders, wherein the bleeding is associated with a disease or medical intervention selected from the group consisting of menorrhagia, postpartum hemorrhage, hemorrhagic shock, trauma, surgery, otolaryngological surgery, dental surgery, urinary surgery, prostatic surgery, cardiovascular surgery, spinal surgery, liver or lung transplantation, stroke, liver diseases, hereditary angioedema, nosebleed, and synovitis and cartilage damage following hemarthrosis, can be demonstrated for example by a reduction in blood loss (quantitative and laboratory values), by a shortened duration of bleeding, by an increased clot firmness, by a lower incidence of recurrent bleeding, by an improved quality of life, which may in the case of menorrhagia be determined by the Menorrhagia Impact Questionnaire, the number of medical visits, and/or by improved compliance due to less frequent dosing as compared to e.g. lysine analogs, including tranexamic acid and -aminocaproic acid.
[0229] The compound of formula (I-A) or (I-B) need not be, but is optionally administered with one or more agents currently used to prevent or treat the disorder in question. The effective amount of such other agents depends on the amount of compound of the invention present, the type of disorder or treatment.
[0230] These are generally used in the same dosages and with administration routes as used hereinbefore or about from 1 to 99% of the heretofore employed dosages. The present invention further relates to medicaments containing at least one of the compounds of formula (I-A) or (I-B) according to the invention and one or more further active substances, in particular for the treatment and/or prophylaxis of the aforementioned diseases. As suitable combination active substances, we may mention for example and preferably:
[0231] Factor VIII, Factor IX, Factor VIIa, activated prothrombin complex concentrates (aPCC) or prothrombin complex concentrates (PCCs), -aminocaproic acid, ethamsylate, paraaminobutyl benzoic acid, tranexamic acid, desmopressin, danazol, combined oral contraceptive pills (COCPs), progestin intrauterine systems, glucocorticoid receptor agonists, analgesics, and nonsteroidal anti-inflammatory drugs (NSAIDs).
[0232] In an embodiment of the invention, the compounds of formula (I-A) or (I-B) according to the invention are administered in a combination with the coagulation factor commonly known as Factor VIII, any derivatives, fragments, muteins or conjugates thereof.
[0233] In an embodiment of the invention, the compounds of formula (I-A) or (I-B) according to the invention are administered in a combination with the coagulation factor commonly known as Factor IX, any derivatives, fragments, muteins or conjugates thereof.
[0234] In an embodiment of the invention, the compounds of formula (I-A) or (I-B) according to the invention are administered in a combination with the coagulation factor commonly known as Factor VIIa, any derivatives, fragments, muteins or conjugates thereof.
[0235] In an embodiment of the invention, the compounds of formula (I-A) or (I-B) according to the invention are administered in a combination with activated prothrombin complex concentrates (aPCCs) or prothrombin complex concentrates (PCCs).
[0236] In an embodiment of the invention, the compounds of formula (I-A) or (I-B) according to the invention are administered in a combination with antifibrinolytic agents such as, by way of example and preferably, -aminocaproic acid, ethamsylate, paraaminobutyl benzoic acid, and tranexamic acid.
[0237] In an embodiment of the invention, the compounds of formula (I-A) or (I-B) according to the invention are administered in a combination with desmopressin.
[0238] In an embodiment of the invention, the compounds of formula (I-A) or (I-B) according to the invention are administered in a combination with danazol.
[0239] In an embodiment of the invention, the compounds of formula (I-A) or (I-B) according to the invention are administered in combination with combined oral contraceptive pills (COCPs) such as, by way of example and preferably, combinations of an estrogen, for example the synthetic estrogen ethinylestradiol or the natural estrogens estradiol and estradiolderivatives, preferably estradiolester, such as estradiolvalerate and estradiolhydrate, and a gestagen for example progesterone, trimegestone, medroxyprogesterone acetate, megestrol acetate, cyproterone acetate, chlormadinone acetate, nestorone, levonorgestrel, norgestimate, desogestrel, ethonogestrel (3-Ketodesogestrel), nomegestrol acetate (NOMAC), norethisterone acetate (NETA), drospirenone, gestodene, dienogest, norethindrone acetate, danazole, norgestrel, and tanaproget.
[0240] In an embodiment of the invention, the compounds of formula (I-A) or (I-B) according to the invention are administered in combination with intrauterine devices, including progestine impregnated intrauterine devices, e.g. LNG-IUS levonorgestrel intrauterine system.
[0241] In an embodiment of the invention, the compounds of formula (I-A) or (I-B) according to the invention are administered in combination with a glucocorticoid receptor agonist, such as, by way of example and preferably, cortisol, cortisone, hydrocortisone, prednisone, methyl-prednisolone, prednylidene, deflazacort, fluocortolone, triamcinolone, dexamethasone or betamethasone.
[0242] In an embodiment of the invention, the compounds of formula (I-A) or (I-B) according to the invention are administered in combination with nonsteroidal anti-inflammatory drugs (NSAIDs), such as by way of example and preferably acetylsalicylic acid, diclofenac, flurbiprofen, ibuprofen, indomethacin, mefenamic acid, meclofenamic acid, and naproxen.
[0243] In an embodiment of the invention, the compounds of formula (I-A) or (I-B) according to the invention are administered in combination with analgesics, such as by way of example and preferably, acetaminophen, acetanilide, aminobenzoic acid, antipyrine, calcium or choline salicylate, codeine, phenatecin, phenyltoloxamine citrate, salicylamide, sodium salicylate, and sodium para-aminobenzoate.
[0244] An embodiment of the invention is also a medicament, comprising a compound of the formula (I-A) or (I-B) as defined above in combination with a further active compound selected from the group consisting of Factor VIII, Factor IX, Factor VIIa, activated prothrombin complex concentrates (aPCC) or prothrombin complex concentrates (PCCs), -aminocaproic acid, ethamsylate, paraaminobutyl benzoic acid, tranexamic acid, desmopressin, danazol, hormonal treatments, including combined oral contraceptive pills (COCPs), progestin intrauterine system, glucocorticoid receptor agonists, analgesics, and nonsteroidal anti-inflammatory drugs (NSAIDs).
[0245] An embodiment of the invention is also a medicament as defined above for the treatment and/or prophylaxis of hereditary or acquired bleeding disorders, trauma, surgery, stroke, menorrhagia, including heavy menstrual bleeding in women with underlying bleeding disorders, postpartum hemorrhage, liver diseases, and hereditary angioedema.
[0246] An embodiment of the invention is also a method for the treatment and/or prophylaxis of hereditary or acquired bleeding disorders, trauma, surgery, stroke, menorrhagia, including heavy menstrual bleeding in women with underlying bleeding disorders, postpartum hemorrhage, liver diseases, and hereditary angioedema in humans and animals using an effective amount of at least one compound of the formula (I-A) or (I-B) as defined above or a medicament as defined above.
[0247] The present invention further relates to medicaments that contain at least one compound of formula (I-A) or (I-B) according to the invention, usually together with one or more inert, non-toxic, pharmaceutically suitable auxiliaries, and use thereof for the aforementioned purposes.
[0248] The compounds of formula (I-A) or (I-B) according to the invention may be effective after systemic and/or local administration. For this purpose they can be applied in a suitable way, e.g. by oral, parenteral, pulmonary, nasal, sublingual, lingual, buccal, rectal, dermal, transdermal, conjunctival, or otic administration or as implant or stent.
[0249] For these routes of application, the compounds of formula (I-A) or (I-B) according to the invention can be administered in suitable dosage forms.
[0250] Dosage forms functioning according to the prior art, for rapid and/or modified release of the compounds according to the invention, which contain the compounds of formula (I-A) or (I-B) according to the invention in crystalline and/or amorphized and/or dissolved form, e.g. tablets (uncoated or coated tablets, for example with enteric coatings or coatings with delayed dissolution or insoluble coatings, which control the release of the compound formula (I-A) or (I-B) according to the invention), tablets or films/wafers that disintegrate rapidly in the oral cavity, films/lyophilizates, capsules (for example hard or soft gelatin capsules), sugar-coated pills, granules, pellets, powders, emulsions, suspensions, aerosols or solutions, are suitable for oral administration.
[0251] Parenteral administration can take place avoiding an absorption step (e.g. intravenous, intraarterial, intracardiac, intraspinal or intralumbar) or including absorption (e.g. intramuscular, subcutaneous, intracutaneous, percutaneous or intraperitoneal). Injection and infusion preparations in the form of solutions, suspensions, emulsions, lyophilizates or sterile powders are suitable, among others, as dosage forms for parenteral application. Intravenous administration can take place for example by bolus administration or by continuous infusion.
[0252] Inhaled pharmaceutical forms (including powder inhalers, nebulizers), nasal drops, nasal solutions or nasal sprays, tablets, films/wafers or capsules for lingual, sublingual or buccal application, suppositories, ear or eye preparations, vaginal capsules, aqueous suspensions (lotions, shaking mixtures), lipophilic suspensions, ointments, creams, transdermal therapeutic systems (e.g. patches), milk, pastes, foams, dusting powders, implants or stents for example are suitable for other routes of administration.
[0253] In one embodiment, the compounds of formula (I-A) or (I-B) according to the invention can be administered in the form of nasal drops, nasal solutions or nasal sprays for the treatment and/or prophylaxis of acute and recurrent nosebleed in patients, in particular in patients with underlying hereditary or acquired bleeding disorders.
[0254] In one embodiment, the compounds of formula (I-A) or (I-B) according to the invention can be administered in the form of patches soaked with the compounds of formula (I-A) or (I-B) according to the invention and applied to the wound for the treatment and/or prophylaxis of acute and recurrent bleeding in patients, in particular in patients with underlying hereditary or acquired bleeding disorders.
[0255] In one embodiment, the compounds of formula (I-A) or (I-B) according to the invention are administered intra-muscular, rectal or transvaginal for the treatment and/or prophylaxis of acute and recurrent bleeding in patients with trauma and other forms of acute bleeding, in particular in patients with underlying hereditary or acquired bleeding disorders.
[0256] In one embodiment, the compounds of formula (I-A) or (I-B) according to the invention are administered in form of a swish and swallow or a lozenge for the treatment and/or prophylaxis of acute and recurrent mouth bleeding in patients, in particular in patients with underlying hereditary or acquired bleeding disorders. A swish and swallow route of administration is defined as the administration of a liquid substance to the oral mucosa by swishing the drug inside the mouth for a certain amount of time then allowed to be swallowed. The drug action is both topical and systemic.
[0257] The compounds of formula (I-A) or (I-B) according to the invention can also be used in vitro or ex vivo to inhibit fibrinolysis, for example for in vitro/ex vivo assays, to inhibit fibrinolysis in blood and plasma products, to pretreat catheters and other medicinal devices and equipment, for surface coatings or in biological samples.
[0258] The compounds of formula (I-A) or (I-B) according to the invention can be transformed to the aforementioned dosage forms. This can take place in a manner known per se by mixing with inert, non-toxic, pharmaceutically suitable auxiliaries. These auxiliaries include inter alia carriers (for example microcrystalline cellulose, lactose, mannitol), solvents (e.g. liquid polyethylene glycols), emulsifiers and dispersants or wetting agents (for example sodium dodecyl sulphate, polyoxysorbitan oleate), binders (for example polyvinylpyrrolidone), synthetic and natural polymers (for example albumin), stabilizers (e.g. antioxidants such as ascorbic acid), colorants (e.g. inorganic pigments, for example iron oxides) and taste and/or odour correctants.
[0259] An embodiment of the invention are pharmaceutical compositions comprising at least one compound of formula (I-A) or (I-B) according to the invention, preferably together with at least one inert, non-toxic, pharmaceutically suitable auxiliary, and the use of these pharmaceutical compositions for the above cited purposes.
[0260] For the prevention or treatment of disease, the appropriate dosage of a compound of the invention (when used alone or in combination with other agents) will depend on the type of disease to be treated, the type of compound, the severity and course of the disease, whether the compound is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the compound, and the discretion of the attending physician. The compound is suitably administered to the patient at one time or over a series of treatments. Depending on the type and severity of disease, about 0.1 g/kg to 100 mg/kg of the compound is an initial candidate dosage for administration to the patient, whether for example, by one or more separate administrations, or by continuous infusion. A typical daily dosage might range from about 0.1 g/kg to 100 mg/kg or more, depending on the factors mentioned above. For repeated administrations over several days or longer, depending on the condition, the treatment is sustained until a desired suppression of disease symptoms occurs. An initial higher loading dose, followed by one or more lower doses may be administered. However, other dosing regimen may be useful. The progress of this therapy is easily monitored by conventional techniques and assays.
[0261] In general, it has proved advantageous, in the case of parenteral administration, to administer amounts of about 2 to 300 mg/kg body weight every 24 hours to achieve effective results. For oral application, the dosage is about 2 to 600 mg/kg body weight every 24 hours.
[0262] According to a further embodiment, it has proved advantageous, in the case of oral or parenteral administration, to administer amounts in a range of from 0.1 to 300 or from 0.5 to 50 or from 1 to 50 or from 2 to 10 mg/kg body weight every 24 hours to achieve effective results.
[0263] Nevertheless, it may optionally be necessary to deviate from the stated amounts, namely depending on body weight, route of administration, individual response to the active substance, type of preparation and time point or interval when application takes place. Thus, in some cases it may be sufficient to use less than the aforementioned minimum amount, whereas in other cases the stated upper limit must be exceeded. When applying larger amounts, it may be advisable to distribute these in several individual doses throughout the day.
[0264] According to a further embodiment, the compounds of formula (I-A) or (I-B) according to the invention are administered orally once or twice or three times a day. According to a further embodiment, the compounds of formula (I-A) or (I-B) according to the invention are administered orally once or twice a day. According to a further embodiment, the compounds of formula (I-A) or (I-B) according to the invention are administered orally once a day. For the oral administration, a rapid release or a modified release dosage form may be used.
[0265] According to a further embodiment, the compounds of formula (I-A) or (I-B) according to the invention are administered orally once or twice or three times a day on 1 or 2 or 3 or 4 or 5 or 6 or 7 or 8 or 9 or 10 days per month. According to a further embodiment, the compounds of formula (I-A) or (I-B) according to the invention are administered orally once or twice or three times a day on 2 or 3 or 4 or 5 or 6 or 7 or 8 or 9 or 10 consecutive days per month. According to a further embodiment, the compounds of formula (I-A) or (I-B) according to the invention are administered orally once or twice or three times a day on 3 or 4 or 5 or 6 or 7 days per month. According to a further embodiment, the compounds of formula (I-A) or (I-B) according to the invention are administered orally once or twice or three times a day on 3 or 4 or 5 or 6 or 7 consecutive days per month.
[0266] The following practical examples explain the invention. The invention is not limited to the examples.
[0267] The percentages in the following tests and examples are percentages by weight, unless stated otherwise; parts are parts by weight. Proportions of solvents, dilution ratios and concentrations for liquid/liquid solutions refer in each case to the volume.
A. EXAMPLES
Abbreviations and Acronyms
[0268] [] specific rotation value [0269] AcOH acetic acid [0270] Boc tert-butoxycarbonyl [0271] br. broad signal (NMR coupling pattern) [0272] CDI N,N-carbonyldiimidazole [0273] Conc. concentrated [0274] CPhos 2-dicyclohexylphosphino-2,6-bis(N,N-dimethylamino)-1,1-biphenyl [0275] NMR shift in ppm [0276] d doublet (NMR coupling pattern) [0277] DCM dichloromethane [0278] DIPEA diisopropyl ethyl amine [0279] DMAP 4-N,N-dimethylaminopyridine [0280] DMF N,N-dimethylformamide [0281] DMSO dimethylsulfoxide [0282] EDCI N-ethyl-N-(3-dimethylaminopropyl)carbodiimide hydrochloride [0283] ESI electrospray ionisation (MS) [0284] GC-MS gas chromatography coupled to mass spectrometry [0285] HATU 1-[Bis(dimethylamino)methylene]-1H-1,2,3-triazolo[4,5-b]pyridinium 3-oxid hexafluorophosphate [0286] HOBt 1-hydroxybenzotriazole hydrate [0287] HPLC high performance liquid chromatography [0288] LC-MS liquid chromatography coupled to mass spectrometry [0289] m multiplet (NMR coupling pattern) [0290] MS mass spectrometry [0291] MTBE tert-butyl methyl ether [0292] NMR nuclear magnetic resonance [0293] q quartet (NMR coupling pattern) [0294] R.sub.t retention time [0295] RT room temperature [0296] s singlet (NMR coupling pattern) [0297] t triplet (NMR coupling pattern) [0298] TFA trifluoroacetic acid [0299] UV ultraviolet [0300] WL wavelength [0301] XPhos 2-dicyclohexylphosphino-2,4,6-triisopropylbiphenyl
Preparative HPLC
Method 1A
[0302] Column: Chromatorex C18 48 m 10030 5 m, Flow: 50 mL/min, Eluent: A: acetonitrile B: water/0.1% formic acid, Gradient 20% A.fwdarw.90% A
Method 2A
[0303] Column: Xbridge 10030 5 m, Flow: 50 mL/min, Eluent: A: acetonitrile B: water/0.2% ammonia, Gradient 10% A.fwdarw.95% A
LC-MS-Methods:
Method 1B
[0304] Instrument: Waters ACQUITY SQD UPLC system; column: Waters Acquity UPLC HSS T3 1.8 501 mm; eluent A: 1 l water+0.25 ml 99% HCOOH, eluent B: 1 l acetonitrile+0.25 ml 99% HCOOH; gradient: 0.0 min 90% A.fwdarw.1.2 min 5% A.fwdarw.2.0 min 5% A; oven: 50 C.; flow: 0.40 ml/min; UV-detection: 208-400 nm.
Method 2B
[0305] Instrument MS: Waters (Micromass) QM; Instrument HPLC: Agilent 1100 series; column: Agilent ZORBAX Extend-C18 3.050 mm 3.5 m; Eluent A: 1 l water+0.01 mol ammonium carbonate, eluent B: 1 l acetonitrile; gradient: 0.0 min 98% A.fwdarw.0.2 min 98% A.fwdarw.3.0 min 5% A.fwdarw.4.5 min 5% A; Oven: 40 C.; Flow: 1.75 ml/min; UV-detection: 210 nm
Method 3B
[0306] Instrument: Micromass Quattro Premier with Waters UPLC Acquity; Column: Thermo Hypersil GOLD 1.9 501 mm; Eluent A: 1 l Wasser+0.5 ml 50% formic acid, Eluent B: 1 l Acetonitril+0.5 ml 50% formix acid; Gradient: 0.0 min 97% A.fwdarw.0.5 min 97% A.fwdarw.3.2 min 5% A.fwdarw.4.0 min 5% A Oven: 50 C.; Flow: 0.3 ml/min; UV-detection: 210 nm.
Method 4B
[0307] Instrument MS: Waters (Micromass) ZQ; Instrument HPLC: Agilent 1100 Series; Column: Agilent ZORBAX Extend-C18 3.050 mm 3.5-Micron; Eluent A: 1 L water+0.01 mol ammonium carbonate, Eluent B: 1 L acetonitrile; Gradient: 0.0 min 98% A.fwdarw.0.2 min 98% A.fwdarw.3.0 min 5% A.fwdarw.4.5 min 5% A; Oven: 40 C.; Flow: 1.75 ml/min; UV-detection: 210 nm
Method 5B
[0308] Instrument: Waters ACQUITY SQD UPLC system; column: Waters Acquity UPLC HSS T3 1.8 302 mm; eluent A: 1 l water+0.25 ml 99% formic acid, eluent B: 1 l acetonitrile+0.25 ml 99% formic acid; gradient: 0.0 min 90% A.fwdarw.1.2 min 5% A.fwdarw.2.0 min 5% A oven: 50 C.; flow: 0.60 ml/min; UV-detection: 208-400 nm.
Method 6B
[0309] Instrument: Waters ACQUITY SQD UPLC system; column: Waters Acquity UPLC HSS T3 1.8 501 mm; eluent A: 1 l water+0.25 ml 99% formic acid, eluent B: 1 l acetonitrile+0.25 ml 99% formic acid; gradient: 0.0 min 95% A.fwdarw.6.0 min 5% A.fwdarw.7.5 min 5% A oven: 50 C.; flow: 0.35 ml/min; UV-detection: 210-400 nm.
Method 7B
[0310] Instrument MS: Waters (Micromass) QM; Instrument HPLC: Agilent 1100 Series; Column: Agilent ZORBAX Extend-C18 3.050 mm 3.5-Micron; Eluent A: 1 L water+0.01 mol ammonium carbonate, Eluent B: 1 L acetonitrile; Gradient: 0.0 min 98% A.fwdarw.0.2 min 98% A.fwdarw.3.0 min 5% A.fwdarw.4.5 min 5% A; Oven: 40 C.; Flow: 1.75 ml/min; UV-detection: 210 nm.
Method 8B
[0311] Instrument: Agilent MS Quad 6150; HPLC: Agilent 1290; Column: Waters Acquity UPLC HSS T3 1.8 502.1 mm; Eluent A: 1 l water+0.25 ml 99% formic acid, Eluent B: 1 l acetonitrile+0.25 ml 99% formic acid; Gradient: 0.0 min 90% A.fwdarw.0.3 min 90% A.fwdarw.1.7 min 5% A.fwdarw.3.0 min 5% A Oven: 50 C.; Flow: 1.20 ml/min; UV-Detection: 205-305 nm.
Preparative Separation of Diastereomers:
Method 1C
[0312] Phase: Chiracel OD-H, 5 m 25 mm50 mm, eluent: CO.sub.2/methanol 81:19; pressure: 135 bar, temperature eluent: 38 C.; temperature zyklon: 40 C., pressure zyklon: 24 bar, flow: 200 g/min; UV-Detection: 210 nm.
Method 2C
[0313] Phase: Daicel AD-H, 5 m 250 mm20 mm, eluent: iso-hexane/ethanol 7/3; temperature: 25 C.; flow: 20 ml/min; UV-Detection: 230 nm.
Method 3C
[0314] Phase: Daicel Chiralpak AZ-H, 5 m 250 mm20 mm, eluent: iso-hexane/ethanol 6:4; temperature: 25 C.; flow: 15 ml/min; UV-Detection: 220 nm.
Method 4C
[0315] Phase: Daicel Chiralpak AZ-H, 5 m 250 mm30 mm, eluent: iso-hexane/isopropanol 1/1; temperature: 25 C.; flow: 35 ml/min; UV-Detection: 230 nm.
Method 5C
[0316] Phase: Daicel Chiralpak AS-H 5 m 25 mm20 mm; eluent: iso-hexane/ethanol 70:30; temperature: 25 C.; flow: 20 ml/min; UV-Detection: 220 nm.
Preparative Separation of Enantiomers:
Method 1D
[0317] Phase: Daicel Chiralpak IC, 5 m 250 mm20 mm, eluent: iso-hexan/isopropanol 70:30; temperature: 30 C.; flow: 20 ml/min; UV-Detection: 230 nm.
Analytical Separation of Diastereomers:
Method 1E
[0318] Phase: 250 mm4.6 mm Chiracel OD-H 5 m, eluent: methanol, temperature: 35 C., flow: 4 ml/min, UV-Detection: 210 nm
Method 2E
[0319] Phase: 250 mm4.6 mm Daicel Chiralpak AD-H 5 m, eluent: iso-hexane/ethanol 1/1, temperature: 30 C., flow: 1.0 ml/min; UV-Detection: 220 nm
Method 3E
[0320] Phase: 250 mm4.6 mm Daicel Chiralpak AZ-H 5 m, eluent: iso-hexane/ethanol/TFA/H.sub.2O 60%/40%/0.2%/1%, temperature: 40 C., flow: 1.0 ml/min; UV-Detection: 220 nm
Method 4E
[0321] Phase: 250 mm4.6 mm Daicel Chiralpak AZ-H 5 m, eluent: iso-hexane/2-propanol 1/1, temperature: 30 C., flow: 1.0 ml/min; UV-Detection: 220 nm
Method 5E
[0322] Phase: Daicel Chiralpak AS-H 5 m 25 mm4.6 mm; eluent: iso-hexane/ethanol 70:30; temperature: 30 C., flow: 1 ml/min, UV-Detection: 220 nm
Analytical Separation of Enantiomers:
Method 1F
[0323] Phase: 250 mm4.6 mm Daicel Chiralpak AY-H 5 m, eluent: iso-hexan/ethanol 9/1, temperature: 45 C., flow: 1.0 ml/min; UV-Detection: 220 nm
GC-MS-Methods:
Method 1G
[0324] Instrument: Thermo Scientific DSQII, Thermo Scientific Trace GC Ultra; Column: Restek RTX-35MS, 15 m200 m0.33 m; constant Helium flow: 1.20 ml/min; Oven: 60 C.; Inlet: 220 C.; Gradient: 60 C., 30 C./min.fwdarw.300 C. (hold for 3.33 min).
Method 2G
[0325] Instrument: Thermo DFS, Trace GC Ultra; Column: Restek RTX-35, 15 m200 m0.33 m; constant Helium flow: 1.20 ml/min; Oven: 60 C.; Inlet: 220 C.; Gradient: 60 C., 30 C./min.fwdarw.300 C. (hold for 3.33 min).
Other Remarks
Microwave Instrument: Biotage Initiator
Starting Materials and Intermediates
General Procedures
General Procedure 1A: Condensation of (Aza)Aminoindazoles Under Standard Conditions
[0326] A mixture of tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (1 eq) and the corresponding (aza)aminoindazol (1 eq.) in acetonitrile was stirred at 60 C. until HPLC and/or LC-MS indicated complete consumption of the starting material. After evaporating the solvent under vacuo the crude product was dissolved in 1-methoxy-2-propanol and then potassium phosphate (2 eq) was added in to the mixture. The reaction mixture was stirred at 110 C. until complete consumption of the intermediate. The work-up is described individually for each example.
Example 1A
Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate
[0327] ##STR00046##
[0328] To a solution of boc-isonipecotic acid (150 g, 654 mmol) in tetrahydrofuran (2100 mL) was added di-1H-imidazol-1-ylmethanone (159 g, 981 mmol) and N,N-dimethylpyridin-4-amine (40.0 g, 327 mmol) at RT. The mixture was stirred at RT for 15 h (CAUTION: moderate gas evolution). In a second flask, a suspension of potassium 3-ethoxy-3-oxopropanoate (200 g, 1.18 mol) and magnesium dichloride (112 g, 1.18 mol) in tetrahydrofuran (2100 mL) was heated to 50 C. for 15 h. The resulting warm suspension was slowly added to the first flask under extensive stirring. The resulting mixture was stirred at RT for 20 h. Tetrahydrofuran was evaporated in vacuo, water (1500 mL) and ethyl acetate (1500 mL) were added. The mixture was cooled to 10 C. and 3N aqueous HCl was added until pH 1 was achieved. The organic phase was separated, the aqueous phase was extracted with ethyl acetate (1500 mL) and the combined organic phases were washed with 10% aq. NaHCO.sub.3 (750 mL) and 10% aq. NaCl (750 mL), dried over magnesium sulfate, filtered and evaporated in vacuo to yield the title compound (182 g, 505 mmol) in a purity of 83%.
[0329] LC-MS (Method 1B): R.sub.t=1.00 min, MS (ESIPos): m/z=300 [M+H].sup.+
Example 2A
Tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate
[0330] ##STR00047##
[0331] To a solution of 1-(tert-butoxycarbonyl)piperidine-4-carboxylic acid (10 g, 43.6 mmol) and 2,2-dimethyl-1,3-dioxane-4,6-dione (6.9 g, 47.98 mmol) in 100 ml dichloromethane was added 4-dimethylaminopyridin (8.0 g, 65.42 mmol). After cooling the mixture to 0 C. 1-(3-dimethylaminopropyl)-3-ethylcarbodiimide hydrochloride (11.7 g, 61.1 mmol) was added in portions and then the reaction mixture was stirred at RT for 16 h. The mixture was treated with 50 ml of water and then the layers were separated. The organic layer was extracted with HCl 1M, dried over magnesium sulfate, filtered and evaporated under vacuo to yield the title compound (14 g, 86% of theory).
[0332] LC-MS (Method 1B): R.sub.t=1.10 min, MS (ESIPos): m/z=354 [MH].sup.
Example 3A
2-Methylisonicotinic Acid
[0333] ##STR00048##
[0334] To a solution of 2,4-lutidine (280 g, 2.61 mol) in water (3.0 l) at 80 C. was added potassium permanganate (826 g, 5.23 mol) in small portions over 3 h. The reaction mixture was stirred at 80 C. overnight. The mixture was filtered through silica gel and then the filtrate was evaporated under vacuo until a volume of approximately of 20 ml was achieved. Then the solution was treated with HCl 37% (450 ml) until pH 3-4 was achieved. The solution was kept 1 h at 0 C. and then the resulting solid was filtered, washed with water at 0 C. and finally dried under vacuo overnight over phosphorus pentoxide to yield the title product (130 g, 36% of theory).
[0335] LC-MS (Method 3B): R.sub.t=0.20 min, MS (ESIPos): m/z=138 [M+H].sup.+
Example 4A
Methyl 2-methylisonicotinate
[0336] ##STR00049##
[0337] To methanol (1.54 l) at 10 C. was added slowly thionyl chloride (401 g, 3.37 mol) and the solution was stirred 10 minutes at 0 C. Then was added 2-methylisonicotinic acid (154 g, 1.20 mol) and the reaction mixture was stirred at reflux temperature overnight. The mixture was evaporated under vacuo, then diluted in ethyl acetated and finally treated with a 10% sodium hydrogen carbonate aqueous solution until pH 7 was achieved. After separation of the layers the aqueous phase was extracted with ethyl acetate. All collected organic phases were dried over magnesium sulfate, evaporated under dried under vacuo. The crude product was used in the next step without further purification (113.0 g, 48% of theory), 72% purity).
[0338] LC-MS (Method 1B): R.sub.t=0.43 min, MS (ESIPos): m/z=152 [M+H].sup.+
Example 5A
Methyl 2-methylpiperidine-4-carboxylate
[0339] ##STR00050##
[0340] To acetic acid (700 ml) were added methyl 2-methylisonicotinate (79 g, 523 mmol) and platinum (IV) oxide (7.83 g, 34.5 mmol). The mixture was hydrogenated in the autoclave at RT and 20 bar during two days. After this time platinum (IV) oxide (5.00 g, 22.2 mmol) was added again and the mixture was hydrogenated during two days more at RT and 20 bar. After filtration of the catalyst the filtrate was evaporated under vacuo to obtain the title compound in quantitative yield.
[0341] LC-MS (Method 2B): R.sub.t=1.15 min, MS (ESIPos): m/z=158 [M+H].sup.+
Example 6A
()-Cis-1-benzyl 4-methyl 2-methylpiperidine-1,4-dicarboxylate and (+)-Cis-1-benzyl 4-methyl 2-methylpiperidine-1,4-dicarboxylate
[0342] ##STR00051##
[0343] To a solution of methyl 2-methylpiperidine-4-carboxylate (138 g, 394 mmol) in dichloromethane (620 ml) was added N,N-diisopropylethylamine (331 g, 2.56 mol). The mixture was cooled to 0 C. and then benzyl chloroformate (80.6 g, 473 mmol) was added slowly. The reaction mixture was stirred 30 min at RT and then water was added in to the mixture. After separation of the layers the aqueous phase was extracted with dichloromethane and the collected organic layers were washed with water, dried over magnesium sulfate and evaporated. The crude product was purified by silica gel chromatography with petrolether/ethyl acetate 8/2 and finally the stereoisomers were separated by chromatography on chiral phase (Method 1D) to yield the title compounds in enantiomerically pure form. ()-Cis-1-benzyl 4-methyl 2-methylpiperidine-1,4-dicarboxylate: [0344] Yield: (26.7 g, 23% of theory) [0345] HPLC (Method 1F): R.sub.t=14.48 min [0346] [].sup.23.sub.D=54.2 (c 0.9, acetonitrile)
(+)-Cis-1-benzyl 4-methyl 2-methylpiperidine-1,4-dicarboxylate
[0347] Yield: (23.3 g, 20% of theory) [0348] HPLC (Method 1F): R.sub.t=11.21 min [0349] [].sup.23.sub.D=+60.0 (c 0.365, acetonitrile) Example 7A Cis-methyl 2-methylpiperidine-4-carboxylate
##STR00052##
[0350] A solution of ()-cis-1-benzyl 4-methyl 2-methylpiperidine-1,4-dicarboxylate (25.00 g, 85.8 mmol) in ethanol (250 ml) was treated with palladium on charcoal 10% (1.83 g, 1.72 mmol) under hydrogen atmosphere at normal pressure and RT for 16 h. The mixture was filtered through celite and the filtrate was evaporated and dried under vacuo to yield the title compound (13.95 g, 96% of theory).
[0351] LC-MS (Method 2B): R.sub.t=1.15 min, MS (ESIPos): m/z=158 [M+H].sup.+
Example 8A
Cis-1-tert-butyl 4-methyl 2-methylpiperidine-1,4-dicarboxylate
[0352] ##STR00053##
[0353] To a solution of cis-methyl 2-methylpiperidine-4-carboxylate obtained in example 7A (12.95 g, 82.34 mmol) in tetrahydrofuran (250 ml) under argon atmosphere was added di-tert-butyl dicarbonate (21.58 g, 98.88 mmol) and the reaction mixture was stirred at RT overnight. The mixture was evaporated under vacuo and the crude product was dissolved in ethyl acetate and treated with a 10% citric acid aqueous solution. After separation of the layers the organic layer was washed with 10% citric acid aqueous solution, with a saturated aqueous solution of sodium hydrogen carbonate and finally with brine. The organic phase was dried over magnesium sulfate, filtered and evaporated to yield the title compound (27.16 g, 96% of theory), 75% pure according NMR). The crude product was used in the next step without further purification.
[0354] MS (ESIPos): m/z=258 [M+H].sup.+
Example 9A
Cis-1-(tert-butoxycarbonyl)-2-methylpiperidine-4-carboxylic Acid
[0355] ##STR00054##
[0356] To a solution of cis-1-tert-butyl 4-methyl 2-methylpiperidine-1,4-dicarboxylate obtained in example 8A) (27.16 g, 79.16 mmol, 75% purity) in a mixture of tetrahydrofuran (250 ml) and water (125 ml) was added lithium hydroxide (10.1 g, 422 mmol) and the mixture was stirred overnight at RT. The mixture was evaporated under vacuo and was diluted in water and ethyl acetate. After separation of the layers the aqueous phase was treated with HCl 37% until pH 4 was achieved and then was extracted with ethyl acetate, dried over magnesium sulfate, filtered and evaporated under vacuo to yield the title compound (18.4 g, 95% of theory).
[0357] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =12.27 (bs, 1H), 4.07-3.99 (m, 1H), 3.67-3-61 (m, 1H), 3.06-2.98 (m, 1H), 1.89-1.76 (m, 4H), 1.62-1.53 (m, 1H), 1.39 (s, 9H), 1.04 (d, 3H).
Example 10A
()-Cis-tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]-2-methylpiperidine-1-carboxylate
[0358] ##STR00055##
[0359] To a solution of cis-1-(tert-butoxycarbonyl)-2-methylpiperidine-4-carboxylic acid obtained in example 9A (17.3 g, 71.0 mmol) and 2,2-dimethyl-1,3-dioxane-4,6-dione (11.3 g, 78.0 mmol) in dichloromethane (190 ml) was added 4-dimethylaminopyridin (13.1 g, 107 mmol). After cooling the mixture to 0 C., 1-(3-dimethylaminopropyl)-3-ethylcarbodiimide hydrochloride (19.13 g, 100.0 mmol) was added in portions and then the reaction mixture was stirred at RT for 16 h. The mixture was treated with water and then the layers were separated. The organic layer was washed with HCl 1M, dried over magnesium sulfate, filtered and evaporated under vacuo to yield the title compound (20.8 g, 79% of theory).
[0360] LC-MS (Method 1B): R.sub.t=1.16 min, MS (ESIPos): m/z=370 [M+H].sup.+
[0361] [].sup.20=71.36 (c. 0.625, methanol) WL=589 nm
Example 11A
6-Fluoro-1H-pyrazolo[4,3-b]pyridin-3-amine
[0362] ##STR00056##
[0363] To a solution of 3,5-difluoro-2-pyridincarbonitrile (2.00 g 14.3 mmol, 1 eq) in ethanol (36 mL) was 5 added hydrazine hydrate (1.04 mL, 21.4 mmol, 1.5 eq) at RT. The mixture was heated to 70 C. for 15 h. After cooling to RT, the resulting suspension was evaporated. The residue was triturated with ethyl acetate (20 mL), filtered, the residue was washed with ethyl acetate (5 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound 6-fluoro-1H-pyrazolo[4,3-b]pyridin-3-amine (0.56 g, 80% purity, 80% of theory).
[0364] LC-MS (Method 2B): R.sub.t=1.10 min, MS (ESIPos): m/z=153 [M+H].sup.+
[0365] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =11.75 (br. s, 1H), 8.26 (dt, 1H), 7.58 (dd, 1H), 5.47 (br. s, 2H).
Example 12A
4-Ethoxy-1H-indazol-3-amine
[0366] ##STR00057##
[0367] To a solution of 2-ethoxy-6-fluorobenzonitrile (2.00 g, 12.1 mmol, 1 eq) in ethanol (30 mL) was added hydrazine hydrate (0.884 mL, 18.1 mmol, 1.5 eq) at RT. The mixture was heated to 70 C. for 30 h. After cooling to RT, water (20 mL) was added, the mixture was extracted with ethyl acetate (250 mL), the combined organic phases were washed with brine (50 mL), dried over MgSO4, filtered and evaporated in vacuo. The residue was triturated with MTBE (10 mL), filtered and the residue was dried for 16 h at 50 C. in vacuo to yield the title compound 4-ethoxy-1H-indazol-3-amine (1.01 g, 47% of theory).
[0368] LC-MS (Method 2B): R.sub.t=1.76 min, MS (ESIPos): m/z=178 [M+H].sup.+
[0369] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =11.36 (s, 1H), 7.08 (dd, 1H), 6.74 (d, 1H), 6.28 (d, 1H), 4.94 (s, 2H), 4.11 (q, 2H), 1.41 (t, 3H).
Example 13A
7-Bromo-1H-pyrazolo[4,3-c]pyridin-3-amine
[0370] ##STR00058##
[0371] A solution of 3,5-dibromopyridine-4-carbonitrile (2.10 g, 8.02 mmol) and hydrazine hydrate (0.90 g, 17.6 mmol) in ethanol (18 mL) was heated in a microwave at 125 C. for 1 h. The precipitate was collected and washed with a mixture of petrol ether and ethanol to obtain the title compound (1.27 g, 72% of theory).
[0372] LC-MS (Method 1B): R.sub.t=0.37 min, MS (ESIPos): m/z=213 [M+H].sup.+
Example 14A
7-Fluoro-1H-indazol-3-amine
[0373] ##STR00059##
[0374] 2,3-Difluorobenzonitril (1.00 g, 7.19 mmol) was dissolved in ethanol (10 mL) and treated with hydrazine hydrate (0.54 g, 10.7 mmol). After stirring at 70 C. for 16 h, the mixture was cooled to RT and concentrated in vacuo. The residue was dissolved in a mixture of water and ethyl acetate. The aqueous layer was extracted once more with ethyl acetate. The combined organic layers were washed with water and with brine, dried over magnesium sulfate, concentrated in vacuo and dried to yield the title compound (0.98 g, 91% of theory)
[0375] LC-MS (Method 2B): R.sub.t=1.45 min, MS (ESIPos): m/z=152 [M+H].sup.+
Example 15A
1H-Pyrazolo[3,4-c]pyridin-3-amine
[0376] ##STR00060##
[0377] 3-Fluoro-isonicotinonitrile (0.50 g, 4.10 mmol) was dissolved in ethanol (8 mL) and treated with hydrazine hydrate (0.31 g, 6.1 mmol). After stirring at 70 C. for 16 h, the mixture was cooled to RT and concentrated in vacuo and dried to yield the title compound (0.66 g, 100% of theory).
[0378] LC-MS (Method 2B): R.sub.t=0.51 min, MS (ESIPos): m/z=135 [M+H].sup.+
Example 16A
7-(Trifluoromethyl)-1H-indazol-3-amine
[0379] ##STR00061##
[0380] 2-Fluoro-3-(trifluoromethyl)-benzonitrile (1.00 g, 5.29 mmol) was dissolved in ethanol (11 mL) and treated with hydrazine hydrate (0.40 g, 7.9 mmol). After stirring at reflux for 16 h, the mixture was cooled to RT, concentrated in vacuo and dried to yield the title compound (1.07 g, 100% of theory).
[0381] LC-MS (Method 1B): R.sub.t=0.74 min, MS (ESIPos): m/z=202 [M+H].sup.+
Example 17A
Tert-butyl 4-(4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate
[0382] ##STR00062##
[0383] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.50 g, 5.01 mmol, 1 eq), 1H-indazol-3-amine (1.00 g, 7.52 mmol, 1.5 eq) and potassium phosphate (2.13 g, 10.0 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (15 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was neutralized (pH 6-7) by the addition of 1N HCl, diluted with water (60 mL), and extracted with ethyl acetate (2, 100 mL and 50 mL). The combined organic phases were washed with brine (25 mL), dried over sodium sulfate, filtered and evaporated in vacuo. The residue was triturated with acetonitrile (5 mL). The precipitate was filtered, washed with acetonitrile (8 mL) and dried for 2 h at 50 C. in vacuo to give the title compound (239 mg, 13% of theory).
[0384] LC-MS (Method 1B): R.sub.t=0.98 min, MS (ESIPos): m/z=369 [M+H].sup.+
Example 18A
Tert-butyl 4-[2-oxo-9-(trifluoromethyl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0385] ##STR00063##
[0386] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (450 mg, 81% purity, 1.22 mmol, 1 eq), 5-(trifluoromethyl)-1H-indazol-3-amine (245 mg, 1.22 mmol, 1.0 eq) and potassium phosphate (517 mg, 2.43 mmol, 2 eq) were suspended in dioxane (4.3 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 150 C. for 1 h. Another 1 eq of tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate was added and the mixture was heated in a microwave to 150 C. for 1 h. Again, 1 eq of tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate was added and the mixture was heated in a microwave to 150 C. for 1 h. The solvent was evaporated in vacuo and the residue was diluted with water (20 mL), and extracted with ethyl acetate (2, 50 mL and 25 mL). The combined organic phases were dried over sodium sulfate, filtered and evaporated in vacuo. The residue was purified by preparative HPLC (Method 1A). The combined product fractions were neutralized with aqueous ammonium hydroxide and acetonitrile was evaporated in vacuo. The aqueous phase was extracted with ethyl acetate (30 mL), dried over sodium sulfate, filtered and evaporated in vacuo to yield the title compound (47 mg, 9% of theory) as solid.
[0387] LC-MS (Method 1B): R.sub.t=1.17 min, MS (ESIPos): m/z=437 [M+H].sup.+
Example 19A
Tert-butyl 4-(10-chloro-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate
[0388] ##STR00064##
[0389] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (9.11 g, 30.4 mmol, 1.5 eq), 4-chloro-1H-indazol-3-amine (3.4 g, 20.3 mmol, 1 eq) and potassium phosphate (8.61 g, 40.6 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (70 mL) and split to seven 20 mL microwave vials. The vials were capped and the mixture was heated in a microwave to 180 C. for 15 min. Another 1.5 eq of tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate was added in 1-methoxy-2-propanol (2 mL for each vial), and the mixture was heated in a microwave to 180 C. for 15 min again. After cooling to RT, the combined suspensions were evaporated in vacuo, diluted with water (150 mL), neutralized (pH 6) by the addition of 1N HCl, and extracted with ethyl acetate (2, 200 mL). The combined organic phases were washed with water (2100 mL) and brine (50 mL) and evaporated in vacuo. The partially crystalline residue was triturated with ethyl acetate (50 mL). The precipitate was filtered, washed with ethyl acetate (20 mL) and acetonitrile (10 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (2.63 g, 96% purity, 31% of theory).
[0390] LC-MS (Method 1B): R.sub.t=1.12 min, MS (ESIPos): m/z=403 [M+H].sup.+
Example 20A
Tert-butyl 4-(10-fluoro-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate
[0391] ##STR00065##
[0392] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (0.66 g, 2.2 mmol, 1 eq), 4-fluoro-1H-indazol-3-amine (0.50 g, 3.31 mmol, 1.5 eq) and potassium phosphate (0.936 g, 4.41 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (9 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with water (15 mL), neutralized (pH 5-6) by the addition of 1N HCl, and extracted with ethyl acetate (2, 15 mL). The combined organic phases were evaporated in vacuo. The residue was triturated with water (30 mL), filtered, and the residue was resuspended in acetonitrile (30 mL). The precipitate was filtered, washed with acetonitrile (2 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (62 mg, 7% of theory).
[0393] LC-MS (Method 1B): R.sub.t=1.02 min, MS (ESIPos): m/z=387 [M+H].sup.+
Example 21A
Tert-butyl 4-(9-chloro-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate
[0394] ##STR00066##
[0395] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (450 mg, 81% purity, 1.22 mmol, 1 eq), 5-chloro-1H-indazol-3-amine (204 mg, 1.22 mmol, 1.0 eq) and potassium phosphate (517 mg, 2.43 mmol, 2 eq) were suspended in dioxane (4.3 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 150 C. for 1 h. Another 1 eq of tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate was added and the mixture was heated in a microwave to 150 C. for 1 h. The solvent was evaporated in vacuo, the residue was diluted with water (20 mL) and extracted with ethyl acetate (2, 50 mL and 25 mL). The combined organic phases were dried over sodium sulfate, filtered and evaporated in vacuo. The residue was purified by preparative HPLC (Method 1A). The combined product fractions were neutralized with aqueous ammonium hydroxide and acetonitrile was evaporated in vacuo. The aqueous phase was extracted with ethyl acetate (30 mL), dried over sodium sulfate, filtered and evaporated in vacuo to yield the title compound (30 mg, 6% of theory) as solid.
[0396] LC-MS (Method 2B): R.sub.t=1.97 min, MS (ESIPos): m/z=403 [M+H].sup.+
Example 22A
Tert-butyl 4-(8,10-dichloro-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate
[0397] ##STR00067##
[0398] Tert-butyl 4-(4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate (50 mg, 0.136 mmol) and N-chlorosuccinimid (27 mg, 0.204 mmol) were dissolved in DMF (1.5 mL) in a 5 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 50 C. for 30 min. The reaction mixture was purified by preparative HPLC (Method 1A). The combined product fractions were neutralized with aqueous ammonium hydroxide and acetonitrile was evaporated in vacuo. The resulting suspension was filtered, the residue was washed with water (10 ml) and dried for 16 h at 50 C. in vacuo to give the title compound (17.3 mg, 29% of theory).
[0399] LC-MS (Method 1B): R.sub.t=1.22 min, MS (ESIPos): m/z=437 [M+H].sup.+
Example 23A
Tert-butyl 4-(9-fluoro-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate
[0400] ##STR00068##
[0401] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (264 mg, 0.882 mmol, 1 eq), 5-fluoro-1H-indazol-3-amine (200 mg, 1.32 mmol, 1.5 eq) and potassium phosphate (374 mg, 1.76 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (2.6 mL) in a microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with water (20 mL), neutralized (pH 5-6) by the addition of 1N HCl, and extracted with ethyl acetate (215 mL). The combined organic phases were evaporated in vacuo. The residue was triturated with acetonitrile (10 mL). The precipitate was filtered, washed with acetonitrile (2 mL) and dried for 2 h at 50 C. in vacuo to yield the title compound (61.3 mg, 18% of theory).
[0402] LC-MS (Method 1B): R.sub.t=1.02 min, MS (ESIPos): m/z=387 [M+H].sup.+
Example 24A
Tert-butyl 4-(10-methoxy-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate
[0403] ##STR00069##
[0404] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 4-methoxy-1H-indazol-3-amine (363 mg, 2.23 mmol, 1.5 eq) and potassium phosphate (945 mg, 10.2 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (10 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with water (20 mL), neutralized (pH 5-6) by the addition of 1N HCl, and extracted with ethyl acetate (250 mL). The combined organic phases were washed with brine (20 mL), dried over magnesium sulfate, filtered and evaporated in vacuo. The residue was purified by preparative HPLC (Method 1A). The combined product fractions were neutralized with aqueous ammonium hydroxide and acetonitrile was evaporated in vacuo. The resulting suspension was filtered, the residue was washed with water (10 ml) and dried for 16 h at 50 C. in vacuo to give the title compound (128 mg, 14% of theory) as light yellow solid.
[0405] LC-MS (Method 1B): R.sub.t=1.04 min, MS (ESIPos): m/z=399 [M+H].sup.+
Example 25A
Tert-butyl 4-(9-oxo-9,10-dihydropyrido[3,2:3,4]pyrazolo[1,5-a]pyrimidin-7-yl)piperidine-1-carboxylate
[0406] ##STR00070##
[0407] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (49 mg, 0.497 mmol, 1 eq), 1H-pyrazolo[4,3-b]pyridin-3-amine (100 mg, 0.745 mmol, 1.5 eq) and potassium phosphate (210 mg, 0.993 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (1.5 mL) in a microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with water (20 mL), neutralized (pH 5-6) by the addition of 1N HCl, and extracted with ethyl acetate (215 mL). The combined organic phases were evaporated in vacuo. The residue was triturated with water (40 mL). The precipitate was filtered, triturated with acetonitrile (6 mL), filtered, washed with acetonitrile (2 mL) and dried for 16 h at 50 C. The crude product was purified by preparative HPLC (Method 1A). The combined product fractions were neutralized with aqueous ammonium hydroxide and acetonitrile was evaporated in vacuo. The aqueous phase was extracted with ethyl acetate (215 mL), dried over magnesium sulfate, filtered and evaporated in vacuo to yield the title compound (15 mg, 8% of theory).
[0408] LC-MS (Method 1B): R.sub.t=0.91 min, MS (ESIPos): m/z=370 [M+H].sup.+
Example 26A
Tert-butyl 4-(10-bromo-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate
[0409] ##STR00071##
[0410] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 4-bromo-1H-indazol-3-amine (472 mg, 2.27 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (11.8 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with water (20 mL) and neutralized (pH 6) by the addition of 1N HCl. The precipitate was filtered, washed with water (10 mL), MTBE (4 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (222 mg, 22% of theory).
[0411] LC-MS (Method 1B): R.sub.t=1.13 min, MS (ESIPos): m/z=447 [M+H].sup.+
Example 27A
Tert-butyl 4-[2-oxo-8-(trifluoromethyl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0412] ##STR00072##
[0413] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 6-(trifluoromethyl)-1H-indazol-3-amine (448 mg, 2.27 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (11.8 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with water (50 mL) and neutralized (pH 5-6) by the addition of 1N HCl and extracted with ethyl acetate (2100 mL). The combined organic phases were washed with brine (25 mL), dried over sodium sulfate, filtered and evaporated in vacuo. The brown residue was triturated with MTBE (4 mL) under ultrasound irradiation. The precipitate was filtered, washed with water (20 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (381 mg, 95% purity, 37% of theory) as off-white solid.
[0414] LC-MS (Method 1B): R.sub.t=1.15 min, MS (ESIPos): m/z=437 [M+H].sup.+
Example 28A
Tert-butyl 4-(10-(trifluoromethyl)-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate
[0415] ##STR00073##
[0416] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 4-(trifluoromethyl)-1H-indazol-3-amine (448 mg, 2.27 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (11.8 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with water (20 mL) and neutralized (pH 5) by the addition of 1N HCl and extracted with ethyl acetate (230 mL). The combined organic phases were washed with brine (10 mL), dried over sodium sulfate, filtered and evaporated in vacuo. The brown residue was purified by preparative HPLC (Method 1A). The combined product fractions were evaporated in vacuo to remove acetonitrile. The resulting suspension was filtered, the residue was washed with water (2 ml) and dried for 16 h at 50 C. in vacuo to yield the title compound (116 mg, 12% of theory) as colorless solid.
[0417] LC-MS (Method 1B): R.sub.t=1.19 min, MS (ESIPos): m/z=437 [M+H].sup.+
Example 29A
Tert-butyl 4-(8-tert-butyl-4-oxo-1,4-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-2-yl)piperidine-1-carboxylate
[0418] ##STR00074##
[0419] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 6-tert-butyl-1H-pyrazolo[3,4-b]pyridin-3-amine (448 mg, 2.27 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (11.8 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with water (20 mL) and neutralized (pH 6) by the addition of 1N HCl and extracted with ethyl acetate (250 mL). The combined organic phases were washed with water (220 mL), brine (20 mL), dried over sodium sulfate, filtered and evaporated in vacuo. The brown residue was purified by preparative HPLC (Method 1A). The combined product fractions were evaporated in vacuo to remove acetonitrile. The resulting suspension was filtered, the residue was washed with water (2 ml) and dried for 16 h at 50 C. in vacuo to yield the title compound (56.6 mg, 90% purity, 5% of theory).
[0420] LC-MS (Method 2B): R.sub.t=2.07 min, MS (ESIPos): m/z=426 [M+H].sup.+
Example 30A
Tert-butyl 4-(8-(trifluoromethyl)-4-oxo-1,4-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-2-yl)piperidine-1-carboxylate
[0421] ##STR00075##
[0422] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 4-methyl-6-(trifluoromethyl)-1H-pyrazolo[3,4-b]pyridin-3-amine (448 mg, 2.27 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (11.8 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min.
[0423] After cooling to RT, the suspension was diluted with water (20 mL) and neutralized (pH 5-6) by the addition of 1N HCl. The precipitate was filtered and washed with water (10 mL). The combined filtrates were extracted with ethyl acetate (230 mL), adjusted to pH 8-9 by the addition of 1N NaOH, and extracted with ethyl acetate (20 mL). The combined organic phases were washed with water (210 mL), brine (10 mL), dried over sodium sulfate, filtered and evaporated in vacuo. The yellow residue was triturated with MTBE (5 mL) under ultrasound irradiation, filtered and washed with MTBE (4 mL) and ethyl acetate (1 mL). The filtrate was evaporated in vacuo and purified by preparative HPLC (Method 1A). The combined product fractions were evaporated in vacuo to remove acetonitrile. The resulting suspension was filtered, the residue was washed with water (2 ml) and dried for 16 h at 50 C. in vacuo to yield the title compound (123 mg, 12% of theory) as off-white solid.
[0424] LC-MS (Method 1B): R.sub.t=1.08 min, MS (ESIPos): m/z=452 [M+H].sup.+
Example 31A
Tert-butyl 4-(9-methyl-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate
[0425] ##STR00076##
[0426] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 5-methyl-1H-indazol-3-ylamine (328 mg, 2.27 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (11 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with 20 mL dichloromethane/methanol (4:1), filtered through a short pad of silica gel with 100 mL dichloromethane/methanol (4:1) and evaporated in vacuo. The yellow residue was triturated with MTBE (5 mL), filtered, washed with ethyl acetate (1 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (148 mg, 95% purity, 17% of theory) as yellow solid.
[0427] LC-MS (Method 1B): R.sub.t=1.04 min, MS (ESIPos): m/z=383 [M+H].sup.+
Example 32A
Tert-butyl 4-(8-amino-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate
[0428] ##STR00077##
[0429] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 6-amino-1H-indazol-3-ylamine (330 mg, 2.27 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (11 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with 20 mL dichloromethane/methanol (4:1), filtered through a short pad of silica gel with 100 mL dichloromethane/methanol (4:1) and evaporated in vacuo. The yellow residue was triturated with acetonitrile (4 mL), filtered, washed with acetonitrile (2 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (31 mg, 4% of theory) as yellow solid.
[0430] LC-MS (Method 1B): R.sub.t=0.81 min, MS (ESIPos): m/z=384 [M+H].sup.+
Example 33A
Tert-butyl 4-(3,4-dimethyl-8-oxo-5,8-dihydropyrimido[1,2:1,5]pyrazolo[3,4-c]pyridazin-6-yl)piperidine-1-carboxylate
[0431] ##STR00078##
[0432] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 0.334 mmol, 1.5 eq), 4,5-dimethyl-1H-pyrazolo[3,4-C]pyridazin-3-amine (363 mg, 2.27 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (11 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with 20 mL dichloromethane/methanol (4:1), filtered through a short pad of silica gel with 100 mL dichloromethane/methanol (4:1) and evaporated in vacuo. The residue was triturated with MTBE (4 mL), filtered, washed with ethyl acetate (1 mL). The filtrate was evaporated in vacuo and purified by preparative HPLC (Method 1A). The combined product fractions were evaporated in vacuo to remove acetonitrile and lyophilized to give the title compound (62.3 mg, 7% of theory).
[0433] LC-MS (Method 1B): R.sub.t=0.75 min, MS (ESIPos): m/z=399 [M+H].sup.+
Example 34A
Tert-butyl 4-(8-fluoro-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate
[0434] ##STR00079##
[0435] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 6-fluoro-1H-indazol-3-ylamine (337 mg, 2.27 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (11 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with 20 mL dichloromethane/methanol (4:1), filtered through a short pad of silica gel with 100 mL dichloromethane/methanol (4:1) and evaporated in vacuo. The residue was triturated with 4 mL MTBE/ethyl acetate (1:1), filtered, washed with ethyl acetate (2 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (66 mg, 7% of theory) as colorless solid.
[0436] LC-MS (Method 1B): R.sub.t=1.01 min, MS (ESIPos): m/z=387 [M+H].sup.+
Example 35A
Tert-butyl 4-(9-bromo-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate
[0437] ##STR00080##
[0438] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 5-bromo-1H-indazol-3-ylamine (472 mg, 2.27 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (11 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with 20 mL dichloromethane/methanol (4:1), filtered through a short pad of silica gel with 100 mL dichloromethane/methanol (4:1) and evaporated in vacuo. The residue was triturated with 4 mL MTBE/ethyl acetate (1:1), filtered, washed with ethyl acetate (2 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (37 mg, 3% of theory).
[0439] LC-MS (Method 1B): R.sub.t=1.11 min, MS (ESIPos): m/z=447 [M+H].sup.+
Example 36A
Tert-butyl 4-(10-iodo-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate
[0440] ##STR00081##
[0441] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (0.750 g, 2.50 mmol, 1.5 eq), 4-iodo-1H-indazol-3-ylamine (472 mg, 1.67 mmol, 1 eq) and potassium phosphate (709 mg, 3.34 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (11 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with 20 mL dichloromethane/methanol (4:1), filtered through a short pad of silica gel with 100 mL dichloromethane/methanol (4:1) and evaporated in vacuo. The residue was purified by preparative HPLC (Method 1A). The combined product fractions were evaporated in vacuo to remove acetonitrile. The resulting suspension was filtered, the residue was washed with water (2 ml) and dried for 16 h at 50 C. in vacuo to yield the title compound (56 mg, 7% of theory).
[0442] LC-MS (Method 1B): R.sub.t=1.19 min, MS (ESIPos): m/z=495 [M+H].sup.+
Example 37A
Tert-butyl 4-(8-bromo-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate
[0443] ##STR00082##
[0444] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 6-bromo-1H-indazol-3-ylamine (472 mg, 2.27 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (11 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with 20 mL dichloromethane/methanol (4:1), filtered through a short pad of silica gel with 100 mL dichloromethane/methanol (4:1) and evaporated in vacuo. The residue was purified by preparative HPLC (Method 1A). The combined product fractions were evaporated in vacuo to remove acetonitrile. The resulting suspension was filtered, the residue was washed with water (2 ml) and dried for 16 h at 50 C. in vacuo to yield the title compound (94 mg, 9% of theory) as yellowish solid.
[0445] LC-MS (Method 1B): R.sub.t=1.12 min, MS (ESIPos): m/z=447 [M+H].sup.+
Example 38A
Tert-butyl 4-(7-chloro-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate
[0446] ##STR00083##
[0447] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 7-chloro-1H-indazol-3-ylamine (373 mg, 2.27 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (10 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with 20 mL dichloromethane/methanol (4:1), filtered through a short pad of silica gel with 100 mL dichloromethane/methanol (4:1) and concentrated in vacuo to 5 mL. The resulting suspension was filtered, washed with ethyl acetate (5 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (83 mg, 9% of theory).
[0448] LC-MS (Method 1B): R.sub.t=1.09 min, MS (ESIPos): m/z=403 [M+H].sup.+
Example 39A
Tert-butyl 4-(8,10-difluoro-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate
[0449] ##STR00084##
[0450] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 4,6-difluoro-1H-indazol-3-ylamine (377 mg, 2.27 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (10 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with 20 mL dichloromethane/methanol (4:1), filtered through a short pad of silica gel with 100 mL dichloromethane/methanol (4:1) and evaporated in vacuo. The residue was purified by preparative HPLC (Method 1A). The combined product fractions were evaporated in vacuo to remove acetonitrile. The resulting suspension was filtered, the residue was washed with water (2 ml) and dried for 16 h at 50 C. in vacuo to yield the title compound (27 mg, 90% purity, 3% of theory).
[0451] LC-MS (Method 2B): R.sub.t=1.92 min, MS (ESIPos): m/z=405 [M+H].sup.+
Example 40A
Tert-butyl 4-(8-methyl-4-oxo-1,4-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-2-yl)piperidine-1-carboxylate
[0452] ##STR00085##
[0453] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 6-methyl-1H-pyrazolo[3,4-b]pyridin-3-amine (330 mg, 2.27 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (10 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with 20 mL dichloromethane/methanol (4:1), filtered through a short pad of silica gel with 100 mL dichloromethane/methanol (4:1) and evaporated in vacuo. The residue was purified by preparative HPLC (Method 2A). The combined product fractions were lyophilized to give the title compound (64 mg, 7% of theory).
[0454] LC-MS (Method 2B): R.sub.t=1.64 min, MS (ESIPos): m/z=384 [M+H].sup.+
Example 41A
Tert-butyl 4-(3-fluoro-9-oxo-9,10-dihydropyrido[3,2:3,4]pyrazolo[1,5-a]pyrimidin-7-yl)piperidine-1-carboxylate
[0455] ##STR00086##
[0456] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (932 mg, 3.11 mmol, 1.5 eq), 6-fluoro-1H-pyrazolo[4,3-b]pyridin-3-amine (395 mg, 80% purity, 2.07 mmol, 1 eq) and potassium phosphate (881 mg, 4.15 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (10 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with 20 mL dichloromethane/methanol (4:1), filtered through a short pad of silica gel with 100 mL dichloromethane/methanol (4:1) and evaporated in vacuo. The residue was purified by preparative HPLC (Method 1A). The combined product fractions were concentrated in vacuo to remove acetonitrile. The resulting suspension was filtered, the residue was washed with water (2 ml) and dried for 16 h at 50 C. in vacuo to give the title compound (59.2 mg, 95% purity, 7% of theory) as yellowish solid.
[0457] LC-MS (Method 1B): R.sub.t=0.96 min, MS (ESIPos): m/z=388 [M+H].sup.+
Example 42A
Tert-butyl 4-(10-ethoxy-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0458] ##STR00087##
[0459] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.07 g, 3.58 mmol, 1.5 eq), 4-ethoxy-1H-indazol-3-amine (423 mg, 2.39 mmol, 1 eq) and potassium phosphate (1.01 g, 4.78 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (10 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with 20 mL dichloromethane/methanol (4:1), filtered through a short pad of silica gel with 100 mL dichloromethane/methanol (4:1) and evaporated in vacuo. The residue was triturated with MTBE (15 mL), filtered, washed with MTBE (2 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (161 mg, 15% of theory).
[0460] LC-MS (Method 1B): R.sub.t=1.11 min, MS (ESIPos): m/z=413 [M+H].sup.+
Example 43A
Tert-butyl 4-(7-bromo-2-oxo-1,2-dihydropyrido[4,3:3,4]pyrazolo[1,5-a]pyrimidin-4-yl)piperidine-1-carboxylate
[0461] ##STR00088##
[0462] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 7-bromo-1H-pyrazolo[4,3-c]pyridin-3-amine (474 mg, 2.27 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (10 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with 20 mL dichloromethane/methanol (4:1), filtered through a short pad of silica gel with 100 mL dichloromethane/methanol (4:1) and evaporated in vacuo. The residue was triturated with acetonitrile (10 mL) and filtered. The residue was triturated with DMSO (6 mL), washed with acetonitrile (8 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (116 mg, 12% of theory).
[0463] LC-MS (Method 1B): R.sub.t=0.98 min, MS (ESIPos): m/z=448 [M+H].sup.+
Example 44A
Tert-butyl 4-(7-fluoro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0464] ##STR00089##
[0465] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 7-fluoro-1H-indazol-3-amine (336 mg, 2.27 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (10 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with water (20 mL) and neutralized (pH 6) by the addition of 1N HCl. The mixture was extracted with ethyl acetate (230 mL). The combined organic phases were washed with brine (10 mL), dried over sodium sulfate, filtered and evaporated in vacuo. The residue was triturated with MTBE (5 mL), filtered and washed with MTBE (2 mL). The residue was purified by preparative HPLC (Method 1A). The combined product fractions were evaporated in vacuo to remove acetonitrile. The resulting suspension was filtered, the residue was washed with water (2 ml) and dried for 2 h at 50 C. in vacuo to the title compound (92 mg, 11% of theory) as off-white solid.
[0466] LC-MS (Method 1B): R.sub.t=1.03 min, MS (ESIPos): m/z=387 [M+H].sup.+
Example 45A
Tert-butyl 4-(2-oxo-1,2-dihydropyrido[3,4:3,4]pyrazolo[1,5-a]pyrimidin-4-yl)piperidine-1-carboxylate
[0467] ##STR00090##
[0468] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 1H-pyrazolo[3,4-c]pyridin-3-amine (299 mg, 2.27 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (10 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with water (20 mL) and neutralized (pH 7) by the addition of 1N HCl. The precipitate was filtered, washed with water (10 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (169 mg, 75% purity, 16% of theory).
[0469] LC-MS (Method 1B): R.sub.t=0.73 min, MS (ESIPos): m/z=370 [M+H].sup.+
Example 46A
Tert-butyl 4-[2-oxo-7-(trifluoromethyl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0470] ##STR00091##
[0471] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 7-(trifluoromethyl)-1H-indazol-3-amine (299 mg, 2.27 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (10 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with water (20 mL), neutralized (pH 6) by the addition of 1N HCl and extracted with ethyl acetate (250 mL). The combined organic phases were washed with water (30 mL), brine (30 mL), dried over magnesium sulfate, filtered and evaporated in vacuo. The residue was triturated with MTBE (5 mL), filtered, washed with MTBE (2 mL)) and dried for 16 h at 50 C. in vacuo to yield the title compound (122 mg, 12% of theory).
[0472] LC-MS (Method 1B): R.sub.t=1.16 min, MS (ESIPos): m/z=437 [M+H].sup.+
Example 47A
Tert-butyl 4-[10-nitro-2-oxo-8-(trifluoromethyl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0473] ##STR00092##
[0474] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 4-nitro-6-(trifluoromethyl)-1H-indazol-3-amine (548 mg, 2.23 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (10 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with 20 mL dichloromethane/methanol (4:1), filtered through a short pad of silica gel with 100 mL dichloromethane/methanol (4:1) and evaporated in vacuo. The residue was purified by preparative HPLC (Method 1A). The combined product fractions were concentrated in vacuo to remove acetonitrile. The resulting suspension was filtered, the residue was washed with water (2 ml) and dried for 16 h at 50 C. in vacuo to give the title compound (90.8 mg, 8% of theory).
[0475] LC-MS (Method 1B): R.sub.t=1.16 min, MS (ESIPos): m/z=482 [M+H].sup.+
Example 48A
Tert-butyl 4-(8,10-dimethyl-4-oxo-1,4-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-2-yl)piperidine-1-carboxylate
[0476] ##STR00093##
[0477] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 4,6-Dimethyl-1H-pyrazolo[3,4-b]pyridin-3-amine (361 mg, 2.27 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (9 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with water (50 mL), neutralized (pH 5-6) by the addition of 1N HCl and extracted with ethyl acetate (2100 mL). The combined organic phases were washed with water, (225 mL), brine (25 mL), dried over sodium sulfate, filtered and evaporated in vacuo. The residue was triturated with acetonitrile (4 mL) and DMSO (4 mL). The precipitate was filtered, washed with acetonitrile (22 mL) and dried for 2 h at 50 C. in vacuo to yield the title compound (50 mg, 5% of theory) as yellow solid.
[0478] LC-MS (Method 1B): R.sub.t=0.92 min, MS (ESIPos): m/z=398 [M+H].sup.+
Example 49A
Tert-butyl 4-(10-chloro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)-2-methylpiperidine-1-carboxylate [Enantiomerically Pure Trans-Isomer]
[0479] ##STR00094##
[0480] The title compound was prepared according to General Procedure A starting from 0.92 g (5.13 mmol) 4-chloro-1H-indazol-3-amine and 2.02 g (5.13 mmol) ()-cis-tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]-2-methylpiperidine-1-carboxylate. Then the mixture was evaporated and the crude product was treated HCl 1N and extracted with ethyl acetates several times. The organic layer was washed with water and dried over sodium sulfate, filtered, evaporated and dried under vacuo. The crude product was stirred in acetonitrile and then was filtered and dried under vacuo to yield the title compound as a mixture of two diastereoisomers (950 mg, 100% of theory). The mixture was dissolved in methanol (6.6 ml) and then was treated with HCl 4N in dioxane (6.6 ml). The reaction mixture was sonicated at RT for 15 minutes. The solvent was evaporated under vacuo and the crude product was stirred in methanol. The resulting solid was filtered, washed with dioxane and dried under vacuo to yield a crude product with the two deprotected diastereomers (677 mg) which could not be separated from each other through chromatography. For this reason the crude product was dissolved again in dichloromethane (15 ml) and was treated with di-tert-butyl dicarbonate (0.38 g, 1.78 mmol) and triethylamine (0.18 g, 1.77 mol). The reaction mixture was stirred 15 minutes at RT and was left without stirring at RT for 39 h. Then the solvent was evaporated under vacuo and the crude product was treated with water and extracted several times with ethyl acetate. The collected organic phases were washed with an 10% aq. solution of citric acid, with water and brine. After that the organic layer was dried over sodium sulfate, filtered, evaporated and dried under vacuo. At that point the mixture could be separated by Method 4C to yield the title compound (273 mg, 37% of theory).
[0481] LC-MS (Method 1B): RT=1.18 min, MS (ESIPos): m/z=417 (M+H).sup.+
[0482] HPLC (Method 4E): R.sub.t=8.77 min
Example 50A
Tert-butyl 4-(7-bromo-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0483] ##STR00095##
[0484] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)-2-methylpiperidine-1-carboxylate (750 mg, 2.50 mmol, 1.5 eq), 7-bromo-1H-indazol-3-amine (354 mg, 1.67 mmol, 1 eq) and potassium phosphate (709 mg, 3.34 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (10 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with water (20 mL) and neutralized (pH 6-7) by the addition of 1N HCl. The resulting aqueous suspension filtered, the residue was washed with ethyl acetate (10 mL) and acetonitrile (5 mL) and dried for 16 h at 50 C. in vacuo to give the title compound (42.3 mg, 7% of theory).
[0485] LC-MS (Method 1B): R.sub.t=1.12 min, MS (ESIPos): m/z=447 [M+H].sup.+
Example 51A
Tert-butyl 4-(2-oxo-1,2-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-4-yl)piperidine-1-carboxylate
[0486] ##STR00096##
[0487] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol, 1.5 eq), 1H-Pyrazolo[3,4-b]pyridin-3-amine (299 mg, 2.27 mmol, 1 eq) and potassium phosphate (945 mg, 4.45 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (10 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the mixture was diluted with water (20 mL) and acidified (pH 5) by the addition of 1N HCl. The resulting suspension was filtered, washed with water (20 mL) and the residue was purified by preparative HPLC (Method 2A). The combined product fractions were lyophilized to give the title compound (36.3 mg, 4% of theory).
[0488] LC-MS (Method 1B): R.sub.t=0.78 min, MS (ESIPos): m/z=370 [M+H].sup.+
Example 52A
Tert-butyl 4-(10-methyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0489] ##STR00097##
[0490] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (750 mg, 2.50 mmol, 1.5 eq), 4-methyl-1H-indazol-3-amine (246 mg, 1.67 mmol, 1 eq) and potassium phosphate (709 mg, 3.34 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (10 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with water (20 mL), neutralized (pH 6) by the addition of 1N HCl and extracted with ethyl acetate (230 mL). The combined organic phases were washed with water, (50 mL), brine (25 mL), dried over magnesium sulfate, filtered and evaporated in vacuo. The residue was purified by preparative HPLC (Method 1A). The combined product fractions were concentrated in vacuo to remove acetonitrile. The resulting suspension was filtered, the residue was washed with water (2 ml) and dried for 16 h at 50 C. in vacuo to give the title compound (63.8 mg, 10% of theory).
[0491] LC-MS (Method 1B): R.sub.t=1.07 min, MS (ESIPos): m/z=383 [M+H].sup.+
Example 53A
Tert-butyl 4-[2-oxo-10-(trifluoromethoxy)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0492] ##STR00098##
[0493] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (750 mg, 2.50 mmol, 1.5 eq), 4-(trifluoromethoxy)-1H-indazol-3-amine (363 mg, 1.67 mmol, 1 eq) and potassium phosphate (709 mg, 3.34 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (10 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with water (20 mL), neutralized (pH 6) by the addition of 1N HCl and extracted with ethyl acetate (230 mL). The combined organic phases were washed with water, (50 mL), brine (25 mL), dried over magnesium sulfate, filtered and evaporated in vacuo. The residue was purified by preparative HPLC (Method 1A). The combined product fractions were concentrated in vacuo to remove acetonitrile. The resulting suspension was filtered, the residue was washed with water (2 ml) and dried for 16 h at 50 C. in vacuo to give the title compound (64 mg, 8% of theory) as off-white solid.
[0494] LC-MS (Method 2B): R.sub.t=2.51 min, MS (ESIPos): m/z=453 [M+H].sup.+
Example 54A
Tert-butyl 4-(9-oxo-9,10-dihydropyrazino[2,3:3,4]pyrazolo[1,5-a]pyrimidin-7-yl)piperidine-1-carboxylate
[0495] ##STR00099##
[0496] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (750 mg, 2.50 mmol, 1.5 eq), 1H-pyrazolo[3,4-b]pyrazin-3-amine (226 mg, 1.67 mmol, 1 eq) and potassium phosphate (709 g, 3.34 mmol, 2 eq) were suspended in 1-methoxy-2-propanol (10 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the suspension was diluted with 20 mL dichloromethane/methanol (3:1), filtered through a short pad of silica gel with 150 mL dichloromethane/methanol (3:1) and evaporated in vacuo. The residue was purified by preparative HPLC (Method 1A). The combined product fractions were lyophilized to give the title compound (31.1 mg, 5% of theory) as yellow solid.
[0497] LC-MS (Method 1B): R.sub.t=0.85 min, MS (ESIPos): m/z=371 [M+H].sup.+
Example 55A
Tert-butyl 4-(8-chloro-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate
[0498] ##STR00100##
[0499] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (450 mg, 81% purity, 1.22 mmol, 1 eq), 6-chloro-1H-indazol-3-amine (204 mg, 1.22 mmol, 1.0 eq) and potassium phosphate (517 mg, 2.43 mmol, 2 eq) were suspended in dioxane (4.3 mL) in a 20 mL microwave vial. The vial was capped and the mixture was heated in a microwave to 150 C. for 1 h. The solvent was evaporated in vacuo, the residue was diluted with water (20 mL) and extracted with ethyl acetate (2, 50 mL and 25 mL). The combined organic phases were dried over sodium sulfate, filtered and evaporated in vacuo. The residue was purified by preparative HPLC (Method 2A). The combined product fractions were evaporated in vacuo. The residue was purified again by preparative HPLC (Method 1A). The combined product fractions were neutralized with aqueous ammonium hydroxide and acetonitrile was evaporated in vacuo. The aqueous phase was extracted with ethyl acetate (30 mL), dried over sodium sulfate, filtered and evaporated in vacuo to yield the title compound (5.2 mg, 1% of theory).
[0500] LC-MS (Method 1B): R.sub.t=1.13 min, MS (ESIPos): m/z=403 [M+H].sup.+
Example 56A
N.SUP.4.,N.SUP.4.-Dimethyl-1H-pyrazolo[3,4-b]pyridine-3,4-diamine
[0501] ##STR00101##
[0502] 2-Chloro-4-(dimethylamino)nicotinonitrile (500 mg, 2.75 mmol) and sodium acetate (270 mg, 3.30 mmol) were suspended in pyridine (4 ml) under argon atmosphere. The resulting suspension was heated at 100 C. Hydrazine hydrate (1.38 g, 27.53 mmol) was added slowly over a period of 10 minutes and then the reaction mixture was heated at 115 C. for 2h. After cooling to RT the mixture was diluted in water and was extracted with dichlormethane. The collected organic phases were washed with brine, dried over magnesium sulfate, filtered and evaporated. The residue was dried under vacuo to yield the title compound (303 mg, 57% of theory).
[0503] LC-MS (Method 2B): R.sub.t=1.37 min, MS (ESIPos): m/z=177 [M+H].sup.+
Example 57A
4-Chloro-6-(trifluoromethyl)-1H-indazol-3-amine
[0504] ##STR00102##
[0505] 2,6-Dichloro-4-(trifluoromethyl)benzonitrile (500 mg, 2.08 mmol) and sodium acetate (205 mg, 2.50 mmol) were suspended in pyridine (5 ml) under argon atmosphere. The resulting suspension was heated at 95 C. Hydrazine hydrate (1.04 g, 20.83 mmol) was added slowly over a period of 10 minutes and then the reaction mixture was heated at 115 C. for 2h. After cooling to RT, the mixture was diluted in water and it was acidified by addition of HCl 4N until pH 6 was achieved. The mixture was extracted with ethyl acetate and the collected organic phases were washed water and brine, dried over magnesium sulfate, filtered and evaporated. The residue was dried under vacuo to yield the title compound (0.54 g, 99% of theory).
[0506] LC-MS (Method 1B): R.sub.t=0.90 min, MS (ESIPos): m/z=236 [M+H].sup.+
Example 58A
6-(4-Fluorophenyl)-4-(trifluoromethyl)-1H-pyrazolo[3,4-b]pyridin-3-amine
[0507] ##STR00103##
[0508] To a solution of 2-chloro-6-(4-fluorophenyl)-4-(trifluoromethyl)nicotinonitrile (0.40 g, 1.33 mmol) in ethanol (4 ml) under argon atmosphere was added hydrazine hydrate (0.13 g, 2.66 mmol) at RT. The mixture was heated at 70 C. for 15 h. After cooling to RT, water was added and the resulting precipitate was filtered, washed again with water and dried under vacuo 2h at 50 C. to yield the title compound (0.36 g, 89% of theory).
[0509] LC-MS (Method 1B): R.sub.t=0.99 min, MS (ESIPos): m/z=297 [M+H].sup.+
Example 59A
4-Methyl-1H-pyrazolo[3,4-b]pyridin-3-amine
[0510] ##STR00104##
[0511] 2-Chloro-4-methylnicotinonitrile (500 mg, 3.18 mmol) and sodium acetate (312 mg, 3.81 mmol) were suspended in pyridine (7.5 ml) under argon atmosphere. The resulting suspension was heated at 100 C. Hydrazine hydrate (1.62 g, 31.79 mmol) was added slowly over a period of 10 minutes and then the resulting mixture was heated at 105 C. for 5h. After cooling to RT the mixture was diluted in water and acidified by addition of HCl 1N until pH 6 was achieved. The mixture was extracted with dichloromethane and the collected organic phases were washed with water and brine, dried over sodium sulfate, filtered and evaporated. The residue was dried under vacuo to yield the title compound (0.27 g, 59% of theory).
[0512] LC-MS (Method 2B): R.sub.t=1.21 min, MS (ESIPos): m/z=149 [M+H].sup.+
Example 60A
1H-Pyrazolo[4,3-c]pyridin-3-amine
[0513] ##STR00105##
[0514] To a solution of 4-chloronicotinonitrile (1.00 g, 7.00 mmol) in ethanol (10 ml) under argon atmosphere was added hydrazine hydrate (0.71 g, 14.00 mmol) at RT. The mixture was heated to 70 C. for 5 h. After cooling to RT the mixture was diluted with water and extracted with ethyl acetate. In the aqueous phase a pale-yellow solid precipitated which was collected by filtration and dried under vacuo to yield the title compound (0.43 g, 46% of theory).
[0515] LC-MS (Method 2B): R.sub.t=0.49 min, MS (ESIPos): m/z=135 [M+H].sup.+
Example 61A
6-Phenyl-1H-pyrazolo[3,4-b]pyridin-3-amine
[0516] ##STR00106##
[0517] To a solution of 2-chloro-6-phenylnicotinonitrile (1.00 g, 4.66 mmol) in ethanol (10 ml) under argon atmosphere was added hydrazine hydrate (0.48 g, 9.32 mmol) at RT. The mixture was heated at 70 C. for 15 h. After that time (0.23 g, 4.65 mmol) hydrazine hydrate were added into the mixture and it was still stirred 2h at 70 C. After cooling to RT the mixture was diluted with water and the resulting precipitate was filtered, washed with water and dried under vacuo to yield the title compound (0.83 g, 84% of theory).
[0518] LC-MS (Method 1B): R.sub.t=0.69 min, MS (ESIPos): m/z=210 [M+H].sup.+
Example 62A
4-Phenyl-1H-pyrazolo[3,4-b]pyridin-3-amine
[0519] ##STR00107##
[0520] To a solution of 2-chloro-4-phenylnicotinonitrile (1.00 g, 4.43 mmol) in ethanol (9.5 ml) under argon atmosphere was added hydrazine hydrate (0.45 g, 8.85 mmol) at RT. The mixture was heated at 70 C. for 15 h. After that time (0.11 g, 2.21 mmol) hydrazine hydrate were added into the mixture and it was still stirred at 70 C. for 2h. After cooling to RT the mixture was diluted with water and the resulting precipitate was filtered, washed with water and dried under vacuo to yield the title compound (0.83 g, 89% of theory).
[0521] LC-MS (Method 1B): R.sub.t=0.67 min, MS (ESIPos): m/z=210 [M+H].sup.+
Example 63A
5-Phenyl-1H-pyrazolo[3,4-b]pyridin-3-amine
[0522] ##STR00108##
[0523] To a solution of 2-chloro-5-phenylnicotinonitrile (1.00 g, 4.66 mmol) in ethanol (10 ml) under argon atmosphere was added hydrazine hydrate (0.48 g, 9.32 mmol) at RT. The mixture was heated at 70 C. for 15 h. After cooling to RT the mixture was diluted with water and the resulting precipitate was filtered, washed with water and dried under vacuo to yield the title compound (0.88 g, 89% of theory).
[0524] LC-MS (Method 1B): R.sub.t=0.68 min; MS (ESIPos): m/z=210 [M+H].sup.+
Example 64A
Tert-butyl 4-[10-(dimethylamino)-2-oxo-1,2-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-4-yl]piperidine-1-carboxylate
[0525] ##STR00109##
[0526] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (842 mg, 2.33 mmol), N.sup.4,N.sup.4-dimethyl-1H-pyrazolo[3,4-b]pyridine-3,4-diamine (303 mg, 1.56 mmol) and potassium phosphate (661 mg, 3.11 mmol) were suspended in 1-methoxy-2-propanol (7 ml) in a 20 ml microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the solvent was evaporated and the residue was diluted in water and extracted with ethyl acetate. After separation of the two layers, the aqueous layer was extracted with ethyl acetate. The aqueous layer was acidified with HCl 1N until pH 7 was achieved and then evaporated under vacuo. The crude product was purified by preparative HPLC (Method 1A). The combined product fractions were neutralized with a 33% ammonia solution and then acetonitrile was evaporated. The resulting aqueous phase was extracted with ethyl acetate and the collected organic phases were dried over sodium sulfate, filtrated and evaporated. The resulting solid was dried under vacuo to yield the title compound (11 mg, 2% of theory).
[0527] LC-MS (Method 1B): R.sub.t=0.77 min, MS (ESIPos): m/z=413 [M+H].sup.+
Example 65A
Tert-butyl 4-[10-chloro-2-oxo-8-(trifluoromethyl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0528] ##STR00110##
[0529] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.03 g, 2.87 mmol), 4-chloro-6-(trifluoromethyl)-1H-indazol-3-amine (500 mg, 1.91 mmol) and potassium phosphate (811 mg, 3.82 mmol) were suspended in 1-methoxy-2-propanol (9 ml) in a 20 ml microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the solvent was evaporated and the residue was diluted with water and extracted with ethyl acetate. After separation of the layers the aqueous layer was extracted with ethyl acetate. The collected organic layers were dried over magnesium sulfate, filtrated and evaporated. The crude product was purified by preparative (Method 1A). The combined product fractions were neutralized with a 33% ammonia solution and then acetonitrile was evaporated. The resulting solid in the aqueous phase was filtered and dried under vacuo to yield the title compound (287 mg, 32% of theory).
[0530] LC-MS (Method 1B): R.sub.t=1.27 min, MS (ESIPos): m/z=471 [M+H].sup.+
Example 66A
Tert-butyl 4-[8-(4-fluorophenyl)-2-oxo-10-(trifluoromethyl)-1,2-dihydropyrido[23:3,4]pyrazolo[1,5-a]pyrimidin-4-yl]piperidine-1-carboxylate
[0531] ##STR00111##
[0532] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (630 mg, 1.75 mmol), 6-(4-fluorophenyl)-4-(trifluoromethyl)-1H-pyrazolo[3,4-b]pyridin-3-amine (352 mg, 1.17 mmol) and potassium phosphate (494 mg, 2.33 mmol) were suspended in 1-methoxy-2-propanol (10 ml) in a 20 ml microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After this period the mixture was additionally heated in the MW at 180 C. for 30 min. After cooling to RT, the solvent was evaporated and the residue was diluted in water and extracted with ethyl acetate. After separation of the layers the aqueous layer was extracted with ethyl acetate. The collected organic layers were dried over sodium sulfate, filtered and evaporated. The crude product was purified by preparative HPLC (Method 1A). The combined product fractions were neutralized with a 33% ammonia solution and then acetonitrile was evaporated. The resulting solid in the aqueous phase was filtered and dried under vacuo to yield the title compound (62 mg, 10% of theory).
[0533] LC-MS (Method 1B): R.sub.t=1.29 min, MS (ESIPos): m/z=532 [M+H].sup.+
Example 67A
Tert-butyl 4-(10-bromo-2-oxo-1,2-dihydropyrido[3,4:3,4]pyrazolo[1,5-a]pyrimidin-4-yl)piperidine-1-carboxylate
[0534] ##STR00112##
[0535] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 3.34 mmol), 4-bromo-1H-pyrazolo[3,4-c]pyridin-3-amine (474 mg, 2.23 mmol) and potassium phosphate (945 mg, 4.45 mmol) were suspended in 1-methoxy-2-propanol (10 ml) in a 20 ml microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the mixture was diluted with water and neutralized until pH 6 was achieved by the addition of 1N HCl. The resulting solid was filtrated, washed with ethyl acetate and dried under vacuo at 60 C. overnight to yield the first fraction of title compound. After separation of filtrate layers the aqueous layer was extracted with ethyl acetate. The collected organic layers were washed with water und brine solution. The resulting precipitate formed in the organic phase was filtered and dried under vacuo at 60 C. for 2 h to give a second fraction of the title compound. Overall yield (176 mg, 18% of theory).
[0536] LC-MS (Method 1B): R.sub.t=0.98 min, MS (ESIPos): m/z=450 [M+H].sup.+
Example 68A
Tert-butyl 4-(2-oxo-8-phenyl-1,2-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-4-yl)piperidine-1-carboxylate
[0537] ##STR00113##
[0538] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1.00 g, 2.77 mmol), 6-phenyl-1H-pyrazolo[3,4-b]pyridin-3-amine (393 mg, 1.85 mmol) and potassium phosphate (785 mg, 3.70 mmol) were suspended in 1-methoxy-2-propanol (10 ml) in a 20 ml microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the reaction mixture was diluted with water and neutralized (pH 6) by the addition of 1N HCl. The resulting solid was filtrated, washed with ethyl acetate and dried under vacuo. The solid was stirred in a mixture of DMSO/water, filtered and dried under vacuo to yield a first fraction of title compound. The filtrate was purified by preparative HPLC (Method 2A) to yield a second fraction of the title compound. Overall yield: 112 mg, 14%.
[0539] LC-MS (Method 1B): R.sub.t=1.07 min, MS (ESIPos): m/z=446 [M+H].sup.+
Example 69A
Tert-butyl 4-(2-oxo-9-phenyl-1,2-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-4-yl)piperidine-1-carboxylate
[0540] ##STR00114##
[0541] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1 g, 2.77 mmol), 5-phenyl-1H-pyrazolo[3,4-b]pyridin-3-amine (389 mg, 1.85 mmol) and potassium phosphate (785 mg, 3.70 mmol) were suspended in 1-methoxy-2-propanol (10 ml) in a 20 ml microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the reaction mixture was diluted with water and neutralized (pH 6) by the addition of 1N HCl. The resulting solid was filtrated, washed with ethyl acetate and water and dried under vacuo. The solid was stirred in a mixture of water and DMSO, filtered und dried under vacuo. The solid was stirred again in a mixture of water, ammonia and acetonitrile. The resulting solid was filtered and the filtrate was purified by preparative HPLC Method 2A) to yield the title compound (70 mg, 8% of theory).
[0542] LC-MS (Method 1B): R.sub.t=1.02 min, MS (ESIPos): m/z=446 [M+H].sup.+
Example 70A
Tert-butyl 4-(2-oxo-10-phenyl-1,2-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-4-yl)piperidine-1-carboxylate
[0543] ##STR00115##
[0544] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1 g, 2.77 mmol), 4-phenyl-1H-pyrazolo[3,4-b]pyridin-3-amine (389 mg, 1.85 mmol) and potassium phosphate (785 mg, 3.70 mmol) were suspended in 1-methoxy-2-propanol (10 ml) in a 20 ml microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT, the reaction mixture was diluted with water and neutralized (pH 6) by the addition of 1N HCl. The resulting solid was filtrated, washed with ethyl acetate and water and dried under vacuo. The solid was stirred in a mixture of water, ammonia and acetonitrile. The solid was filtered off and the filtrate was purified by preparative HPLC (Method 2A) to yield the title compound (49 mg, 6% of theory).
[0545] LC-MS (Method 1B): R.sub.t=0.98 min, MS (ESIPos): m/z=446 [M+H].sup.+
Example 71A
Tert-butyl 4-(2-oxo-1,2-dihydropyrido[4,3:3,4]pyrazolo[1,5-a]pyrimidin-4-yl)piperidine-1-carboxylate
[0546] ##STR00116##
[0547] The title compound was prepared according to General Procedure 1A starting from 37 mg (0.28 mmol) 1H-pyrazolo[4,3-c]pyridin-3-amine and 100 mg (0.28 mmol) tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate.
[0548] Work-up: the mixture was diluted with ethyl acetate and treated with HCl 1H. The layers were separated and the aqueous layer was treated with NaOH 1N until pH 10 was achieved. The resulting precipitate was filtered and dried under vacuo to yield the title compound (13 mg, 12% of theory).
[0549] LC-MS (Method 1B): R.sub.t=0.68 min, MS (ESIPos): m/z=370 [M+H].sup.+
Example 72A
Tert-butyl 4-(10-methyl-2-oxo-1,2-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-4-yl)piperidine-1-carboxylate
[0550] ##STR00117##
[0551] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (818 mg, 2.27 mmol), 4-methyl-1H-pyrazolo[3,4-b]pyridin-3-amine (224 mg, 1.51 mmol) and potassium phosphate (642 mg, 3.02 mmol) were suspended in 1-methoxy-2-propanol (8 ml) in a 20 ml microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. The reaction mixture was diluted with water and neutralized (pH 6) by the addition of 1N HCl. The resulting solid was filtrated, washed with ethyl acetate and water and dried under vacuo. The solid was stirred in a mixture of water, ammonia and acetonitrile. The solid was filtered off and the filtrate was purified by preparative HPLC (Method 2A) to yield the title compound (40 mg, 7% of theory).
[0552] LC-MS (Method 3B): R.sub.t=1.75 min, MS (ESIPos): m/z=384 [M+H].sup.+
Example 73A
Tert-butyl 4-(9-iodo-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0553] ##STR00118##
[0554] Tert-butyl 4-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate (1 g, 2.27 mmol), 5-iodo-1H-indazol-3-amine (504 mg, 1.85 mmol) and potassium phosphate (785 mg, 3.70 mmol) were suspended in 1-methoxy-2-propanol (10 ml) in a 20 ml microwave vial. The vial was capped and the mixture was heated in a microwave to 180 C. for 15 min. After cooling to RT the residue was diluted with water and extracted with ethyl. The layers were separated and the aqueous layer was extracted with ethyl acetate.
[0555] The collected organic phases were dried over magnesium sulfate, filtered and evaporated. The crude product was purified by preparative HPLC (Method 1A). The combined product fractions were neutralized with aqueous ammonium hydroxide. After the evaporation of acetonitrile a white solid was formed in the aqueous phase, which was filtered and dried under vacuo to yield the title compound (108 mg, 12% of theory).
[0556] LC-MS (Method 3B): R.sub.t=2.46 min, MS (ESIPos): m/z=495 [M+H].sup.+
Example 74A
Tert-butyl-4-(10-bromo-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)-2-methylpiperidine-1-carboxylate [Enantiomerically Pure Trans-Isomer]
[0557] ##STR00119##
[0558] The title compound was prepared according to General Procedure 1A starting from 1.00 g (4.48 mmol) 4-bromo-1H-indazol-3-amine and 1.77 mg (4.48 mmol) ()-cis-tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]-2-methylpiperidine-1-carboxylate.
[0559] Work-up: the mixture was evaporated and the crude product was treated with water and ethyl acetate.
[0560] After separation of the layers the organic layer was washed with water, dried over sodium sulfate and evaporated under vacuo. The crude product was purified by preparative HPLC (Method 1A). The combined product fractions were neutralized with a 33% ammonia solution and then acetonitrile was evaporated. In the aqueous phase precipitated a solid which was filtered and dried under vacuo. After reaction epimerization was observed obtaining a mixture of diastereomers which were separated by Method 1C to yield the title compound (1.00 g, 49% of theory).
[0561] LC-MS (Method 1B): R.sub.t=1.17 min, MS (ESIPos): m/z=463 [M+H].sup.+
[0562] HPLC (Method 1E): R.sub.t=7.04 min
Example 75A
Tert-butyl 4-(10-ethoxy-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)-2-methylpiperidine-1-carboxylate [Enantiomerically Pure Trans-Isomer]
[0563] ##STR00120##
[0564] The title compound was prepared according to General Procedure 1A starting from 0.26 g (1.28 mmol) 4-Ethoxy-1H-pyrazolo[3,4-b]pyridin-3-amine and 0.50 g (1.28 mmol) ()-cis-tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]-2-methylpiperidine-1-carboxylate.
[0565] Work-up: the mixture was evaporated and the crude product was treated with water and ethyl acetate.
[0566] After separation of the layers the aqueous layer was extracted with ethyl acetate and then the collected organic phases were washed with water, dried over sodium sulfate and evaporated under vacuo. The crude product was sonicated 15 minutes at RT in tert-butylmethylether, filtered off and the filtrate was evaporated and then purified by preparative HPLC (Method 1A). The combined product fractions were neutralized with a 33% ammonia solution and then acetonitrile was evaporated. In the aqueous phase precipitated a solid which was filtered and dried under vacuo. After reaction epimerization was observed obtaining a mixture of diastereomers which were separated by Method 2C to yield the title compound (99 mg, 18% of theory).
[0567] LC-MS (Method 2B): R.sub.t=2.45 min, MS (ESIPos): m/z=427 [M+H].sup.+
[0568] HPLC (Method 2E): R.sub.t=5.75 min
Example 76A
Tert-butyl 2-methyl-4-(2-oxo-10-phenyl-1,2-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-4-yl)piperidine-1-carboxylate [Enantiomerically Pure Trans-Isomer]
[0569] ##STR00121##
[0570] The title compound was prepared according to General Procedure 1A starting from 200 mg (0.92 mmol) 4-phenyl-1H-pyrazolo[3,4-b]pyridin-3-amine and 363 mg (0.92 mmol) ()-cis-tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]-2-methylpiperidine-1-carboxylate.
[0571] Work-up: the mixture was evaporated and the crude product was treated with water and extracted with ethyl acetate. After separation of the phases a yellow solid precipitated in the aqueous phase. The solid was filtered and dried under vacuo. After reaction epimerization was observed obtaining a mixture of diastereomers which were separated by Method 3C. The fraction containing the title compound was purified again by preparative HPLC (Method 1A). The combined product fractions were neutralized with a 33% ammonia solution and then acetonitrile was evaporated. In the aqueous phase precipitated a solid which was filtered and dried under vacuo to yield the title compound (81 mg, 20% of theory).
[0572] LC-MS (Method 1B): R.sub.t=1.04 min, MS (ESIPos): m/z=460 [M+H].sup.+
[0573] HPLC (Method 3E): R.sub.t=8.18 min
Example 77A
3-Amino-1H-indazole-4-carbonitrile
[0574] ##STR00122##
[0575] 3-Fluorophthalonitrile (1.00 g, 6.84 mmol) was dissolved in ethanol (10 mL) and treated with hydrazine hydrate (1.37 g, 27.4 mmol). After stirring at 70 C. for 8 h, the mixture was cooled to RT and concentrated in vacuo. The residue was dissolved in a mixture of water and ethyl acetate. The aqueous layer was extracted once more with ethyl acetate. The combined organic layers were washed with water and with brine, dried over magnesium sulfate, concentrated in vacuo and dried to yield the title compound (0.51 g, 47% of theory)
[0576] LC-MS (Method 2B): R.sub.t=1.47 min, MS (ESIPos): m/z=159 [M+H].sup.+
Example 78A
Tert-butyl 4-(10-cyano-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0577] ##STR00123##
[0578] 3-Amino-1H-indazole-4-carbonitrile (0.51 g, 3.20 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (1.27 g, 3.55 mmol) were dissolved in acetonitrile (20 mL) and refluxed for 6 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (20 mL). Potassium phosphate (1.37 g, 6.45 mmol) was added and the mixture was stirred at 80 C. for 6 h. Concentration in vacuo and purification by preparative HPLC (Method 1A) afforded the title compound (0.32 g, 25% of theory).
[0579] LC-MS (Method 1B): R.sub.t=1.07 min, MS (ESIPos): m/z=394 [M+H].sup.+
Example 79A
4-(4-Methoxyphenyl)-1H-indazol-3-amine
[0580] ##STR00124##
[0581] Under argon, 4-chloro-1H-indazol-3-amine (0.50 g, 2.98 mmol), 4-methoxyphenylboronic acid (0.68 g, 4.48 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl) [2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (0.07 g, 0.09 mmol) were dissolved in a degassed mixture of ethanol, water, and toluene (1:1:1, 20 mL total volume). Potassium phosphate solution (1 M in water, degassed) (6.00 mL, 6.00 mmol) was added and the mixture was stirred at 80 C. for 4 h. The mixture was concentrated in vacuo and purified by preparative HPLC (Method 1A) to yield the title compound (0.28 g, 40% of theory).
[0582] LC-MS (Method 1B): R.sub.t=0.84 min, MS (ESIPos): m/z=240 [M+H].sup.+
Example 80A
Tert-butyl-4-[10-(4-methoxyphenyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidin-1-carboxylate
[0583] ##STR00125##
[0584] 4-(4-Methoxyphenyl)-1H-indazol-3-amine (0.28 g, 1.18 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.46 g, 1.30 mmol) were dissolved in acetonitrile (10 mL) and refluxed for 6 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (10 mL). Potassium phosphate (0.52 g, 2.44 mmol) was added and the mixture was stirred at 120 C. for 6 h. Concentration in vacuo and purification by preparative HPLC (Method 1A) afforded the title compound (0.31 g, 54% of theory).
[0585] LC-MS (Method 1B): R.sub.t=1.27 min, MS (ESIPos): m/z=475 [M+H].sup.+
Example 81A
4-[4-(Trifluoromethyl)phenyl]-1H-indazol-3-amine
[0586] ##STR00126##
[0587] Under argon, 4-chloro-1H-indazol-3-amine (0.50 g, 2.98 mmol), 4-trifluoromethylphenylboronic acid (0.85 g, 4.48 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl)[2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (0.07 g, 0.09 mmol) were dissolved in a degassed mixture of ethanol, water, and toluene (1:1:1, 20 mL total volume). Potassium phosphate solution (1 M in water, degassed) (6.00 mL, 6.00 mmol) was added and the mixture was stirred at 80 C. for 4 h. The mixture was concentrated in vacuo and purified by preparative HPLC (Method 1A) to yield the title compound (0.18 g, 22% of theory).
[0588] LC-MS (Method 1B): R.sub.t=0.99 min, MS (ESIPos): m/z=278 [M+H].sup.+
Example 82A
Tert-butyl 4-{2-oxo-10-[4-(trifluoromethyl)phenyl]-1,2-dihydropyrimido[1,2-b]indazol-4-yl}piperidine-1-carboxylate
[0589] ##STR00127##
[0590] 4-[4-(Trifluoromethyl)phenyl]-1H-indazol-3-amine (0.18 g, 0.65 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.25 g, 0.71 mmol) were dissolved in acetonitrile (5 mL) and refluxed for 6 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (10 mL). Potassium phosphate (0.29 g, 1.36 mmol) was added and the mixture was stirred at 120 C. for 6 h. Concentration in vacuo and purification by preparative HPLC (Method 1A) afforded the title compound (0.18 g, 53% of theory).
[0591] LC-MS (Method 1B): R.sub.t=1.38 min, MS (ESIPos): m/z=513 [M+H].sup.+
Example 83A
4-Phenyl-1H-indazol-3-amine
[0592] ##STR00128##
[0593] Under argon, 4-chloro-1H-indazol-3-amine (0.50 g, 2.98 mmol), phenylboronic acid (0.55 g, 4.48 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl) [2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (0.07 g, 0.09 mmol) were dissolved in a degassed mixture of ethanol, water, and toluene (1:1:1, 20 mL total volume). Potassium phosphate solution (1 M in water, degassed) (6.00 mL, 6.00 mmol) was added and the mixture was stirred at 80 C. for 4 h. The mixture was concentrated in vacuo and purified by preparative HPLC (Method 1A) to yield the title compound (0.35 g, 57% of theory).
[0594] LC-MS (Method 1B): R.sub.t=0.83 min, MS (ESIPos): m/z=210 [M+H].sup.+
Example 84A
Tert-butyl 4-(2-oxo-10-phenyl-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0595] ##STR00129##
[0596] 4-Phenyl-1H-indazol-3-amine (0.35 g, 1.69 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.66 g, 1.86 mmol) were dissolved in acetonitrile (10 mL) and refluxed for 6 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (10 mL). Potassium phosphate (0.75 g, 3.55 mmol) was added and the mixture was stirred at 120 C. for 6 h. Concentration in vacuo and purification by preparative HPLC (Method 1A) afforded the title compound (0.47 g, 60% of theory).
[0597] LC-MS (Method 1B): R.sub.t=1.23 min, MS (ESIPos): m/z=445 [M+H].sup.+
Example 85A
4-(2-Fluorophenyl)-1H-indazol-3-amine
[0598] ##STR00130##
[0599] Under argon, 4-chloro-1H-indazol-3-amine (0.50 g, 2.98 mmol), 2-fluorophenylboronic acid (0.63 g, 4.48 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl) [2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (0.07 g, 0.09 mmol) were dissolved in a degassed mixture of ethanol, water, and toluene (1:1:1, 20 mL total volume). Potassium phosphate solution (1 M in water, degassed) (6.00 mL, 6.00 mmol) was added and the mixture was stirred at 80 C. for 4 h. The mixture was concentrated in vacuo and purified by preparative HPLC (Method 1A) to yield the title compound (0.45 g, 66% of theory).
[0600] LC-MS (Method 2B): R.sub.t=2.07 min, MS (ESIPos): m/z=228 [M+H]+
Example 86A
Tert-butyl 4-[10-(2-fluorophenyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0601] ##STR00131##
[0602] 4-(2-Fluorophenyl)-1H-indazol-3-amine (0.45 g, 1.97 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.77 g, 2.17 mmol) were dissolved in acetonitrile (10 mL) and refluxed for 6 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (10 mL). Potassium phosphate (0.98 g, 4.60 mmol) was added and the mixture was stirred at 120 C. for 6 h. Concentration in vacuo and purification by preparative HPLC (Method 1A) afforded the title compound (0.59 g, 55% of theory).
[0603] LC-MS (Method 3B): R.sub.t=2.62 min, MS (ESIPos): m/z=463[M+H].sup.+
Example 87A
4-(Pyridin-3-yl)-1H-indazol-3-amine
[0604] ##STR00132##
[0605] Under argon, 4-chloro-1H-indazol-3-amine (0.50 g, 2.98 mmol), 3-pyridylboronic acid (0.55 g, 4.48 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl) [2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (0.07 g, 0.09 mmol) were dissolved in a degassed mixture of ethanol, water, and toluene (1:1:1, 20 mL total volume). Potassium phosphate solution (1 M in water, degassed) (6.00 mL, 6.00 mmol) was added and the mixture was stirred at 80 C. for 4 h. The mixture was concentrated in vacuo and purified by preparative HPLC (Method 1A) to yield the title compound (0.48 g, 77% of theory).
[0606] LC-MS (Method 2B): R.sub.t=1.63 min, MS (ESIPos): m/z=211 [M+H].sup.+
Example 88A
Tert-butyl 4-[2-oxo-10-(pyridin-3-yl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0607] ##STR00133##
[0608] 4-(Pyridin-3-yl)-1H-indazol-3-amine (0.48 g, 2.28 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.89 g, 2.51 mmol) were dissolved in acetonitrile (20 mL) and refluxed for 6 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (30 mL). Potassium phosphate (0.97 g, 4.56 mmol) was added and the mixture was stirred under reflux for 6 h. Concentration in vacuo and purification by preparative HPLC (Method 1A) afforded the title compound (0.48 g, 47% of theory).
Example 89A
4-(Pyridin-4-yl)-1H-indazol-3-amine
[0609] ##STR00134##
[0610] Under argon, 4-chloro-1H-indazol-3-amine (0.50 g, 2.98 mmol), 4-pyridylboronic acid (0.55 g, 4.48 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl) [2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (0.07 g, 0.09 mmol) were dissolved in a degassed mixture of ethanol, water, and toluene (1:1:1, 20 mL total volume). Potassium phosphate solution (1 M in water, degassed) (6.00 mL, 6.00 mmol) was added and the mixture was stirred at 80 C. for 4 h. The mixture was concentrated in vacuo and purified by preparative HPLC (Method 1A) to yield the title compound (0.33 g, 53% of theory).
[0611] LC-MS (Method 2B): R.sub.t=1.62 min, MS (ESIPos): m/z=211 [M+H].sup.+
Example 90A
Tert-butyl 4-(3-oxo-3-{[4-(pyridin-4-yl)-1H-indazol-3-yl]amino}propanoyl)piperidine-1-carboxylate
[0612] ##STR00135##
[0613] 4-(Pyridin-4-yl)-1H-indazol-3-amine (0.33 g, 1.58 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.62 g, 1.74 mmol) were dissolved in acetonitrile (15 mL) and refluxed for 6 h. Concentration in vacuo and purification by preparative HPLC (Method 1A) afforded the title compound (0.07 g, 10% of theory).
[0614] LC-MS (Method 1B): R.sub.t=0.73 min, MS (ESIPos): m/z=464 [M+H].sup.+
Example 91A
Tert-butyl 4-[2-oxo-10-(pyridin-4-yl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0615] ##STR00136##
[0616] Tert-butyl 4-(3-oxo-3-{[4-(pyridin-4-yl)-1H-indazol-3-yl]amino}propanoyl)piperidine-1-carboxylate (0.07 g, 0.15 mmol) was dissolved in 1-methoxy-2-propanol (2 mL). Potassium phosphate (0.06 g, 0.30 mmol) was added and the mixture was stirred at 100 C. for 4 h. Concentration in vacuo and purification by preparative HPLC (Method 1A) afforded the title compound (0.03 g, 67% of theory).
[0617] LC-MS (Method 1B): R.sub.t=0.86 min, MS (ESIPos): m/z=446 [M+H].sup.+
Example 92A
Tert-butyl 4-(10-bromo-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0618] ##STR00137##
[0619] 4-Bromo-1H-indazol-3-amine (2.00 g, 9.43 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (3.69 g, 10.38 mmol) were dissolved in acetonitrile (90 mL) and refluxed for 4 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (25 mL). Potassium phosphate (4.00 g, 18.9 mmol) was added and the mixture was stirred at reflux for 4 h. After concentration in vacuo, the residue was dissolved in water and extracted with ethyl acetate. The organic phase was washed with brine and dried over magnesium sulfate. Concentration in vacuo and purification by preparative HPLC (Method 1A) afforded the title compound in 93% purity. The solid was suspended in methanol, filtered, and dried to afford the title compound (0.86 g, 20% of theory).
[0620] LC-MS (Method 3B): R.sub.t=2.37 min, MS (ESIPos): m/z=447 [M+H].sup.+, 449 [M+H].sup.+
Example 93A
Tert-butyl 4-(10-cyclopropyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0621] ##STR00138##
[0622] Under argon, a mixture of tert-butyl 4-(10-chloro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (0.10 g, 0.25 mmol), palladium(II)acetate (1.7 mg, 7 mol), and 2-dicyclohexylphosphino-2,6-bis(N,N-dimethylamino)biphenyl (6.5 mg, 15 mol) in tetrahydrofuran (5 mL) was cooled to 0 C. Cyclopropylzinc bromide (0.5 M in tetrahydrofuran, 1.24 mL, 0.62 mmol) was added dropwise. After stirring for 4 h at RT, additional cyclopropylzinc bromide (0.5 M in tetrahydrofuran, 1.24 mL, 0.62 mmol) was added and the mixture was stirred at RT for 16 h. The mixture was quenched with water, extracted with ethyl acetate and dried over magnesium sulfate. Concentration in vacuo and purification by preparative HPLC (Method 1A) afforded the title compound (20 mg, 20% of theory).
[0623] LC-MS (Method 1B): R.sub.t=1.16 min, MS (ESIPos): m/z=409 [M+H].sup.+
Example 94A
Tert-butyl 4-(10-isopropyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0624] ##STR00139##
[0625] Under argon, a mixture of tert-butyl 4-(10-chloro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (0.10 g, 0.25 mmol), [(2-dicyclohexylphosphino-2,6-bis(N,N-dimethylamino)-1,1-biphenyl)-2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (0.04 g, 0.05 mmol), and 2-dicyclohexylphosphino-2,6-bis(N,N-dimethylamino)biphenyl (0.02 g, 0.05 mmol) was suspended in tetrahydrofuran (5 mL). Lithium chloride (0.5 M in tetrahydrofuran, 5.00 mL, 2.48 mmol) was added and the mixture was cooled to 0 C. Isopropylzinc bromide (0.5 M in tetrahydrofuran, 5.00 mL, 2.48 mmol) was added dropwise. After stirring at RT for 16 h, the mixture was quenched with water, extracted with ethyl acetate and dried over magnesium sulfate. Concentration in vacuo and purification by preparative HPLC (Method 1A) afforded the title compound (0.03 g, 33% of theory).
[0626] LC-MS (Method 1B): R.sub.t=1.21 min, MS (ESIPos): m/z=411 [M+H].sup.+
Example 95A
Tert-butyl 4-(10-cyclopentyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0627] ##STR00140##
[0628] Under argon, a mixture of tert-butyl 4-(10-chloro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (0.10 g, 0.25 mmol), [(2-dicyclohexylphosphino-2,6-bis(N,N-dimethylamino)-1,1-biphenyl)-2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (0.04 g, 0.05 mmol), and 2-dicyclohexylphosphino-2,6-bis(N,N-dimethylamino)biphenyl (0.02 g, 0.05 mmol) was suspended in tetrahydrofuran (5 mL). Lithium chloride (0.5 M in tetrahydrofuran, 5.00 mL, 2.48 mmol) was added and the mixture was cooled to 0 C. Cyclopentylzinc bromide (0.5 M in tetrahydrofuran, 5.00 mL, 2.48 mmol) was added dropwise. After stirring at RT for 16 h, the mixture was quenched with water, extracted with ethyl acetate and dried over magnesium sulfate. Concentration in vacuo and purification by preparative HPLC (Method 1A) afforded the title compound (0.02 g, 20% of theory).
[0629] LC-MS (Method 1B): R.sub.t=1.32 min, MS (ESIPos): m/z=437 [M+H].sup.+
Example 96A
4-(2-Chlorophenyl)-1H-indazol-3-amine
[0630] ##STR00141##
[0631] Under argon, 4-chloro-1H-indazol-3-amine (0.50 g, 2.98 mmol), 2-chlorophenylboronic acid (0.70 g, 4.48 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl)[2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (0.07 g, 0.09 mmol) were dissolved in a degassed mixture of ethanol, water, and toluene (1:1:1, 20 mL total volume). Potassium phosphate solution (1 M in water, degassed) (6.00 mL, 6.00 mmol) was added and the mixture was stirred at 80 C. for 4 h. The mixture was concentrated in vacuo and purified by preparative HPLC (Method 1A) to yield the title compound (0.31 g, 42% of theory).
[0632] LC-MS (Method 1B): R.sub.t=0.86 min, MS (ESIPos): m/z=244 [M+H].sup.+
Example 97A
Tert-butyl 4-[10-(2-chlorophenyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0633] ##STR00142##
[0634] 4-(2-Chlorophenyl)-1H-indazol-3-amine (0.30 g, 1.23 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.48 g, 1.35 mmol) were dissolved in acetonitrile (6 mL) and refluxed for 6 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (5 mL). Potassium phosphate (0.52 g, 2.46 mmol) was added and the mixture was stirred at 120 C. for 6 h. Concentration in vacuo and purification by preparative HPLC (Method 1A) afforded the title compound (0.30 g, 51% of theory).
[0635] LC-MS (Method 1B): R.sub.t=1.28 min, MS (ESIPos): m/z=479 [M+H].sup.+
Example 98A
4-(2-Methoxyphenyl)-1H-indazol-3-amine
[0636] ##STR00143##
[0637] Under argon, 4-chloro-1H-indazol-3-amine (0.50 g, 2.98 mmol), 2-methoxyphenylboronic acid (0.68 g, 4.48 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl) [2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (0.07 g, 0.09 mmol) were dissolved in a degassed mixture of ethanol, water, and toluene (1:1:1, 20 mL total volume). Potassium phosphate solution (1 M in water, degassed) (6.00 mL, 6.00 mmol) was added and the mixture was stirred at 80 C. for 4 h. The mixture was concentrated in vacuo and purified by preparative HPLC (Method 1A) to yield the title compound (0.52 g, 72% of theory).
[0638] LC-MS (Method 1B): R.sub.t=0.77 min, MS (ESIPos): m/z=240 [M+H].sup.+
Example 99A
Tert-butyl 4-[10-(2-methoxyphenyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0639] ##STR00144##
[0640] 4-(2-Methoxyphenyl)-1H-indazol-3-amine (0.51 g, 2.13 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.83 g, 2.35 mmol) were dissolved in acetonitrile (11 mL) and refluxed for 6 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (9 mL). Potassium phosphate (0.90 g, 4.26 mmol) was added and the mixture was stirred at 120 C. for 6 h. Concentration in vacuo and purification by preparative HPLC (Method 1A) afforded the title compound (0.20 g, 20% of theory).
[0641] LC-MS (Method 1B): R.sub.t=1.22 min, MS (ESIPos): m/z=475 [M+H].sup.+
Example 100A
4-[2-(Trifluoromethyl)phenyl]-1H-indazol-3-amine
[0642] ##STR00145##
[0643] Under argon, 4-chloro-1H-indazol-3-amine (0.50 g, 2.98 mmol), 2-trifluoromethylphenylboronic acid (0.85 g, 4.48 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl)[2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (0.07 g, 0.09 mmol) were dissolved in a degassed mixture of ethanol, water, and toluene (1:1:1, 20 mL total volume). Potassium phosphate solution (1 M in water, degassed) (6.00 mL, 6.00 mmol) was added and the mixture was stirred at 80 C. for 4 h. The mixture was concentrated in vacuo and purified by preparative HPLC (Method 1A) to yield the title compound (0.31 g, 37% of theory).
[0644] LC-MS (Method 1B): R.sub.t=0.89 min, MS (ESIPos): m/z=278 [M+H].sup.+
Example 101A
Tert-butyl 4-{2-oxo-10-[2-(trifluoromethyl)phenyl]-1,2-dihydropyrimido[1,2-b]indazol-4-yl}piperidine-1-carboxylate
[0645] ##STR00146##
[0646] 4-[2-(Trifluoromethyl)phenyl]-1H-indazol-3-amine (0.31 g, 1.10 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.43 g, 1.21 mmol) were dissolved in acetonitrile (6 mL) and refluxed for 6 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (5 mL). Potassium phosphate (0.47 g, 2.20 mmol) was added and the mixture was stirred at 120 C. for 6 h. Concentration in vacuo and purification by preparative HPLC (Method 1A) afforded the title compound (0.10 g, 18% of theory).
[0647] LC-MS (Method 1B): R.sub.t=1.26 min, MS (ESIPos): m/z=513 [M+H].sup.+
Example 102A
2-Chloro-6-fluoro-3-methylbenzaldehyde
[0648] ##STR00147##
[0649] 2-Chloro-4-fluoro-1-methylbenzene (5.00 g, 34.6 mmol) was dissolved in tetrahydrofuran (100 mL) and cooled to 78 C. Lithium diisopropyl amide (1.8 M in tetrahydrofuran, 21.1 mL, 38.0 mmol) was added. After stirring at 78 C. for 30 min, N,N-dimethylformamide (3.03 g, 41.5 mmol) was added. After stirring at 78 C. for an additional 15 min, acetic acid (8 mL) and water (100 mL) was added and the mixture was warmed to RT. After extraction with ethyl acetate, the organic phase was washed with 1 M hydrochloride acid solution and brine, and dried over magnesium sulfate. Concentration in vacuo afforded the title compound (3.25 g, 49% of theory) in a purity of 90%.
[0650] GC-MS (Method 1G): R.sub.t=3.90 min, MS (ESINeg): m/z=171 [MH].sup.
Example 103A
2-Chloro-6-fluoro-3-methylbenzonitrile
[0651] ##STR00148##
[0652] A mixture of 2-chloro-6-fluoro-3-methylbenzaldehyde (90% purity, 3.25 g, 18.8 mmol), sodium lauryl sulfate (1.09 g, 3.77 mmol), (Diacetoxyiodo)benzene (9.10 g, 28.2 mmol) and ammonium acetate (7.26 g, 94.2 mmol) in water (20 mL) was stirred at 70 C. for 30 min. After cooling to RT, a solution of sodium thiosulfate (3.33 g, 21.1 mmol) in water (3.5 mL) was added and the mixture was stirred at RT for 15 min. After extraction with dichloromethane, the organic phase was dried over magnesium sulfate. Concentration in vacuo and purification by preparative HPLC (Method 1A) afforded the title compound (1.26 g, 39% of theory).
[0653] GC-MS (Method 1G): R.sub.t=3.94 min, MS (ESIPos): m/z=169 [M+H].sup.+
Example 104A
4-Chloro-5-methyl-1H-indazol-3-amine
[0654] ##STR00149##
[0655] 2-chloro-6-fluoro-3-methylbenzonitrile (1.26 g, 7.43 mmol) was dissolved in ethanol (10 mL) and treated with hydrazine hydrate (1.49 g, 29.7 mmol). After stirring at reflux for 4 h, the mixture was cooled to RT and concentrated in vacuo. The residue was dissolved in a mixture of water and ethyl acetate. The aqueous layer was extracted once more with ethyl acetate. The combined organic layers were washed with water and with brine, dried over magnesium sulfate, concentrated in vacuo and dried to yield the title compound (1.06 g, 79% of theory) in a purity of 75%.
[0656] LC-MS (Method 2B): R.sub.t=1.85 min, MS (ESIPos): m/z=182 [M+H].sup.+
Example 105A
Tert-butyl 4-(10-chloro-9-methyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0657] ##STR00150##
[0658] 4-Chloro-5-methyl-1H-indazol-3-amine (75% purity, 1.06 g, 4.38 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (2.29 g, 6.42 mmol) were dissolved in acetonitrile (50 mL) and refluxed for 4 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (20 mL). Potassium phosphate (2.36 g, 11.1 mmol) was added and the mixture was stirred at reflux for 4 h. After concentration in vacuo, the residue was dissolved in water and extracted with ethyl acetate. The organic phase was washed with brine and dried over magnesium sulfate. Concentration in vacuo and recrystallization from acetonitrile/methanol afforded the title compound (0.76 g, 33% of theory).
[0659] LC-MS (Method 1B): R.sub.t=1.16 min, MS (ESIPos): m/z=417 [M+H].sup.+
Example 106A
2-Bromo-3,6-difluorobenzaldehyde
[0660] ##STR00151##
[0661] 2-Bromo-1,4-difluorobenzene (5.00 g, 25.9 mmol) was dissolved in tetrahydrofuran (100 mL) and cooled to 78 C. Lithium diisopropyl amide (1.8 M in tetrahydrofuran, 15.8 mL, 28.5 mmol) was added. After stirring at 78 C. for 30 min, N,N-dimethylformamide (2.28 g, 31.1 mmol) was added. After stirring at 78 C. for an additional 15 min, acetic acid (6 mL) and water (100 mL) was added and the mixture was warmed to RT. After extraction with ethyl acetate, the organic phase was washed with 1 M hydrochloride acid solution and brine, and dried over magnesium sulfate. Concentration in vacuo afforded the title compound (2.72 g, 42% of theory) in a purity of 90%.
[0662] GC-MS (Method 2G): R.sub.t=3.40 min, MS (ESIPos): m/z=221 [M+H].sup.+
Example 107A
2-Bromo-3,6-difluorobenzonitrile
[0663] ##STR00152##
[0664] A mixture of 2-bromo-3,6-difluorobenzaldehyde (90% purity, 2.72 g, 11.1 mmol), sodium lauryl sulfate (0.71 g, 2.46 mmol), (Diacetoxyiodo)benzene (5.95 g, 18.5 mmol) and ammonium acetate (4.74 g, 61.5 mmol) in water (13 mL) was stirred at 70 C. for 30 min. After cooling to RT, a solution of sodium thiosulfate (2.18 g, 13.8 mmol) in water (2.3 mL) was added and the mixture was stirred at RT for 15 min. After extraction with dichloromethane, the organic phase was dried over magnesium sulfate. Concentration in vacuo and purification by preparative HPLC (Method 1A) afforded the title compound (1.32 g, 44% of theory).
[0665] GC-MS (Method 1G): R.sub.t=3.73 min, MS (ESIPos): m/z=217 [M+H].sup.+
Example 108A
4-Bromo-5-fluoro-1H-indazol-3-amine
[0666] ##STR00153##
[0667] 2-Bromo-3,6-difluorobenzonitrile (1.32 g, 6.06 mmol) was dissolved in ethanol (10 mL) and treated with hydrazine hydrate (1.21 g, 24.2 mmol). After stirring at reflux for 4 h, the mixture was cooled to RT and concentrated in vacuo. The residue was dissolved in a mixture of water and ethyl acetate. The aqueous layer was extracted once more with ethyl acetate. The combined organic layers were washed with water and with brine, dried over magnesium sulfate, concentrated in vacuo and dried to yield the title compound (1.25 g, 83% of theory) in a purity of 92%.
[0668] LC-MS (Method 2B): R.sub.t=1.78 min, MS (ESIPos): m/z=230 [M+H]+
Example 109A
Tert-butyl 4-(10-bromo-9-fluoro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0669] ##STR00154##
[0670] 4-Bromo-5-fluoro-1H-indazol-3-amine (92% purity, 1.25 g, 5.01 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (2.13 g, 6.00 mmol) were dissolved in acetonitrile (50 mL) and refluxed for 4 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (20 mL). Potassium phosphate (2.42 g, 11.4 mmol) was added and the mixture was stirred at reflux for 4 h. After concentration in vacuo, the residue was dissolved in water and extracted with ethyl acetate. The organic phase was washed with brine and dried over magnesium sulfate. Concentration in vacuo and recrystallization from acetonitrile/methanol afforded the title compound (0.70 g, 29% of theory).
[0671] LC-MS (Method 1B): R.sub.t=1.16 min, MS (ESIPos): m/z=466 [M+H].sup.+
Example 110A
6-Bromo-2,3-difluorobenzaldehyde
[0672] ##STR00155##
[0673] 4-Bromo-1,2-difluorobenzene (5.00 g, 25.9 mmol) was dissolved in tetrahydrofuran (100 mL) and cooled to 78 C. Lithium diisopropyl amide (1.8 M in tetrahydrofuran, 15.8 mL, 28.5 mmol) was added. After stirring at 78 C. for 30 min, N,N-dimethylformamide (2.28 g, 31.1 mmol) was added. After stirring at 78 C. for an additional 15 min, acetic acid (6 mL) and water (100 mL) was added and the mixture was warmed to RT. After extraction with ethyl acetate, the organic phase was washed with 1 M hydrochloride acid solution and brine, and dried over magnesium sulfate. Concentration in vacuo afforded the title compound (2.59 g, 52% of theory).
[0674] GC-MS (Method 2G): R.sub.t=3.28 min, MS (ESIPos): m/z=221 [M+H].sup.+
Example 111A
6-Bromo-2,3-difluorobenzonitrile
[0675] ##STR00156##
[0676] A mixture of 6-bromo-2,3-difluorobenzaldehyde (2.59 g, 11.7 mmol), sodium lauryl sulfate (0.68 g, 2.34 mmol), (Diacetoxyiodo)benzene (5.66 g, 17.6 mmol) and ammonium acetate (4.52 g, 58.6 mmol) in water (12 mL) was stirred at 70 C. for 30 min. After cooling to RT, a solution of sodium thiosulfate (2.08 g, 13.1 mmol) in water (2.2 mL) was added and the mixture was stirred at RT for 15 min. After extraction with dichloromethane, the organic phase was dried over magnesium sulfate. Concentration in vacuo and purification by preparative HPLC (Method 1A) afforded the title compound (0.78 g, 31% of theory).
[0677] GC-MS (Method 1G): R.sub.t=3.59 min, MS (ESIPos): m/z=217 [M+H].sup.+
Example 112A
4-Bromo-7-fluoro-1H-indazol-3-amine
[0678] ##STR00157##
[0679] 6-Bromo-2,3-difluorobenzonitrile (0.78 g, 3.58 mmol) was dissolved in ethanol (10 mL) and treated with hydrazine hydrate (0.72 g, 14.3 mmol). After stirring at reflux for 4 h, the mixture was cooled to RT and concentrated in vacuo. The residue was dissolved in a mixture of water and ethyl acetate. The aqueous layer was extracted once more with ethyl acetate. The combined organic layers were washed with water and with brine, dried over magnesium sulfate, concentrated in vacuo and dried to yield the title compound (0.77 g, 94% of theory).
[0680] LC-MS (Method 2B): R.sub.t=1.83 min, MS (ESIPos): m/z=230 [M+H].sup.+
Example 113A
Tert-butyl 4-(10-bromo-7-fluoro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0681] ##STR00158##
[0682] 4-Bromo-7-fluoro-1H-indazol-3-amine (0.77 g, 3.36 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (1.31 g, 3.70 mmol) were dissolved in acetonitrile (30 mL) and refluxed for 4 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (10 mL). Potassium phosphate (1.37 g, 6.46 mmol) was added and the mixture was stirred at reflux for 4 h. After concentration in vacuo, the residue was dissolved in water and extracted with ethyl acetate. The organic phase was washed with brine and dried over magnesium sulfate. Concentration in vacuo and recrystallization from acetonitrile/methanol afforded the title compound (0.48 g, 32% of theory).
[0683] LC-MS (Method 1B): R.sub.t=1.16 min, MS (ESIPos): m/z=465 [M+H].sup.+
Example 114A
Tert-butyl 4-(10-sec-butyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0684] ##STR00159##
[0685] Under argon, a mixture of tert-butyl 4-(10-chloro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (0.11 g, 0.27 mmol), [(2-dicyclohexylphosphino-2,6-bis(N,N-dimethylamino)-1,1-biphenyl)-2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (0.04 g, 0.055 mmol), and 2-dicyclohexylphosphino-2,6-bis(N,N-dimethylamino)biphenyl (0.02 g, 0.055 mmol) was suspended in tetrahydrofuran (5 mL). Lithium chloride (0.5 M in tetrahydrofuran, 5.50 mL, 2.73 mmol) was added and the mixture was cooled to 0 C. Isopropylzinc bromide (0.5 M in tetrahydrofuran, 5.50 mL, 2.73 mmol) was added dropwise. After stirring at RT for 16 h, the mixture was quenched with water, extracted with ethyl acetate and dried over magnesium sulfate. Concentration in vacuo and purification by preparative HPLC (Method 1A) afforded the title compound (28 mg, 24% of theory).
[0686] LC-MS (Method 1B): R.sub.t=1.26 min, MS (ESIPos): m/z=425 [M+H].sup.+
Example 115A
Tert-butyl 4-(10-isobutyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0687] ##STR00160##
[0688] Under argon, a mixture of tert-butyl 4-(10-chloro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (0.20 g, 0.50 mmol), [(2-dicyclohexylphosphino-2,6-bis(N,N-dimethylamino)-1,1-biphenyl)-2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (0.08 g, 0.10 mmol), and 2-dicyclohexylphosphino-2,6-bis(N,N-dimethylamino)biphenyl (0.04 g, 0.10 mmol) was suspended in tetrahydrofuran (10 mL). Lithium chloride (0.5 M in tetrahydrofuran, 9.90 mL, 4.96 mmol) was added and the mixture was cooled to 0 C. Isopropylzinc bromide (0.5 M in tetrahydrofuran, 9.90 mL, 4.96 mmol) was added dropwise. After stirring at RT for 16 h, the mixture was quenched with water, extracted with ethyl acetate and dried over magnesium sulfate. Concentration in vacuo and purification by preparative HPLC (Method 1A) afforded the title compound (98 mg, 47% of theory).
[0689] LC-MS (Method 1B): R.sub.t=1.30 min, MS (ESIPos): m/z=425 [M+H].sup.+
Example 116A
2-Bromo-6-fluoro-3-methylbenzaldehyde
[0690] ##STR00161##
[0691] 2-Bromo-4-fluoro-1-methylbenzene (5.00 g, 25.9 mmol) was dissolved in tetrahydrofuran (100 mL) and cooled to 78 C. Lithium diisopropyl amide (1.8 M in tetrahydrofuran, 16.2 mL, 29.1 mmol) was added. After stirring at 78 C. for 30 min, N,N-dimethylformamide (2.32 g, 31.7 mmol) was added. After stirring at 78 C. for an additional 15 min, acetic acid (6 mL) and water (100 mL) was added and the mixture was warmed to RT. After extraction with ethyl acetate, the organic phase was washed with 1 M hydrochloride acid solution and brine, and dried over magnesium sulfate. Concentration in vacuo afforded the title compound (6.05 g, 84% of theory) in a purity of 80%.
[0692] GC-MS (Method 1G): R.sub.t=4.38 min, MS (ESIPos): m/z=217 [M+H].sup.+
Example 117A
2-Bromo-6-fluoro-3-methylbenzonitrile
[0693] ##STR00162##
[0694] A mixture of 2-bromo-3,6-difluorobenzaldehyde (80% purity, 6.05 g, 22.2 mmol), sodium lauryl sulfate (1.61 g, 5.57 mmol), (Diacetoxyiodo)benzene (13.5 g, 41.8 mmol) and ammonium acetate (10.7 g, 139.4 mmol) in water (30 mL) was stirred at 70 C. for 30 min. After cooling to RT, a solution of sodium thiosulfate (4.94 g, 31.2 mmol) in water (5 mL) was added and the mixture was stirred at RT for 15 min. After extraction with dichloromethane, the organic phase was dried over magnesium sulfate and concentrated in vacuo. A portion of the residue was purified by preparative HPLC (Method 1A) to afford the title compound (1.03 g).
[0695] GC-MS (Method 1G): R.sub.t=4.46 min, MS (ESIPos): m/z=213 [M+H].sup.+
Example 118A
4-Bromo-5-methyl-1H-indazol-3-amine
[0696] ##STR00163##
[0697] 2-Bromo-6-fluoro-3-methylbenzonitrile (0.30 g, 1.40 mmol) was dissolved in ethanol (2 mL) and treated with hydrazine hydrate (0.28 g, 5.6 mmol). After stirring at reflux for 4 h, the mixture was cooled to RT and concentrated in vacuo. The residue was dissolved in a mixture of water and ethyl acetate. The aqueous layer was extracted once more with ethyl acetate. The combined organic layers were washed with water and with brine, dried over magnesium sulfate, concentrated in vacuo and dried to yield the title compound (0.28 g, 62% of theory) in a purity of 70%.
[0698] LC-MS (Method 2B): R.sub.t=1.90 min, MS (ESIPos): m/z=226 [M+H].sup.+
Example 119A
Tert-butyl 4-(10-bromo-9-methyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0699] ##STR00164##
[0700] 4-Bromo-5-methyl-1H-indazol-3-amine (70% purity, 0.28 g, 0.86 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.48 g, 1.36 mmol) were dissolved in acetonitrile (12 mL) and refluxed for 4 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (5 mL). Potassium phosphate (0.53 g, 2.47 mmol) was added and the mixture was stirred at 70 C. for 6 h. Concentration in vacuo and purification via preparative HPLC (Method 1A) afforded the title compound (0.22 g, 56% of theory).
[0701] LC-MS (Method 1B): R.sub.t=1.21 min, MS (ESIPos): m/z=461 [M+H].sup.+
Example 120A
6-Bromo-2-fluoro-3-methylbenzaldehyde
[0702] ##STR00165##
[0703] 4-Bromo-2-fluoro-1-methylbenzene (5.00 g, 26.5 mmol) was dissolved in tetrahydrofuran (100 mL) and cooled to 78 C. Lithium diisopropyl amide (1.8 M in tetrahydrofuran, 16.2 mL, 29.1 mmol) was added. After stirring at 78 C. for 30 min, N,N-dimethylformamide (2.32 g, 31.7 mmol) was added. After stirring at 78 C. for an additional 15 min, acetic acid (6 mL) and water (100 mL) was added and the mixture was warmed to RT. After extraction with ethyl acetate, the organic phase was washed with 1 M hydrochloride acid solution and brine, and dried over magnesium sulfate. Concentration in vacuo afforded the title compound (5.63 g, 83% of theory) in a purity of 85%.
[0704] GC-MS (Method 1G): R.sub.t=4.35 min, MS (ESIPos): m/z=217 [M+H].sup.+
Example 121A
6-Bromo-2-fluoro-3-methylbenzonitrile
[0705] ##STR00166##
[0706] A mixture of 6-bromo-2-fluoro-3-methylbenzaldehyde (85% purity, 5.63 g, 22.1 mmol), sodium lauryl sulfate (1.50 g, 5.19 mmol), (Diacetoxyiodo)benzene (12.5 g, 38.9 mmol) and ammonium acetate (10.0 g, 129.7 mmol) in water (30 mL) was stirred at 70 C. for 30 min. After cooling to RT, a solution of sodium thiosulfate (4.60 g, 29.1 mmol) in water (5 mL) was added and the mixture was stirred at RT for 15 min. After extraction with dichloromethane, the organic phase was dried over magnesium sulfate and concentrated in vacuo. A portion of the residue was purified by preparative HPLC (Method 1A) to afford the title compound (0.45 g).
Example 122A
Tert-butyl 4-(10-bromo-7-methyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0707] ##STR00167##
[0708] 6-Bromo-2-fluoro-3-methylbenzonitrile (0.45 g, 2.09 mmol) was dissolved in ethanol (3 mL) and treated with hydrazine hydrate (0.42 g, 8.37 mmol). After stirring at reflux for 4 h, the mixture was cooled to RT and concentrated in vacuo. The residue was dissolved in a mixture of water and ethyl acetate. The aqueous layer was extracted once more with ethyl acetate. The combined organic layers were washed with water and with brine, dried over magnesium sulfate, and concentrated in vacuo.
[0709] The residue and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.82 g, 2.30 mmol) were dissolved in acetonitrile (20 mL) and refluxed for 4 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (9 mL). Potassium phosphate (0.89 g, 4.17 mmol) was added and the mixture was stirred at 70 C. for 6 h. Concentration in vacuo and purification via preparative HPLC (Method 1A) afforded the title compound (0.47 g, 49% of theory).
[0710] LC-MS (Method 1B): R.sub.t=1.25 min, MS (ESIPos): m/z=461 [M+H].sup.+
Example 123A
4-Isopropoxy-1H-indazol-3-amine
[0711] ##STR00168##
[0712] 2-Fluoro-6-isopropoxybenzonitrile (0.50 g, 2.79 mmol) was dissolved in ethanol (10 mL) and treated with hydrazine hydrate (0.56 g, 11.2 mmol). After stirring at reflux for 8 h, the mixture was cooled to RT and concentrated in vacuo. The residue was dissolved in a mixture of water and ethyl acetate. The aqueous layer was extracted once more with ethyl acetate. The combined organic layers were washed with water and with brine, dried over magnesium sulfate, concentrated in vacuo and dried to yield the title compound (0.53 g, 90% of theory) in a purity of 90%.
[0713] LC-MS (Method 2B): R.sub.t=1.90 min, MS (ESIPos): m/z=192 [M+H].sup.+
Example 124A
Tert-butyl 4-(10-isopropoxy-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0714] ##STR00169##
[0715] 4-Isopropoxy-1H-indazol-3-amine (90% purity, 0.52 g, 2.45 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (1.06 g, 2.99 mmol) were dissolved in acetonitrile (25 mL) and refluxed for 4 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (20 mL). Potassium phosphate (0.82 g, 3.88 mmol) was added and the mixture was stirred at 70 C. for 6 h. Concentration in vacuo and purification via preparative HPLC (Method 1A) afforded the title compound (0.14 g, 18% of theory).
[0716] LC-MS (Method 1B): R.sub.t=1.16 min, MS (ESIPos): m/z=427 [M+H].sup.+
Example 125A
Tert-butyl 4-(9-fluoro-2-oxo-10-phenyl-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0717] ##STR00170##
[0718] Under argon, tert-butyl 4-(10-bromo-9-fluoro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (0.15 g, 0.32 mmol), phenylboronic acid (0.043 g, 0.36 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl) [2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (8 mg, 10 mol) were dissolved in degassed tetrahydrofuran (3 mL). Potassium phosphate solution (1 M in water, degassed) (1.90 mL, 1.90 mmol) was added and the mixture was stirred at 40 C. for 10 min. The mixture was diluted with water, and extracted with dichloromethane. The organic phase was dried over magnesium sulfate and concentrated in vacuo. Purification by preparative HPLC (Method 1A) afforded the title compound (69 mg, 46% of theory).
[0719] LC-MS (Method 1B): R.sub.t=1.21 min, MS (ESIPos): m/z=463 [M+H].sup.+
Example 126A
2,3,6-Trifluorobiphenyl-2-carbonitrile
[0720] ##STR00171##
[0721] Under argon, 2-bromo-6-fluorobenzonitrile (0.50 g, 2.50 mmol), 2,6-difluorophenylboronic acid (0.443 g, 2.75 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl)[2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (63 mg, 0.08 mmol) were dissolved in degassed tetrahydrofuran (30 mL). Potassium phosphate solution (1 M in water, degassed) (14.8 mL, 14.8 mmol) was added and the mixture was stirred at RT for 16 h. The mixture was concentrated in vacuo. Purification by preparative HPLC (Method 1A) afforded the title compound (0.19 g, 32% of theory).
[0722] GC-MS (Method 1G): R.sub.t=5.34 min, MS (ESIPos): m/z=233 [M]
Example 127A
Tert-butyl 4-[10-(2,6-difluorophenyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0723] ##STR00172##
[0724] 2,3,6-Trifluorobiphenyl-2-carbonitrile (0.19 g, 0.79 mmol) was dissolved in ethanol (1 mL) and treated with hydrazine hydrate (0.16 g, 3.17 mmol). After stirring at reflux for 4 h, an additional portion of hydrazine hydrate (0.16 g, 3.17 mmol) was added at RT and stirring was resumed at reflux for 4 h. The mixture was cooled to RT and concentrated in vacuo. The residue was dissolved in a mixture of water and ethyl acetate. The aqueous layer was extracted once more with ethyl acetate. The combined organic layers were washed with water and with brine, dried over magnesium sulfate, and concentrated in vacuo. The residue and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.31 g, 0.87 mmol) were dissolved in acetonitrile (8 mL) and refluxed for 4 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (5 mL). Potassium phosphate (0.33 g, 1.58 mmol) was added and the mixture was stirred at 70 C. for 6 h. Concentration in vacuo and purification via preparative HPLC (Method 1A) afforded the title compound (0.11 g, 28% of theory).
[0725] LC-MS (Method 1B): R.sub.t=1.23 min, MS (ESIPos): m/z=481 [M+H].sup.+
Example 128A
2-Chloro-6-fluoro-4-methylbenzaldehyde
[0726] ##STR00173##
[0727] 1-Chloro-3-fluoro-5-methylbenzene (5.00 g, 34.6 mmol) was dissolved in tetrahydrofuran (100 mL) and cooled to 78 C. Lithium diisopropyl amide (1.8 M in tetrahydrofuran, 21.1 mL, 38.0 mmol) was added. After stirring at 78 C. for 30 min, N,N-dimethylformamide (3.03 g, 41.5 mmol) was added. After stirring at 78 C. for an additional 15 min, acetic acid (8 mL) and water (100 mL) was added and the mixture was warmed to RT. After extraction with ethyl acetate, the organic phase was washed with 1 M hydrochloride acid solution and brine, and dried over magnesium sulfate. Concentration in vacuo afforded the title compound (2.83 g, 43% of theory) in a purity of 90%.
[0728] GC-MS (Method 1G): R.sub.t=3.91 min, MS (ESIPos): m/z=171 [M+H].sup.+
Example 129A
2-Chloro-6-fluoro-4-methylbenzonitrile
[0729] ##STR00174##
[0730] A mixture of 2-chloro-6-fluoro-4-methylbenzaldehyde (90% purity, 2.80 g, 14.6 mmol), sodium lauryl sulfate (0.94 g, 3.25 mmol), (Diacetoxyiodo)benzene (7.4 g, 24.3 mmol) and ammonium acetate (6.25 g, 81.1 mmol) in water (20 mL) was stirred at 70 C. for 30 min. After extraction with dichloromethane, the organic phase was dried over magnesium sulfate and concentrated in vacuo. Purification by preparative HPLC (Method 1A) afforded the title compound (1.34 g).
[0731] GC-MS (Method 1G): R.sub.t=3.92 min, MS (ESIPos): m/z=169 [M+H].sup.+
Example 130A
4-Chloro-6-methyl-1H-indazol-3-amine
[0732] ##STR00175##
2-Chloro-6-fluoro-4-methylbenzonitrile (1.33 g, 7.84 mmol) was dissolved in ethanol (40 mL) and treated with hydrazine hydrate (1.57 g, 31.3 mmol). After stirring at reflux for 4 h, the mixture was cooled to RT and concentrated in vacuo. The residue was dissolved in a mixture of water and ethyl acetate. The aqueous layer was extracted once more with ethyl acetate. The combined organic layers were washed with water and with brine, dried over magnesium sulfate, concentrated in vacuo and dried to yield the title compound (1.20 g, 85% of theory).
[0733] LC-MS (Method 2B): R.sub.t=1.88 min, MS (ESIPos): m/z=182 [M+H].sup.+
Example 131A
Tert-butyl 4-(10-chloro-8-methyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0734] ##STR00176##
[0735] 4-Chloro-6-methyl-1H-indazol-3-amine (0.40 g, 2.20 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.86 g, 2.42 mmol) were dissolved in acetonitrile (18 mL) and refluxed for 2 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (18 mL). Potassium phosphate (0.74 g, 3.47 mmol) was added and the mixture was stirred at 70 C. for 6 h. After concentration in vacuo, the residue was taken up in water and extracted with dichloromethane. The organic phase was dried over magnesium sulfate and concentrated in vacuo. Purification via preparative HPLC (Method 1A) afforded the title compound (0.32 g, 45% of theory).
[0736] LC-MS (Method 1B): R.sub.t=1.15 min, MS (ESIPos): m/z=417 [M+H].sup.+
Example 132A
Tert-butyl 4-{2-oxo-10-[2-(trifluoromethoxy)phenyl]-1,2-dihydropyrimido[1,2-b]indazol-4-yl}piperidine-1-carboxylate
[0737] ##STR00177##
[0738] Under argon, tert-butyl 4-(10-bromo-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (0.20 g, 0.48 mmol), 2-trifluoromethoxyphenylboronic acid (0.10 g, 0.49 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl) [2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (11 mg, 13 mol) were dissolved in degassed tetrahydrofuran (4 mL). Potassium phosphate solution (1 M in water, degassed) (2.55 mL, 2.55 mmol) was added and the mixture was stirred at 40 C. for 2.5 h. The mixture was diluted with water, and extracted with ethyl acetate. The organic phase was dried over magnesium sulfate and concentrated in vacuo. Purification by preparative HPLC (Method 1A) afforded the title compound (107 mg, 45% of theory).
[0739] LC-MS (Method 1B): R.sub.t=1.27 min, MS (ESIPos): m/z=529 [M+H].sup.+
Example 133A
2-Bromo-4,6-difluorobenzaldehyde
[0740] ##STR00178##
[0741] 1-Bromo-3,5-difluoro-2-iodobenzene (5.00 g, 15.7 mmol) was dissolved in 2-methyltetrahydrofuran (30 mL) and cooled to 0 C. Isopropylmagnesium chloride lithium chloride complex (1.3 M in tetrahydrofuran, 12.7 mL, 16.5 mmol) was added dropwise. After stirring at 0 C. for 30 min, 4-formylmorpholine (1.99 g, 17.2 mmol) was added. The mixture was warmed to RT and stirred at RT for 4 h. The mixture was quenched with hydrochloric acid (1M in water), diluted with water, and extracted with ethyl acetate. The organic phase was washed with hydrochloric acid (1M in water), water, and brine, and dried over magnesium sulfate. Concentration in vacuo afforded the title compound (2.70 g, 70% of theory) in a purity of 92%.
[0742] GC-MS (Method 1G): R.sub.t=3.37 min, MS (ESIPos): m/z=219 [M+H].sup.+
Example 134A
2-Bromo-4,6-difluorobenzonitrile
[0743] ##STR00179##
[0744] A mixture of 2-bromo-4,6-difluorobenzaldehyde (92% purity, 2.68 g, 11.1 mmol), sodium lauryl sulfate (0.70 g, 2.43 mmol), (Diacetoxyiodo)benzene (5.86 g, 18.2 mmol) and ammonium acetate (4.67 g, 60.6 mmol) in water (20 mL) was stirred at 70 C. for 30 min. After extraction with dichloromethane, the organic phase was dried over magnesium sulfate and concentrated in vacuo to afford the title compound (0.50 g, 16% of theory) in a purity of 90%.
[0745] GC-MS (Method 1G): R.sub.t=3.36 min, MS (ESIPos): m/z=217 [M+H].sup.+
Example 135A
4-Bromo-6-fluoro-1H-indazol-3-amine
[0746] ##STR00180##
[0747] 2-Bromo-4,6-difluorobenzonitrile (90% purity, 0.45 g, 1.85 mmol) was dissolved in ethanol (10 mL) and treated with hydrazine hydrate (0.41 g, 8.3 mmol). After stirring at reflux for 4 h, the mixture was cooled to RT and concentrated in vacuo. The residue was dissolved in a mixture of water and ethyl acetate. The aqueous layer was extracted once more with ethyl acetate. The combined organic layers were washed with water and with brine, dried over magnesium sulfate, concentrated in vacuo and dried to yield a mixture containing the title compound (0.38 g, 20% of theory) in a purity of 25% which was taken to the next step without further purification.
[0748] LC-MS (Method 2B): R.sub.t=1.86 min, MS (ESIPos): m/z=230 [M+H].sup.+
Example 136A
Tert-butyl 4-(10-bromo-8-fluoro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0749] ##STR00181##
[0750] 4-Bromo-6-fluoro-1H-indazol-3-amine (25% purity, 0.38 g, 0.41 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.65 g, 1.82 mmol) were dissolved in acetonitrile (10 mL) and refluxed for 2 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (10 mL). Potassium phosphate (0.49 g, 2.32 mmol) was added and the mixture was stirred at 100 C. for 2 h. After concentration in vacuo, the residue was taken up in water and extracted with ethyl acetate. The organic phase was washed with water and brine, dried over magnesium sulfate, and concentrated in vacuo. Purification via preparative HPLC (Method 1A) afforded the title compound (23 mg, 17% of theory).
[0751] LC-MS (Method 1B): R.sub.t=1.19 min, MS (ESIPos): m/z=465 [M+H].sup.+
Example 137A
2-Fluoro-6-(pyridin-2-yl)benzonitrile
[0752] ##STR00182##
[0753] Under argon, 2-pyridylzinc bromide (0.5 M in tetrahydrofuran, 13 mL, 6.5 mmol) was diluted with tetrahydrofuran (10 mL), and 2-bromo-6-fluorobenzonitrile (1.00 g, 5.00 mmol), (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl)[2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (127 mg, 150 mol), 2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl (72 mg, 150 mol) were added. After stirring at RT for 16 h, the mixture was diluted with ethyl acetate. The organic phase was washed with water and brine, dried over magnesium sulfate, and concentrated in vacuo. Purification via preparative HPLC (Method 1A) afforded the title compound (263 mg, 27% of theory).
[0754] LC-MS (Method 3B): R.sub.t=1.81 min, MS (ESIPos): m/z=199 [M+H].sup.+
Example 138A
4-(Pyridin-2-yl)-1H-indazol-3-amine
[0755] ##STR00183##
[0756] 2-Fluoro-6-(pyridin-2-yl)benzonitrile (0.26 g, 1.31 mmol) was dissolved in ethanol (5 mL) and treated with hydrazine hydrate (0.26 g, 5.25 mmol). After stirring at reflux for 2 h, the mixture was cooled to RT and concentrated in vacuo. The residue was dissolved in a mixture of water and ethyl acetate. The aqueous layer was extracted once more with ethyl acetate. The combined organic layers were washed with water and with brine, dried over magnesium sulfate, concentrated in vacuo and dried to afford the title compound (0.31 g, 83% of theory) in a purity of 75%.
[0757] LC-MS (Method 1B): R.sub.t=0.53 min, MS (ESIPos): m/z=211 [M+H].sup.+
Example 139A
Tert-butyl 4-[2-oxo-10-(pyridin-2-yl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0758] ##STR00184##
[0759] 4-(Pyridin-2-yl)-1H-indazol-3-amine (75% purity, 0.31 g, 1.09 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.57 g, 1.60 mmol) were dissolved in acetonitrile (10 mL) and refluxed for 2 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (15 mL). Potassium phosphate (0.80 g, 3.75 mmol) was added and the mixture was stirred at 100 C. for 2 h. After concentration in vacuo, the residue was taken up in water and extracted with ethyl acetate. The organic phase was washed with water and brine, dried over magnesium sulfate, and concentrated in vacuo. Purification via preparative HPLC (Method 1A) afforded the title compound (0.34 g, 54% of theory).
[0760] LC-MS (Method 1B): R.sub.t=1.14 min, MS (ESIPos): m/z=446 [M+H].sup.+
Example 140A
2-Fluoro-6-(1,3-thiazol-2-yl)benzonitrile
[0761] ##STR00185##
[0762] Under argon, 2-thiazolozinc bromide (0.5 M in tetrahydrofuran, 13 mL, 6.5 mmol) was diluted with tetrahydrofuran (10 mL), and 2-bromo-6-fluorobenzonitrile (1.00 g, 5.00 mmol), (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl)[2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (127 mg, 150 mol), 2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl (72 mg, 150 mol) were added. After stirring at RT for 16 h, the mixture was diluted with ethyl acetate. The organic phase was washed with water and brine, dried over magnesium sulfate, and concentrated in vacuo. Purification via preparative HPLC (Method 1A) afforded the title compound (248 mg, 24% of theory).
[0763] LC-MS (Method 1B): R.sub.t=0.87 min, MS (ESIPos): m/z=205 [M+H].sup.+
Example 141A
4-(1,3-Thiazol-2-yl)-1H-indazol-3-amine
[0764] ##STR00186##
[0765] 2-Fluoro-6-(1,3-thiazol-2-yl)benzonitrile (0.25 g, 1.21 mmol) was dissolved in ethanol (5 mL) and treated with hydrazine hydrate (0.24 g, 4.86 mmol). After stirring at reflux for 2 h, the mixture was cooled to RT and concentrated in vacuo. The residue was dissolved in a mixture of water and ethyl acetate. The aqueous layer was extracted once more with ethyl acetate. The combined organic layers were washed with water and with brine, dried over magnesium sulfate, concentrated in vacuo and dried to afford the title compound (0.29 g, 76% of theory) in a purity of 70%.
[0766] LC-MS (Method 1B): R.sub.t=0.66 min, MS (ESIPos): m/z=217 [M+H].sup.+
Example 142A
Tert-butyl 4-[2-oxo-10-(1,3-thiazol-2-yl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0767] ##STR00187##
[0768] 4-(1,3-Thiazol-2-yl)-1H-indazol-3-amine (70% purity, 0.29 g, 0.98 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.55 g, 1.55 mmol) were dissolved in acetonitrile (10 mL) and refluxed for 2 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (15 mL). Potassium phosphate (0.74 g, 3.49 mmol) was added and the mixture was stirred at 100 C. for 2 h. After concentration in vacuo, the residue was taken up in water and extracted with ethyl acetate. The organic phase was washed with water and brine, dried over magnesium sulfate, and concentrated in vacuo. Purification via preparative HPLC (Method 1A) afforded the title compound (0.28 g, 50% of theory).
[0769] LC-MS (Method 1B): R.sub.t=1.21 min, MS (ESIPos): m/z=452 [M+H].sup.+
Example 143A
Tert-butyl 4-[2-oxo-10-(3-thienyl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0770] ##STR00188##
[0771] Under argon, tert-butyl 4-(10-bromo-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (0.20 g, 0.48 mmol), 3-thienylboronic acid (63 mg, 0.49 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl) [2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (11 mg, 13 mol) were dissolved in degassed tetrahydrofuran (4 mL). Potassium phosphate solution (1 M in water, degassed) (2.55 mL, 2.55 mmol) was added and the mixture was stirred at 40 C. for 16 h. The mixture was diluted with water, and extracted with dichloromethane. The organic phase was dried over magnesium sulfate and concentrated in vacuo. Purification by preparative HPLC (Method 1A) afforded the title compound (98 mg, 49% of theory).
[0772] LC-MS (Method 1B): R.sub.t=1.18 min, MS (ESIPos): m/z=451 [M+H].sup.+
Example 144A
Tert-butyl 4-[10-(2-methylphenyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0773] ##STR00189##
[0774] Under argon, tert-butyl 4-(10-bromo-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (0.20 g, 0.48 mmol), 2-methylphenylboronic acid (67 mg, 0.49 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl) [2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (11 mg, 13 mol) were dissolved in degassed tetrahydrofuran (4 mL). Potassium phosphate solution (1 M in water, degassed) (2.55 mL, 2.55 mmol) was added and the mixture was stirred at 40 C. for 16 h. The mixture was diluted with water, and extracted with dichloromethane. The organic phase was dried over magnesium sulfate and concentrated in vacuo. Purification by preparative HPLC (Method 1A) afforded the title compound (150 mg, 73% of theory).
[0775] LC-MS (Method 1B): R.sub.t=1.26 min, MS (ESIPos): m/z=459 [M+H].sup.+
Example 145A
Tert-butyl 4-[10-(1-methyl-1H-pyrazol-5-yl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0776] ##STR00190##
[0777] Under argon, tert-butyl 4-(10-bromo-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (0.20 g, 0.48 mmol), 1-methyl-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole (102 mg, 0.49 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl)[2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (11 mg, 13 mol) were dissolved in degassed tetrahydrofuran (4 mL). Potassium phosphate solution (1 M in water, degassed) (2.55 mL, 2.55 mmol) was added and the mixture was stirred at 40 C. for 48 h. Additional (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl)[2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (11 mg, 13 mol) was added and the mixture was stirred at reflux for 16 h. The phases were separated and the organic phase was subjected to preparative HPLC (Method 1A) to afford the title compound (140 mg, 70% of theory).
[0778] LC-MS (Method 1B): R.sub.t=1.05 min, MS (ESIPos): m/z=449 [M+H].sup.+
Example 146A
Tert-butyl 4-[10-(1-methyl-1H-pyrazol-4-yl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0779] ##STR00191##
[0780] Under argon, tert-butyl 4-(10-bromo-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (0.20 g, 0.48 mmol), (1-methyl-1H-pyrazol-4-yl)boronic acid (62 mg, 0.49 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl) [2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (11 mg, 13 mol) were dissolved in degassed tetrahydrofuran (4 mL). Potassium phosphate solution (1 M in water, degassed) (2.55 mL, 2.55 mmol) was added and the mixture was stirred at 40 C. for 48 h. Additional (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl)[2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (11 mg, 13 mol) was added and the mixture was stirred at reflux for 16 h. The phases were separated and the organic phase was subjected to preparative HPLC (Method 1A) to afford the title compound (121 mg, 60% of theory).
[0781] LC-MS (Method 1B): R.sub.t=1.03 min, MS (ESIPos): m/z=449 [M+H].sup.+
Example 147A
Tert-butyl 4-[2-oxo-10-(2-thienyl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0782] ##STR00192##
[0783] Under argon, tert-butyl 4-(10-bromo-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (0.20 g, 0.48 mmol), 2-thienylboronic acid (63 mg, 0.49 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl) [2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (11 mg, 13 mol) were dissolved in degassed tetrahydrofuran (4 mL). Potassium phosphate solution (1 M in water, degassed) (2.55 mL, 2.55 mmol) was added and the mixture was stirred at 40 C. for 48 h. Additional (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl)[2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (11 mg, 13 mol) was added and the mixture was stirred at reflux for 16 h. The phases were separated and the organic phase was subjected to preparative HPLC (Method 1A) to afford the title compound (121 mg, 60% of theory).
[0784] LC-MS (Method 1B): R.sub.t=1.21 min, MS (ESIPos): m/z=451 [M+H].sup.+
Example 148A
2-Bromo-6-fluoro-4-methylbenzaldehyde
[0785] ##STR00193##
[0786] 1-Bromo-3-fluoro-5-methylbenzene (5.00 g, 26.5 mmol) was dissolved in tetrahydrofuran (100 mL) and cooled to 78 C. Lithium diisopropyl amide (1.8 M in tetrahydrofuran, 16.2 mL, 29.1 mmol) was added. After stirring at 78 C. for 30 min, N,N-dimethylformamide (2.32 g, 31.7 mmol) was added.
[0787] After stirring at 78 C. for an additional 15 min, acetic acid (6 mL) and water (100 mL) was added and the mixture was warmed to RT. After extraction with ethyl acetate, the organic phase was washed with 1 M hydrochloride acid solution and brine, and dried over magnesium sulfate. Concentration in vacuo afforded the title compound (5.45 g, 95% of theory).
[0788] GC-MS (Method 1G): R.sub.t=4.39 min, MS (ESIPos): m/z=217 [M+H].sup.+
Example 149A
2-Bromo-6-fluoro-4-methylbenzonitrile
[0789] ##STR00194##
[0790] A mixture of 2-bromo-6-fluoro-4-methylbenzaldehyde (5.45 g, 25.1 mmol), sodium lauryl sulfate (1.45 g, 5.03 mmol), (Diacetoxyiodo)benzene (12.1 g, 37.7 mmol) and ammonium acetate (9.68 g, 125.6 mmol) in water (25 mL) was stirred at 70 C. for 30 min. After extraction with dichloromethane, the organic phase was dried over magnesium sulfate and concentrated in vacuo. Purification via preparative HPLC (Method 1A) afforded the title compound (4.26 g, 79% of theory).
[0791] GC-MS (Method 1G): R.sub.t=4.43 min, MS (ESIPos): m/z=215 [M+H].sup.+
Example 150A
4-Bromo-6-methyl-1H-indazol-3-amine
[0792] ##STR00195##
[0793] 2-Bromo-6-fluoro-4-methylbenzonitrile (4.26 g, 19.9 mmol) was dissolved in ethanol (100 mL) and treated with hydrazine hydrate (3.99 g, 79.6 mmol). After stirring at reflux for 4 h, the mixture was cooled to RT and concentrated in vacuo. The residue was dissolved in a mixture of water and ethyl acetate. The aqueous layer was extracted once more with ethyl acetate. The combined organic layers were washed with water and with brine, dried over magnesium sulfate, concentrated in vacuo and dried to yield the title compound (4.40 g, 41% of theory) in a purity of 42%.
[0794] LC-MS (Method 1B): R.sub.t=0.72 min, MS (ESIPos): m/z=226 [M+H].sup.+
Example 151A
Tert-butyl 4-(10-bromo-8-methyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0795] ##STR00196##
[0796] 4-Bromo-6-methyl-1H-indazol-3-amine (42% purity, 300 mg, 0.42 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.52 g, 1.46 mmol) were dissolved in acetonitrile (13 mL) and refluxed for 4 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (15 mL). Potassium phosphate (0.56 g, 2.65 mmol) was added and the mixture was stirred at 70 C. for 6 h. After concentration in vacuo, the residue was taken up in water and extracted with ethyl acetate. The organic phase was washed with water and brine, dried over magnesium sulfate, and concentrated in vacuo. Purification via preparative HPLC (Method 1A) afforded the title compound (0.40 g, 89% of theory).
[0797] LC-MS (Method 1B): R.sub.t=1.19 min, MS (ESIPos): m/z=461 [M+H].sup.+
Example 152A
2-Chloro-3,6-difluorobenzaldehyde
[0798] ##STR00197##
[0799] 2-Chloro-1,4-difluorobenzene (1.78 g, 12.0 mmol) was dissolved in tetrahydrofuran (50 mL) and cooled to 78 C. Lithium diisopropyl amide (1.8 M in tetrahydrofuran, 7.3 mL, 13.2 mmol) was added. After stirring at 78 C. for 30 min, N,N-dimethylformamide (1.05 g, 14.4 mmol) was added. After stirring at 78 C. for an additional 15 min, acetic acid (3 mL) and water (100 mL) was added and the mixture was warmed to RT. After extraction with ethyl acetate, the organic phase was washed with 1 M hydrochloride acid solution and brine, and dried over magnesium sulfate. Concentration in vacuo afforded the title compound (1.51 g, 71% of theory).
[0800] GC-MS (Method 1G): R.sub.t=3.25 min, MS (ESIPos): m/z=177 [M+H].sup.+
Example 153A
2-Chloro-3,6-difluorobenzonitrile
[0801] ##STR00198##
[0802] A mixture of 2-chloro-3,6-difluorobenzaldehyde (1.51 g, 8.5 mmol), sodium lauryl sulfate (0.49 g, 1.71 mmol), (Diacetoxyiodo)benzene (4.12 g, 12.8 mmol) and ammonium acetate (3.29 g, 42.7 mmol) in water (9 mL) was stirred at 70 C. for 30 min. After extraction with dichloromethane, the organic phase was dried over magnesium sulfate and concentrated in vacuo. Purification via preparative HPLC (Method 1A) afforded the title compound (0.42 g, 28% of theory) in a purity of 60%.
[0803] GC-MS (Method 1G): R.sub.t=2.80 min, MS (ESIPos): m/z=175 [M+H].sup.+
Example 154A
4-Chloro-5-fluoro-1H-indazol-3-amine
[0804] ##STR00199##
[0805] 2-chloro-3,6-difluorobenzonitrile (purity 60%, 0.42 g, 1.45 mmol) was dissolved in ethanol (12 mL) and treated with hydrazine hydrate (0.49 g, 9.68 mmol). After stirring at reflux for 4 h, the mixture was cooled to RT and concentrated in vacuo. The residue was dissolved in a mixture of water and ethyl acetate. The aqueous layer was extracted once more with ethyl acetate. The combined organic layers were washed with water and with brine, dried over magnesium sulfate, concentrated in vacuo and dried to yield the title compound (0.32 g, 99% of theory) in a purity of 85%.
[0806] LC-MS (Method 1B): R.sub.t=0.63 min, MS (ESIPos): m/z=186 [M+H].sup.+
Example 155A
Tert-butyl 4-(10-chloro-9-fluoro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0807] ##STR00200##
[0808] 4-Chloro-5-fluoro-1H-indazol-3-amine (85% purity, 319 mg, 1.46 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.67 g, 1.89 mmol) were dissolved in acetonitrile (16 mL) and refluxed for 4 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (15 mL). Potassium phosphate (0.73 g, 3.43 mmol) was added and the mixture was stirred at 70 C. for 6 h. After concentration in vacuo, the residue was taken up in water and extracted with ethyl acetate. The organic phase was washed with water and brine, dried over magnesium sulfate, and concentrated in vacuo. Purification via preparative HPLC (Method 1A) afforded the title compound (0.43 g, 70% of theory).
[0809] LC-MS (Method 1B): R.sub.t=1.12 min, MS (ESIPos): m/z=421 [M+H].sup.+
Example 156A
2-Fluoro-6-(1H-1,2,4-triazol-1-yl)benzonitrile
[0810] ##STR00201##
[0811] Under argon, 2,6-difluorobenzonitrile (1.00 g, 7.19 mmol) was dissolved in dimethylsulfoxide (4 mL), and 1,2,4-triazole (0.52 g, 7.48 mmol) and cesium carbonate (2.44 g, 7.48 mmol) were added. The mixture was stirred at 50 C. for 5 h. After cooling to RT, water (20 mL) was added and stirring was continued for 15 min. The precipitate was filtered and washed with water (10 mL). The solid was taken up in dichloromethane/water and extracted with dichloromethane. The combined organic phases were washed with brine, and concentrated in vacuo. Purification via column chromatography (silica gel, cyclohexane/ethyl acetate, Gradient) afforded the title compound (0.25 g, 18% of theory).
[0812] LC-MS (Method 1B): R.sub.t=0.62 min, MS (ESIPos): m/z=189 [M+H]+
Example 157A
4-(1H-1,2,4-Triazol-1-yl)-1H-indazol-3-amine
[0813] ##STR00202##
[0814] 2-Fluoro-6-(1H-1,2,4-triazol-1-yl)benzonitrile (0.25 g, 1.3 mmol) was dissolved in ethanol (2.5 mL) and treated with hydrazine hydrate (0.27 g, 5.3 mmol). After stirring at 70 C. for 9 h, the mixture was cooled to RT and concentrated in vacuo. The residue was dissolved in a mixture of water and ethyl acetate. The aqueous layer was extracted once more with ethyl acetate. The combined organic layers were washed with water and with brine, dried over sodium sulfate, concentrated in vacuo and dried to yield the title compound (0.18 g, 66% of theory).
[0815] GC-MS (Method 1G): R.sub.t=8.04 min, MS (ESIPos): m/z=200 [M+H].sup.+
Example 158A
Tert-butyl 4-[2-oxo-10-(1H-1,2,4-triazol-1-yl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0816] ##STR00203##
[0817] 4-(1H-1,2,4-Triazol-1-yl)-1H-indazol-3-amine (180 mg, 0.88 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.34 g, 0.97 mmol) were dissolved in acetonitrile (8.5 mL) and refluxed for 5 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (5 mL). Potassium phosphate (0.39 g, 1.85 mmol) was added and the mixture was stirred at 110 C. for 4 h. After cooling to RT, water (24 mL) was added, and the mixture was neutralized with aqueous hydrogen chloride solution (1 M). The precipitate was collected via filtration, washed with water and acetonitrile, and dried to afford the title compound (96 mg, 23% of theory).
[0818] LC-MS (Method 1B): R.sub.t=0.95 min, MS (ESIPos): m/z=436 [M+H].sup.+
Example 159A
Tert-butyl 4-[9-fluoro-10-(2-fluorophenyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0819] ##STR00204##
[0820] Under argon, tert-butyl 4-(10-bromo-9-fluoro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (purity 70%, 0.10 g, 0.16 mmol), 2-fluorophenylboronic acid (24 mg, 0.17 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl) [2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (4 mg, 5 mol) were dissolved in degassed tetrahydrofuran (2 mL). Potassium phosphate solution (1 M in water, degassed) (0.90 mL, 0.90 mmol) was added and the mixture was stirred at RT for 15 min. The mixture was diluted with ethyl acetate. The organic phase was washed with water and brine, dried over magnesium sulfate, and concentrated in vacuo. Purification by preparative HPLC (Method 1A) afforded the title compound (43 mg, 57% of theory).
[0821] LC-MS (Method 1B): R.sub.t=1.21 min, MS (ESIPos): m/z=481 [M+H].sup.+
Example 160A
Tert-butyl 4-[10-(2-ethoxyphenyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0822] ##STR00205##
[0823] Under argon, tert-butyl 4-(10-bromo-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (0.20 g, 0.48 mmol), 2-ethoxyphenylboronic acid (82 mg, 0.49 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl)[2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (11 mg, 13 mol) were dissolved in degassed tetrahydrofuran (4 mL). Potassium phosphate solution (1 M in water, degassed) (2.65 mL, 2.65 mmol) was added and the mixture was stirred at 40 C. for 16 h. The phases were separated and the organic phase was subjected to preparative HPLC (Method 1A) to afford the title compound (151 mg, 69% of theory).
[0824] LC-MS (Method 1B): R.sub.t=1.23 min, MS (ESIPos): m/z=489 [M+H].sup.+
Example 161A
Tert-butyl 4-[10-(2-isopropoxyphenyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0825] ##STR00206##
[0826] Under argon, tert-butyl 4-(10-bromo-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (0.20 g, 0.48 mmol), 2-isopropoxyphenylboronic acid (89 mg, 0.49 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl)[2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (11 mg, 13 mol) were dissolved in degassed tetrahydrofuran (4 mL). Potassium phosphate solution (1 M in water, degassed) (2.65 mL, 2.65 mmol) was added and the mixture was stirred at 40 C. for 16 h. The phases were separated and the organic phase was subjected to preparative HPLC (Method 1A) to afford the title compound (134 mg, 59% of theory).
[0827] LC-MS (Method 1B): R.sub.t=1.33 min, MS (ESIPos): m/z=503 [M+H].sup.+
Example 162A
2-Fluoro-6-(1H-pyrazol-1-yl)benzonitrile
[0828] ##STR00207##
[0829] Under argon, 2,6-difluorobenzonitrile (4.00 g, 28.8 mmol) was dissolved in dimethylsulfoxide (16 mL), and pyrazole (2.04 g, 29.9 mmol) and cesium carbonate (9.74 g, 29.9 mmol) were added. After stirring the mixture at 50 C. for 11 h, additional pyrazole (1.18 g, 17.3 mmol) was added and stirring was resumed at 50 C. for 6 h. After cooling to RT, water (80 mL) was added and stirring was continued for 15 min. The mixture was extracted with ethyl acetate. The combined organic phases were washed with brine, dried over sodium sulfate, and concentrated in vacuo. Purification via column chromatography (silica gel, cyclohexane/ethyl acetate, Gradient) afforded the title compound (4.16 g, 70% of theory) in a purity of 90%.
[0830] GC-MS (Method 1G): R.sub.t=5.28 min, MS (ESIPos): m/z=187 [M+H].sup.+
Example 163A
4-(1H-Pyrazol-1-yl)-1H-indazol-3-amine
[0831] ##STR00208##
[0832] 2-Fluoro-6-(1H-pyrazol-1-yl)benzonitrile (purity 90%, 4.16 g, 20.2 mmol) was dissolved in ethanol (45 mL) and treated with hydrazine hydrate (4.05 g, 80.9 mmol). After stirring at 70 C. for 7 h, the mixture was cooled to RT and concentrated in vacuo. The residue was dissolved in a mixture of water and ethyl acetate. The aqueous layer was extracted once more with ethyl acetate. The combined organic layers were washed with water and with brine, dried over sodium sulfate, concentrated in vacuo and dried. Purification via column chromatography (silica gel, cyclohexane/ethyl acetate, Gradient) afforded the title compound (2.65 g, 66% of theory).
[0833] LC-MS (Method 1B): R.sub.t=0.59 min, MS (ESIPos): m/z=200 [M+H].sup.+
Example 164A
Tert-butyl 4-[2-oxo-10-(1H-pyrazol-1-yl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0834] ##STR00209##
[0835] 4-(1H-Pyrazol-1-yl)-1H-indazol-3-amine (500 mg, 2.51 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.98 g, 2.76 mmol) were dissolved in acetonitrile (8.5 mL) and refluxed for 5 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (5 mL). Potassium phosphate (0.39 g, 1.85 mmol) was added and the mixture was stirred at 110 C. for 4 h. After cooling to RT, water (24 mL) was added, and the mixture was neutralized with aqueous hydrogen chloride solution (1 M). The precipitate was collected via filtration, washed with water and acetonitrile, and dried to afford the title compound (96 mg, 23% of theory).
[0836] LC-MS (Method 1B): R.sub.t=0.95 min, MS (ESIPos): m/z=436 [M+H].sup.+
Example 165A
Tert-butyl 4-[10-(2-fluoro-6-methoxyphenyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0837] ##STR00210##
[0838] Under argon, tert-butyl 4-(10-bromo-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (50 mg, 0.11 mmol) and (2-dicyclohexylphosphino-2,4,6-triisopropyl-1,1-biphenyl)[2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (104 mg, 0.12 mmol) were dissolved in degassed tetrahydrofuran (1.5 mL) and treated with potassium phosphate solution (1 M in water, degassed) (0.44 mL, 0.44 mmol). After stirring at RT for 15 min, a solution of 2-fluoro-6-methoxyboronic acid (38 mg, 0.22 mmol) and 1-bromo-3,5-difluorobenzene (43 mg, 0.22 mmol) in degassed tetrahydrofuran (0.5 mL) was added and stirring was resumed at RT for 15 min. The mixture was taken up in a mixture of water and ethyl acetate. The aqueous phase was extracted twice with ethyl acetate. The combined organic phases were washed with brine and dried over sodium sulfate. Separation via column chromatography (gradient cyclohexane/ethyl acetate) followed by preparative HPLC (Method 1A) afforded the title compound (21 mg, 36% of theory).
[0839] LC-MS (Method 1B): R.sub.t=1.18 min, MS (ESIPos): m/z=493 [M+H].sup.+
Example 166A
Isomer mixture of 2-fluoro-6-(2H-1,2,3-triazol-2-yl)benzonitrile and 2-fluoro-6-(1H-1,2,3-triazol-1-yl)benzonitrile
[0840] ##STR00211##
[0841] Under argon, 2,6-difluorobenzonitrile (5.00 g, 35.9 mmol) was dissolved in dimethylsulfoxide (20 mL), and 1,2,3-triazole (2.58 g, 37.4 mmol) and cesium carbonate (12.18 g, 37.4 mmol) were added. After stirring the mixture at 50 C. for 10 h, additional 1,2,3-triazole (1.25 g, 18.7 mmol) was added and stirring was resumed at 50 C. for 6 h. After cooling to RT, water (90 mL) was added and stirring was continued for 10 min. The mixture was extracted with ethyl acetate. The combined organic phases were washed with brine, dried over sodium sulfate, and concentrated in vacuo to afford a mixture of the isomers of the title compounds (ca 7:1, 9.73 g, 65% of theory) in a purity of 46%.
[0842] Major Isomer (2-fluoro-6-(2H-1,2,3-triazol-2-yl)benzonitrile): GC-MS (Method 1G): R.sub.t=5.56 min, MS (ESIPos): m/z=188 [M+H].sup.+
[0843] Minor Isomer (2-fluoro-6-(1H-1,2,3-triazol-1-yl)benzonitrile): GC-MS (Method 1G): R.sub.t=5.92 min, MS (ESIPos): m/z=188 [M+H].sup.+
Examples 167A and 168A
4-(2H-1,2,3-Triazol-2-yl)-1H-indazol-3-amine and 4-(1H-1,2,3-triazol-1-yl)-1H-indazol-3-amine
[0844] ##STR00212##
[0845] The 7:1 mixture of 2-fluoro-6-(2H-1,2,3-triazol-2-yl)benzonitrile and 2-fluoro-6-(1H-1,2,3-triazol-1-yl)benzonitrile obtained in Example 166A (purity 46%, 9.73 g, 23.8 mmol) was dissolved in ethanol (80 mL) and treated with hydrazine hydrate (7.25 g, 144.8 mmol). After stirring at 70 C. for 7 h, the mixture was cooled to RT and concentrated in vacuo. The residue was dissolved in a mixture of water and ethyl acetate. The aqueous layer was extracted twice with ethyl acetate. The combined organic layers were washed with water and with brine, dried over sodium sulfate and concentrated in vacuo. Separation and purification by column chromatography (eluent dichloromethane, then dichloromethane/ethanol) afforded the two isomers 4-(2H-1,2,3-triazol-2-yl)-1H-indazol-3-amine (1.13 g, 23% of theory) and 4-(1H-1,2,3-triazol-1-yl)-1H-indazol-3-amine (0.29 g, 6% of theory).
[0846] 4-(2H-1,2,3-triazol-2-yl)-1H-indazol-3-amine: LC-MS (Method 2B): R.sub.t=1.64 min, MS (ESIPos): m/z=201 [M+H].sup.+
[0847] 4-(1H-1,2,3-triazol-1-yl)-1H-indazol-3-amine: LC-MS (Method 2B): R.sub.t=1.67 min, MS (ESIPos): m/z=201 [M+H].sup.+
Example 169A
Tert-butyl 4-[2-oxo-10-(2H-1,2,3-triazol-2-yl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0848] ##STR00213##
[0849] 4-(2H-1,2,3-Triazol-2-yl)-1H-indazol-3-amine (500 mg, 2.37 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.93 g, 2.61 mmol) were dissolved in acetonitrile (8.5 mL) and refluxed for 4 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (20 mL). Potassium phosphate (0.94 g, 4.45 mmol) was added and the mixture was stirred at 50 C. for 4 h. After cooling to RT, water was added, and the mixture was neutralized with aqueous hydrogen chloride solution (1 M). The precipitate was collected via filtration, triturated with acetonitrile, and dried to afford the title compound (750 mg, 77% of theory).
[0850] LC-MS (Method 1B): R.sub.t=1.11 min, MS (ESIPos): m/z=436 [M+H].sup.+
Example 170A
Tert-butyl 4-[2-oxo-10-(1H-1,2,3-triazol-1-yl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0851] ##STR00214##
[0852] 4-(1H-1,2,3-Triazol-1-yl)-1H-indazol-3-amine (280 mg, 2.37 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.53 g, 1.49 mmol) were dissolved in acetonitrile (8.5 mL) and refluxed for 4 h. Additional tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (0.24 g, 0.68 mmol) was added and the mixture was refluxed for another 6 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (20 mL). Potassium phosphate (0.70 g, 3.28 mmol) was added and the mixture was stirred at 110 C. for 4 h. After cooling to RT, water was added, and the mixture was neutralized with aqueous hydrogen chloride solution (1 M). The aqueous phase was washed with ethyl acetate and left standing over night. The precipitate was collected via filtration, washed with acetonitrile, and dried to afford the title compound (240 mg, 23% of theory).
[0853] LC-MS (Method 1B): R.sub.t=1.01 min, MS (ESIPos): m/z=436 [M+H].sup.+
Example 171A
6-Chloro-2-fluoro-3-methylbenzaldehyde H.SUB.3.C
[0854] ##STR00215##
[0855] 4-Chloro-2-fluorotoluene (5.00 g, 34.6 mmol) was dissolved in tetrahydrofuran (100 mL) and cooled to 78 C. Lithium diisopropyl amide (1.8 M in tetrahydrofuran, 21.1 mL, 38.0 mmol) was added. After stirring at 78 C. for 30 min, N,N-dimethylformamide (3.03 g, 41.5 mmol) was added. After stirring at 78 C. for an additional 15 min, acetic acid (8 mL) and water (100 mL) was added and the mixture was warmed to RT. After extraction with ethyl acetate, the organic phase was washed with 1 M hydrochloride acid solution and brine, and dried over magnesium sulfate. Concentration in vacuo afforded the title compound (5.93 g, 94% of theory).
[0856] GC-MS (Method 1G): R.sub.t=3.86 min, MS (ESIPos): m/z=172 [M+H].sup.+
Example 172A
6-Chloro-2-fluoro-3-methylbenzonitrile
[0857] ##STR00216##
[0858] A mixture of 6-chloro-2-fluoro-3-methylbenzaldehyde (5.90 g, 34.2 mmol), sodium lauryl sulfate (1.97 g, 6.84 mmol), (Diacetoxyiodo)benzene (16.5 g, 51.3 mmol) and ammonium acetate (13.2 g, 170.9 mmol) in water (35 mL) was stirred at 70 C. for 30 min. After extraction with dichloromethane, the organic phase was dried over magnesium sulfate and concentrated in vacuo. Purification via preparative HPLC (Method 1A) afforded the title compound (1.12 g, 19% of theory).
[0859] GC-MS (Method 1G): R.sub.t=3.90 min, MS (ESIPos): m/z=169 [M+H].sup.+
Example 173A
4-Chloro-7-methyl-1H-indazol-3-amine
[0860] ##STR00217##
[0861] 6-Chloro-2-fluoro-3-methylbenzonitrile (1.12 g, 6.60 mmol) was dissolved in ethanol (10 mL) and treated with hydrazine hydrate (1.32 g, 26.4 mmol). After stirring at 70 C. for 6 h, the mixture was cooled to RT and concentrated in vacuo. The residue was dissolved in a mixture of water and ethyl acetate. The aqueous layer was extracted once more with ethyl acetate. The combined organic layers were washed with water and with brine, dried over magnesium sulfate, concentrated in vacuo and dried to yield the title compound (1.25 g, 99% of theory) in a purity of 95%.
[0862] LC-MS (Method 2B): R.sub.t=1.87 min, MS (ESIPos): m/z=182 [M+H].sup.+
Example 174A
Tert-butyl 4-(10-chloro-7-methyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate
[0863] ##STR00218##
[0864] 4-Chloro-7-methyl-1H-indazol-3-amine (purity 95%, 200 mg, 1.05 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (409 mg, 1.15 mmol) were dissolved in acetonitrile (10 mL) and refluxed for 2 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (10 mL). Potassium phosphate (0.30 g, 1.43 mmol) was added and the mixture was stirred at 110 C. for 4 h. After concentration in vacuo, purification via preparative HPLC (Method 1A) afforded the title compound (230 g, 77% of theory).
[0865] LC-MS (Method 1B): R.sub.t=1.24 min, MS (ESIPos): m/z=417 [M+H].sup.+
Example 175A
Cis-methyl 2-methylpiperidine-4-carboxylate
[0866] ##STR00219##
[0867] A solution of (+)-Cis-1-benzyl 4-methyl 2-methylpiperidine-1,4-dicarboxylate (21.15 g, 72.60 mmol) in ethanol (250 ml) was treated with palladium on charcoal 10% (1.54 g, 1.45 mmol) under hydrogen atmosphere at normal pressure and RT for 16 h. The mixture was filtered through celite and the filtrate was evaporated and dried under vacuo to yield the title compound (11.42 g, 95% of theory).
[0868] LC-MS (MCW-ZQ3-EXT-B): R.sub.t=1.10 min, MS (ESIPos): m/z=158 [M+H].sup.+
Example 176A
Cis-1-tert-butyl 4-methyl 2-methylpiperidine-1,4-dicarboxylate
[0869] ##STR00220##
[0870] To a solution of cis-methyl 2-methylpiperidine-4-carboxylate obtained in example 175A (11.70 g, 74.42 mmol) in tetrahydrofuran (250 ml) under argon atmosphere was added di-tert-butyl dicarbonate (19.49 g, 89.30 mmol) and the reaction mixture was stirred at RT overnight. The mixture was evaporated under vacuo and the crude product was dissolved in ethyl acetate and treated with a 10% citric acid aqueous solution. After separation of the layers the organic layer was washed with 10% citric acid aqueous solution, with a saturated aqueous solution of sodium hydrogen carbonate and finally with brine. The organic phase was dried over magnesium sulfate, filtered and evaporated to yield the title compound (23.69 g, 90% of theory, 73% pure according NMR). The crude product was used in the next step without further purification.
[0871] MS (ESIPos): m/z=258 [M+H].sup.+
Example 177A
Cis-1-(tert-butoxycarbonyl)-2-methylpiperidine-4-carboxylic Acid
[0872] ##STR00221##
[0873] To a solution of cis-1-tert-butyl 4-methyl 2-methylpiperidine-1,4-dicarboxylate obtained in example 176A (23.69 g, 92.06 mmol) in a mixture of tetrahydrofuran (250 ml) and water (125 ml) was added lithium hydroxide (8.82 g, 368.24 mmol) and the mixture was stirred overnight at RT. The mixture was evaporated under vacuo and was diluted in water and ethyl acetate. After separation of the layers the aqueous phase was treated with HCl 1M until pH 4 was achieved and then was extracted with ethyl acetate, dried over magnesium sulfate, filtered and evaporated under vacuo to yield the title compound (14.85 g, 66% of theory).
[0874] LC-MS (Method 2B): R.sub.t=1.45 min, MS (ESIPos): m/z=242 [MH].sup.
[0875] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =12.33 (bs, 1H), 4.07-3.99 (m, 1H), 3.68-3.60 (m, 1H), 3.07-2.97 (m, 1H), 1.87-1.75 (m, 4H), 1.62-1.52 (m, 1H), 1.39 (s, 9H), 1.04 (d, 3H).
Example 178A
(+)-Cis-tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]-2-methylpiperidine-1-carboxylate
[0876] ##STR00222##
[0877] To a solution of cis-1-(tert-butoxycarbonyl)-2-methylpiperidine-4-carboxylic acid obtained in example 177A (1.00 g, 4.11 mmol) and 2,2-dimethyl-1,3-dioxane-4,6-dione (0.65 g, 4.52 mmol) in dichloromethane (10 ml) was added 4-dimethylaminopyridin (0.75 g, 6.16 mmol). After cooling the mixture to 0 C., 1-(3-dimethylaminopropyl)-3-ethylcarbodiimide hydrochloride (1.10 g, 5.75 mmol) was added in portions and then the reaction mixture was stirred at RT for 16 h. The mixture was diluted in dichloromethane and then treated with HCl 1M. After that the layers were separated. The organic layer was washed with HCl 1M, water and brine and finally was dried over magnesium sulfate, filtered and evaporated under vacuo to yield the title compound (1.49 g, 94% of theory).
[0878] LC-MS (Method 1B): R.sub.t=1.18 min, MS (ESIPos): m/z=370 [M+H].sup.+
[0879] [].sup.20=+65.33 (c. 0.375, methanol) WL=589 nm
Example 179A
(+)-Cis-Tert-butyl 4-(10-chloro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)-2-methylpiperidine-1-carboxylate [Enantiomerically Pure Cis-Isomer]
[0880] ##STR00223##
[0881] The title compound was prepared according to General Procedure 1A starting from 0.26 g (1.48 mmol) 4-chloro-1H-indazol-3-amine and 0.55 g (1.48 mmol) (+)-cis-tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]-2-methylpiperidine-1-carboxylate. Then the mixture was diluted with water and was treated with 1N hydrochloric acid until pH 5 was achieved and finally extracted with ethyl acetate. The organic layer was washed with water, brine and dried over magnesium sulfate, filtered, evaporated and dried in vacuo. The crude was purified by preparative HPLC (Method 1A). The combined product fractions were evaporated and lyophilized overnight. Epimerization was observed obtaining a mixture of diastereomers which were separated by Method 5C to yield the title compound, which was after then stirred in acetonitrile. The resulting solid was filtered, washed with acetonitrile and dried overnight in vacuo at 60 C. to yield the title compound. The filtrate was purified by preparative HPLC (Method 1A).
[0882] The combined product fractions were evaporated and lyophilized overnight to yield the title compound (65 mg, 10% of theory).
[0883] LC-MS (Method 1B): RT=1.18 min, MS (ESIPos): m/z=417 (M+H).sup.+
[0884] HPLC (Method 5E): R.sub.t=7.19 min
[0885] [].sup.20=+24.9 (c. 0.30, methanol) WL=589 nm
Example 180A
(3-amino-1H-indazol-4-yl)acetonitrile
[0886] ##STR00224##
[0887] To a solution of 2-(cyanomethyl)-6-fluorobenzonitrile (1.00 g, 6.24 mmol) in ethanol (12 mL) under argon was added hydrazine hydrate (2.38 mL, 25.0 mmol) at RT. The mixture was heated to 70 C. for 5 h. The mixture was cooled to RT and concentrated in vacuo and then the residue was dissolved in a mixture of water and ethyl acetate. The aqueous layer was extracted once more with ethyl acetate. The combined organic layers were washed with water and with brine, dried over magnesium sulfate, concentrated in vacuo and dried in vacuo to yield the title compound (0.80 g, 62% of theory, 80% pure according LC-MS).
[0888] LC-MS (Method 2B): R.sub.t=1.54 min, MS (ESIPos): m/z=173 [M+H].sup.+
Example 181A
Tert-butyl 4-[10-(cyanomethyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0889] ##STR00225##
[0890] (3-amino-1H-indazol-4-yl)acetonitrile (purity 80%, 589 mg, 2.74 mmol) and tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (863 mg, 2.28 mmol) were dissolved in acetonitrile (8.6 mL) and stirred at 60 C. for 5 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (8.6 mL). Potassium phosphate (969 mg, 4.57 mmol) was added and the mixture was stirred at 110 C. for 1 h. The mixture was diluted with water, neutralized (pH 6) by the addition of 1N HCl and the resulting solid was filtered, washed with water and finally purified by preparative HPLC (Method 2A) to yield the title compound (15 mg, 2% of theory).
[0891] LC-MS (Method 1B): R.sub.t=1.02 min, MS (ESIPos): m/z=408 [M+H].sup.+
Example 182A
tert-butyl 4-{2-oxo-10-[1-(tetrahydro-2H-pyran-2-yl)-1H-imidazol-5-yl]-1,2-dihydropyrimido[1,2-b]indazol-4-yl}piperidine-1-carboxylate
[0892] ##STR00226##
[0893] tert-butyl 4-(10-bromo-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (200 mg, 0.45 mmol) and 1-(tetrahydro-2H-pyran-2-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-imidazole (187 mg, 0.67 mmol) were dissolved in N,N-Dimethylformamide (5 ml) and treated with sodium carbonate solution (2M in water, 0.89 ml). After degassing the solution 1,1-Bis(diphenylphosphino)ferrocene-palladium(II)chloride (16.4 mg, 0.02 mmol) was added. After stirring at 80 C. for 16 h, the mixture was separated via reverse phase HPLC (gradient acetonitrile/water with 0.1% trifluoroacetic acid) which afforded the title compound (55.4 mg, 25% of theory).
[0894] LC-MS (Method 5B): R.sub.t=0.84 min, MS (ESIPos): m/z=519.5 [M+H].sup.+
Example 183A
tert-butyl 4-{10-[1-(tert-butoxycarbonyl)-1H-pyrrol-2-yl]-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl}piperidine-1-carboxylate
[0895] ##STR00227##
[0896] tert-butyl 4-(10-bromo-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (200 mg, 0.45 mmol) and [1-(tert-butoxycarbonyl)-1H-pyrrol-2-yl]boronic acid (142 mg, 0.67 mmol) were dissolved in N,N-Dimethylformamide (5 ml) and treated with sodium carbonate solution (2M in water, 0.89 ml). After degassing the solution 1,1-Bis(diphenylphosphino)ferrocene-palladium(II)chloride (16.4 mg, 0.02 mmol) was added. After stirring at 80 C. for 16 h, the mixture was separated via reverse phase HPLC (gradient acetonitrile/water with 0.1% trifluoroacetic acid) which afforded the title compound (149 mg, 61% of theory).
[0897] LC-MS (Method 5B): R.sub.t=1.26 min, MS (ESIPos): m/z=534.5 [M+H].sup.+
Example 184A
4-[1-(tert-butoxycarbonyl)piperidin-4-yl]-2-oxo-1,2-dihydropyrimido[1,2-b]indazole-10-carboxylic Acid
[0898] ##STR00228##
[0899] Tert-butyl 4-(10-cyano-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (Example 78A) (200 mg, 0.51 mmol) and sodium hydroxide solution (2M in water, 25 ml, 50.8 mol) were dissolved in water (5 ml) and ethanol (40 ml). After stirring at 100 C. for 4 h and 2 d at rt, the mixture was worked up 3 with ethyl acetate and citric acid solution (10% in water). The organic phases were washed with water and dried with sodium sulfate. Drying in vacuo afforded the title compound (187 mg, 84% of theory).
[0900] LC-MS (Method 5B): R.sub.t=0.95 min, MS (ESIPos): m/z=412.3 [M+H].sup.+
Example 185A
tert-butyl 4-[2-oxo-10-(2,2,2-trifluoroethoxy)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate
[0901] ##STR00229##
[0902] tert-butyl 4-[(2,2-dimethyl-4,6-dioxo-1,3-dioxan-5-yl)carbonyl]piperidine-1-carboxylate (338 mg, 0.95 mmol, 1.1 eq) and 4-(2,2,2-trifluoroethoxy)-2H-indazol-3-amine (200 mg, 0.86 mmol, 1 eq) were dissolved in acetonitrile (15 mL) and refluxed for 3 h. After cooling to RT, the solvent was removed in vacuo and the residue was dissolved in 1-methoxy-2-propanol (15 mL). Potassium phosphate (368 mg, 1.7 mmol, 2 eq.) was added and the mixture was stirred at 100 C. for 4 h. After concentration in vacuo, purification via reverse phase HPLC (gradient acetonitrile/water with 0.1% formic acid) afforded the title compound (190 mg, 47% of theory).
[0903] LC-MS (Method 1B): R.sub.t=1.04 min, MS (ESIPos): m/z=467 [M+H].sup.+
Example 186A
4-(2,2,2-trifluoroethoxy)-1H-indazol-3-amine
[0904] ##STR00230##
[0905] To a solution of 2-(2,2,2-trifluoroethoxy)-6-fluorobenzonitrile (1.00 g, 4.56 mmol, 1 eq) in ethanol (30 mL) was added hydrazine hydrate (0.88 mL, 18 mmol, 4 eq) at RT. The mixture was stirred at rt for 16 h and the heated to 70 C. over night. The solvents were removed in vacuo and the obtained residue purification via reverse phase HPLC (gradient acetonitrile/water with 0.1% trifluoro acetic acid) afforded the title compound (430 mg, 35% of theory).
[0906] LC-MS (Method 7B): R.sub.t=1.89 min, MS (ESIPos): m/z=232 [M+H].sup.+
PREPARATION OF COMPOUND EXAMPLES
Example 1
4-(Piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one hydrochloride
[0907] ##STR00231##
[0908] Tert-butyl 4-(4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate (1.50 g, 4.07 mmol) was dissolved in 4N HCl in dioxane (10 mL) and methanol (5 mL) and irradiated with ultrasound for 5 min. The resulting suspension was filtered, the residue was washed with dioxane (50 ml) and methanol (2 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (1.35 g, 92% purity, 4.07 mmol, 100% of theory).
[0909] LC-MS (Method 2B): R.sub.t=1.19 min, MS (ESIPos): m/z=269 [M+HxHCl].sup.+
[0910] .sup.1H-NMR (400 MHz, D.sub.2O): =7.57 (d, 2H), 7.41 (d-like, 2H), 7.00 (quint-like, 1H), 6.26 (s, 1H), 3.67 (d, 2H), 3.53 (t, 1H), 3.31 (t, 2H), 2.43 (d, 2H), 1.96 (qm, 2H).
Example 2
4-(Piperidin-4-yl)-9-(trifluoromethyl)pyrimido[1,2-b]indazol-2(1H)-one hydrochloride
[0911] ##STR00232##
[0912] Tert-butyl 4-[2-oxo-9-(trifluoromethyl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate, 48.3 mg, 0.111 mmol) was dissolved in 4N HCl in dioxane (1.2 mL), stirred for 5 min and evaporated in vacuo. Methanol (5 mL) was added and the solution was evaporated again. The residue was dissolved in methanol (0.5 mL) and water (2 mL) and then lyophilized to give the title compound (38.7 mg, 94% of theory).
[0913] LC-MS (Method 1B): R.sub.t=0.65 min, MS (ESIPos): m/z=337 [M+HxHCl].sup.+
[0914] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =13.55 (br. S, 1H), 8.91 (br. s, 1H), 8.74 (br. S, 1H), 8.48 (s, 1H), 7.73 (d, 1H), 7.58 (d, 1H), 6.31 (s, 1H), 3.79 (m, 1H), 3.43 (d, 2H), 3.17 (q, 2H), 2.30 (d, 2H), 1.92 (q, 2H).
Example 3
10-Chloro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[0915] ##STR00233##
[0916] Tert-butyl 4-(10-chloro-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate, 47.3 mg, 0.12 mmol) was dissolved in 4N HCl in dioxane (1.3 mL), stirred for 5 min and evaporated in vacuo. Methanol (5 mL) was added and the solution was evaporated again. The residue was dissolved in methanol (0.5 mL) and water (2 mL) and then lyophilized to give the title compound (40.5 mg, 0.12 mmol, 100% of theory).
[0917] LC-MS (Method 2B): R.sub.t=1.36 min, MS (ESIPos): m/z=303 [M+HxHCl].sup.+
[0918] .sup.1H-NMR (400 MHz, D.sub.2O): =7.27 (d, 1H), 7.22 (dd, 1H), 6.85 (d, 1H), 6.34 (s, 1H), 3.68 (d, 2H), 3.52 (t, 1H), 3.32 (t, 2H), 2.44 (d, 2H), 1.97 (qm, 2H).
Example 4
10-Fluoro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[0919] ##STR00234##
[0920] Tert-butyl 4-(10-fluoro-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate (80 mg, 0.21 mmol) was dissolved in 4N HCl in dioxane (1 mL) and methanol (1 mL) and irradiated with ultrasound for 15 min. The resulting suspension was diluted with dioxane (2 mL), filtered, the residue was washed with dioxane (2 ml) and dried for 16 h at 50 C. in vacuo to yield the title compound (64 mg, 95% of theory).
[0921] LC-MS (Method 2B): R.sub.t=1.24 min, MS (ESIPos): m/z=287 [M+HxHCl].sup.+
[0922] .sup.1H-NMR (400 MHz, D.sub.2O): =7.39 (q, 1H), 7.28 (d, 1H), 6.70 (dd, 1H), 6.38 (s, 1H), 3.72-3.59 (m, 3H), 3.31 (t, 2H), 2.46 (d, 2H), 1.99 (qm, 2H).
Example 5
9-Chloro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[0923] ##STR00235##
[0924] Tert-butyl 4-(9-chloro-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate, 26.5 mg, 0.066 mmol) was dissolved in 4N HCl in dioxane (1 mL), stirred for 1 min and evaporated in vacuo. Methanol (5 mL) was added and the solution was evaporated again. The residue was dissolved in methanol (0.5 mL) and water (2 mL) and then lyophilized to give the title compound (24 mg, 0.07 mmol, 100% of theory).
[0925] LC-MS (Method 1B): R.sub.t=0.59 min, MS (ESIPos): m/z=303 [M+HxHCl].sup.+
[0926] .sup.1H-NMR (400 MHz, D.sub.2O): =7.67 (s, 1H), 7.48 (d, 1H), 7.37 (d, 1H), 6.39 (s, 1H), 3.72-3.62 (m, 3H), 3.32 (t, 2H), 2.48 (d, 2H), 2.00 (qm, 2H).
Example 6
7,9-Dichloro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[0927] ##STR00236##
[0928] Tert-butyl 4-(8,10-dichloro-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate (15.5 mg, 0.035 mmol) was dissolved in 4N HCl in dioxane (0.9 mL) and methanol (0.1 mL), stirred for 30 min and evaporated in vacuo. Methanol (5 mL each) was added and the solution was evaporated two times to give the title compound (13.4 mg, 0.04 mmol, 100% of theory).
[0929] LC-MS (Method 1B): R.sub.t=0.61 min, MS (ESIPos): m/z=337 [M+HxHCl].sup.+
[0930] .sup.1H-NMR (400 MHz, DMSO-d.sub.6+TFA): =8.01 (d, J=1.8 Hz, 1H), 7.62 (d, J=1.8 Hz, 1H), 6.41 (s, 1H), 3.81 (tm, 1H), 2.10 (dm, 2H), 3.23 (tm, 2H), 2.33 (d, 2H), 1.91 (dq, 2H).
Example 7
9-Fluoro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[0931] ##STR00237##
[0932] Tert-butyl 4-(9-fluoro-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate (59 mg, 0.153 mmol) was dissolved in 4N HCl in dioxane (1 mL) and methanol (1 mL) and irradiated with ultrasound for 15 min. The resulting suspension was diluted with dioxane (2 mL) and filtered, the residue was washed with dioxane (2 ml) and dried for 16 h at 50 C. in vacuo to yield the title compound (53 mg, 92% purity, 99% of theory).
[0933] LC-MS (Method 2B): R.sub.t=1.29 min, MS (ESIPos): m/z=287 [M+HxHCl].sup.+
[0934] .sup.1H-NMR (400 MHz, D.sub.2O): =7.52 (dt, 1H), 7.34-7.25 (m, 2H), 6.34 (s, 1H), 3.71-3.60 (m, 3H), 3.31 (t, 2H), 2.46 (d, 2H), 1.99 (qm, 2H).
Example 8
10-Methoxy-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[0935] ##STR00238##
[0936] Tert-butyl 4-(10-methoxy-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate (120 mg, 0.30 mmol) was dissolved in 4N HCl in dioxane (2 mL) and methanol (2 mL) and irradiated with ultrasound for 15 min. The resulting suspension was diluted with dioxane (2 mL) and filtered, the residue was washed with dioxane (2 ml) and dried for 16 h at 50 C. in vacuo to yield the title compound (102 mg, 98% purity, 99% of theory).
[0937] LC-MS (Method 2B): R.sub.t=1.27 min, MS (ESIPos): m/z=299 [M+HxHCl].sup.+
[0938] .sup.1H-NMR (400 MHz, D.sub.2O): =7.32 (t, 1H), 6.92 (d, 1H), 6.30 (d, 1H), 6.23 (s, 1H), 3.65 (d, 2H), 3.47 (t, 1H), 3.29 (t, 2H), 2.42 (d, 2H), 1.94 (dm, 2H).
Example 9
7-(Piperidin-4-yl)pyrido[3,2:3,4]pyrazolo[1,5-a]pyrimidin-9(10H)-one Hydrochloride
[0939] ##STR00239##
[0940] Tert-butyl 4-(9-oxo-9,10-dihydropyrido[3,2:3,4]pyramzolo[1,5-a]pyrimidin-7-yl)piperidine-1-carboxylate (16 mg, 0.04 mmol) was dissolved in 4N HCl in dioxane (1 mL) and methanol (1 mL) and irradiated with ultrasound for 15 min. The resulting suspension was diluted with dioxane (2 mL) and filtered, the residue was washed with dioxane (2 ml) and dried for 16 h at 50 C. in vacuo to yield the title compound (16 mg, 92% purity, 99% of theory).
[0941] LC-MS (Method 2B): R.sub.t=1.07 min, MS (ESIPos): m/z=270 [M+HxHCl].sup.+
[0942] .sup.1H-NMR (400 MHz, D.sub.2O): =8.54 (d, 1H), 8.14 (d, 1H), 7.56 (dd, 1H), 6.51 (s, 1H), 3.82 (t, 1H), 3.66 (d, 2H), 3.32 (t, 2H), 2.49 (d, 2H), 2.02 (qm, 2H).
Example 10
10-Bromo-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[0943] ##STR00240##
[0944] Tert-butyl 4-(10-bromo-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate (190 mg, 0.425 mmol) was dissolved in 4N HCl in dioxane (4 mL) and methanol (4 mL) and irradiated with ultrasound for 15 min. The resulting suspension was filtered, the residue was washed with dioxane (5 ml) and dried for 16 h at 50 C. in vacuo to yield the title compound (175 mg, 93% purity, 99% of theory).
[0945] LC-MS (Method 2B): R.sub.t=1.44 min, MS (ESIPos): m/z=347/349 [M+HxHCl].sup.+
[0946] .sup.1H-NMR (400 MHz, D.sub.2O): =7.40 (d, 1H), 7.22 (dd, 1H), 7.11 (d, 1H), 6.39 (s, 1H), 3.67 (d, 2H), 3.60 (t, 1H), 3.32 (dd, 2H), 2.46 (d, 2H), 1.98 (qm, 2H).
Example 11
4-(Piperidin-4-yl)-8-(trifluoromethyl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[0947] ##STR00241##
[0948] Tert-butyl 4-[2-oxo-8-(trifluoromethyl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (353 mg, 0.810 mmol) was dissolved in methanol (8 mL), 4N HCl in dioxane (8 mL) was added and the mixture irradiated with ultrasound for 15 min. The resulting suspension was filtered, the residue was washed with dioxane (5 ml) and dried for 16 h at 50 C. in vacuo to yield the title compound (231 mg, 76% of theory).
[0949] LC-MS (Method 2B): R.sub.t=1.61 min, MS (ESIPos): m/z=337 [M+HxHCl].sup.+
[0950] .sup.1H-NMR (400 MHz, D.sub.2O): =7.78 (s, 1H), 7.74 (d, 1H), 7.16 (d, 1H), 6.35 (s, 1H), 3.68 (d, 2H), 3.63 (t, 1H), 3.32 (dd, 2H), 2.45 (d, 2H), 1.99 (dm, 2H).
Example 12
4-(Piperidin-4-yl)-10-(trifluoromethyl)pyrimido[1,2-b]indazol-2(1H)-one hydrochloride
[0951] ##STR00242##
[0952] Tert-butyl 4-(10-(trifluoromethyl)-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate (103 mg, 0.237 mmol) was dissolved in methanol (4 mL), 4N HCl in dioxane (4 mL) was added and the mixture irradiated with ultrasound for 15 min. The resulting suspension was diluted with methanol (2 mL), filtered, the residue was washed with methanol (3 ml) and dried for 16 h at 50 C. in vacuo to yield the title compound (90.6 mg, 97% purity, 99% of theory).
[0953] LC-MS (Method 2B): R.sub.t=1.55 min, MS (ESIPos): m/z=337 [M+HxHCl].sup.+
[0954] .sup.1H-NMR (400 MHz, D.sub.2O): =7.80 (d, 1H), 7.58-7.49 (m, 2H), 6.48 (s, 1H), 3.76 (t, 1H), 3.67 (d, 2H), 3.32 (dd, 2H), 2.47 (d, 2H), 2.00 (qm, 2H).
Example 13
8-tert-Butyl-4-(piperidin-4-yl)pyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-2(1H)-one Hydrochloride
[0955] ##STR00243##
[0956] Tert-butyl 4-(8-tert-butyl-4-oxo-1,4-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-2-yl)piperidine-1-carboxylate (64 mg, 0.152 mmol) was dissolved in methanol (2 mL), 4N HCl in dioxane (2 mL) was added and the mixture irradiated with ultrasound for 15 min. The resulting yellow solution was evaporated and the residue was triturated with 4 mL dioxane/methanol (20:1), filtered and dried for 16 h at 50 C. in vacuo to yield the title compound (51.4 mg, 90% purity, 76% of theory).
[0957] LC-MS (Method 2B): R.sub.t=1.57 min, MS (ESIPos): m/z=326 [M+HxHCl].sup.+
[0958] .sup.1H-NMR (400 MHz, D.sub.2O): =8.82 (d, 1H), 7.53 (d, 1H), 6.62 (s, 1H), 3.88 (t, 1H), 3.66 (d, 2H), 3.33 (dd, 2H), 2.49 (d, 2H), 2.05 (qm, 2H), 1.54 (s, 9H).
Example 14
10-Methyl-4-(piperidin-4-yl)-8-(trifluoromethyl)pyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-2(1H)-one Hydrochloride
[0959] ##STR00244##
[0960] Tert-butyl 4-(8-(trifluoromethyl)-4-oxo-1,4-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-2-yl)piperidine-1-carboxylate (105 mg, 0.233 mmol) was dissolved in methanol (2 mL), 4N HCl in dioxane (2 mL) was added and the mixture irradiated with ultrasound for 15 min. The resulting suspension was filtered, the residue was washed with dioxane (5 ml) and dried for 16 h at 50 C. in vacuo to yield the title compound (71.8 mg, 72% of theory).
[0961] LC-MS (Method 1B): R.sub.t=0.59 min, MS (ESIPos): m/z=352 [M+HxHCl].sup.+
[0962] .sup.1H-NMR (400 MHz, D.sub.2O): =7.49 (s, 1H), 6.63 (s, 1H), 3.85 (dt-like, 1H), 3.67 (d, 2H), 3.34 (t, 2H), 2.77 (s, 3H), 2.50 (d, 2H), 2.05 (qm, 2H).
Example 15
9-Methyl-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[0963] ##STR00245##
[0964] Tert-butyl 4-(9-methyl-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate (130 mg, 0.34 mmol) was dissolved in methanol (2 mL). 4N HCl in dioxane (2 mL) was added and the mixture was irradiated with ultrasound for 15 min. The resulting suspension was diluted with methanol (2 mL), filtered, the residue was washed with dioxane (2 ml) and dried for 16 h at 50 C. in vacuo to yield the title compound (108 mg, 98% of theory).
[0965] LC-MS (Method 1B): R.sub.t=0.55 min, MS (ESIPos): m/z=283 [M+HxHCl].sup.+
[0966] .sup.1H-NMR (400 MHz, D.sub.2O): =7.32-7.19 (m, 3H), 6.20 (br. S, 1H), 3.67 (d, 2H), 3.48 (t-like, 1H), 3.30 (t, 2H), 2.41 (d, 2H), 2.32 (s, 3H), 1.94 (qm, 2H).
Example 16
8-Amino-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[0967] ##STR00246##
[0968] Tert-butyl 4-(8-amino-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate (23 mg, 0.06 mmol) was dissolved in methanol (0.5 mL). 4N HCl in dioxane (0.5 mL) was added and the mixture was irradiated with ultrasound for 15 min. The resulting suspension was diluted with methanol (2 mL), filtered, the residue was washed with dioxane (2 ml) and dried for 16 h at 50 C. in vacuo to yield the title compound (14 mg, 64% of theory).
[0969] LC-MS (Method 1B): R.sub.t=0.18 min, MS (ESIPos): m/z=284 [M+HxHCl].sup.+
[0970] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =7.91 (d, 1H), 6.96 (d, 1H), 6.38 (s, 1H), 6.26 (s, 1H), 3.71 (t, 1H), 3.66 (d, 2H), 3.31 (dd, 2H), 2.47 (d, 2H), 1.99 (qm, 2H).
Example 17
3,4-Dimethyl-8-(piperidin-4-yl)pyrimido[1,2:1,5]pyrazolo[3,4-c]pyridazin-6(5H)-one Hydrochloride
[0971] ##STR00247##
[0972] Tert-butyl 4-(3,4-dimethyl-8-oxo-5,8-dihydropyrimido[1,2:1,5]pyrazolo[3,4-c]pyridazin-6-yl)piperidine-1-carboxylate (55 mg, 0.128 mmol) was dissolved in methanol (1 mL). 4N HCl in dioxane (1 mL) was added and the mixture was irradiated with ultrasound for 15 min. The resulting suspension was diluted with methanol (2 mL), filtered, the residue was washed with dioxane (2 ml) and dried for 16 h at 50 C. in vacuo to yield the title compound (43.6 mg, 85% of theory).
[0973] LC-MS (Method 2B): R.sub.t=1.12 min, MS (ESIPos): m/z=299 [M+HxHCl].sup.+
[0974] .sup.1H-NMR (400 MHz, D.sub.2O): =7.02 (s, 1H), 3.86 (t-like, 1H), 3.68 (d, 2H), 3.34 (dd, 2H), 3.06 (s, 3H), 2.81 (s, 3H), 2.51 (d, 2H), 2.08 (qm, 2H).
Example 18
8-Fluoro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[0975] ##STR00248##
[0976] Tert-butyl 4-(8-fluoro-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate (57.1 mg, 0.148 mmol) was dissolved in methanol (1 mL). 4N HCl in dioxane (1 mL) was added and the mixture was irradiated with ultrasound for 15 min. The resulting suspension was diluted with methanol (2 mL), filtered, the residue was washed with dioxane (2 ml) and dried for 16 h at 50 C. in vacuo to yield the title compound (40.3 mg, 84% of theory).
[0977] LC-MS (Method 2B): R.sub.t=1.30 min, MS (ESIPos): m/z=287 [M+HxHCl].sup.+
[0978] .sup.1H-NMR (400 MHz, D.sub.2O): =7.67 (dt, 1H), 7.05 (d, 1H), 6.82 (dt, 1H), 6.29 (s, 1H), 3.62 (d, 2H), 3.58 (t-like, 1H), 3.26 (dd, 2H), 2.40 (d, 2H), 1.93 (qm, 2H), 2 exchangeable protons not visible.
Example 19
9-Bromo-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[0979] ##STR00249##
[0980] Tert-butyl 4-(9-bromo-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate (30 mg, 0.067 mmol) was dissolved in methanol (1 mL). 4N HCl in dioxane (1 mL) was added and the mixture was irradiated with ultrasound for 15 min. The resulting suspension was filtered, the residue was washed with methanol (0.5 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (11 mg, 42% of theory).
[0981] LC-MS (Method 2B): R.sub.t=1.48 min, MS (ESIPos): m/z=347/349 [M+HxHCl].sup.+
[0982] .sup.1H-NMR (400 MHz, D.sub.2O): =7.83 (s, 1H), 7.48 (d, 1H), 7.42 (d, 1H), 6.40 (s, 1H), 3.74-3.62 (m, 3H), 3.31 (t-like, 2H), 2.48 (d, 2H), 2.00 (qm, 2H).
Example 20
10-Iodo-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[0983] ##STR00250##
[0984] Tert-butyl 4-(10-iodo-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate (43 mg, 0.087 mmol) was dissolved in methanol (1 mL). 4N HCl in dioxane (1 mL) was added and the mixture was irradiated with ultrasound for 15 min. The resulting suspension was diluted with methanol (2 mL), filtered, the residue was washed with dioxane (2 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (34 mg, 90% of theory).
[0985] LC-MS (Method 2B): R.sub.t=1.52 min, MS (ESIPos): m/z=395 [M+HxHCl].sup.+
[0986] .sup.1H-NMR (400 MHz, D.sub.2O): =7.43 (d, 1H), 7.37 (d, 1H), 7.05 (dd, 1H), 6.43 (s, 1H), 3.68 (d, 2H), 3.61 (t-like, 1H), 3.32 (dd, 2H), 2.46 (d, 2H), 1.98 (qm, 2H).
Example 21
8-Bromo-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[0987] ##STR00251##
[0988] Tert-butyl 4-(8-bromo-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate (85 mg, 0.190 mmol) was dissolved in methanol (1 mL). 4N HCl in dioxane (1 mL) was added and the mixture was irradiated with ultrasound for 15 min. The resulting suspension was diluted with methanol (2 mL), filtered, the residue was washed with dioxane (2 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (58 mg, 78% of theory).
[0989] LC-MS (Method 2B): R.sub.t=1.50 min, MS (ESIPos): m/z=347/349 [M+HxHCl].sup.+
[0990] .sup.1H-NMR (400 MHz, D.sub.2O): =7.50 (s, 1H), 7.39 (d, 1H), 6.94 (d, 1H), 6.37 (s, 1H), 3.68 (d, 2H), 3.56 (t-like, 1H), 3.32 (dd, 2H), 2.47 (d, 2H), 1.99 (qm, 2H).
Example 22
7-Chloro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[0991] ##STR00252##
[0992] Tert-butyl 4-(7-chloro-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate (75 mg, 0.186 mmol) was suspended in methanol (1 mL). 4N HCl in dioxane (1 mL) was added and the mixture was irradiated with ultrasound for 30 min. The resulting yellow suspension was diluted with methanol (2 mL), filtered, the residue was washed with 2 mL dioxane/methanol (1:1) and dried for 16 h at 50 C. in vacuo to yield the title compound (60 mg, 95% of theory).
[0993] LC-MS (Method 2B): R.sub.t=1.41 min, MS (ESIPos): m/z=303 [M+HxHCl].sup.+
[0994] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =13.49 (br. s, 1H), 8.80 (br. s, 1H), 8.56 (br. s, 1H), 7.95 (d, 1H), 7.53 (d, 1H), 6.99 (dd, 1H), 6.28 (br. s, 1H), 3.81 (br. s, 1H), 3.44 (d, 2H), 3.28-3.14 (m, 2H), 2.33 (d, 2H), 1.90 (qm, 2H).
Example 23
8,10-Difluoro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[0995] ##STR00253##
[0996] Tert-butyl 4-(8,10-difluoro-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate (26 mg, 0.064 mmol) was suspended in methanol (0.5 mL). 4N HCl in dioxane (0.5 mL) was added and the mixture was irradiated with ultrasound for 30 min. The resulting yellow suspension was filtered, the residue was washed with dioxane (2 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (13 mg, 95% purity, 57% of theory).
[0997] LC-MS (Method 2B): R.sub.t=1.36 min, MS (ESIPos): m/z=305 [M+HxHCl].sup.+
[0998] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =12.79 (br. s, 1H), 8.91 (br. d, 1H), 8.74 (br. d, 1H), 7.22 (d, 1H), 6.87 (dt, 1H), 6.66 (br. s, 1H), 3.85 (br. t, 1H), 3.44 (d, 2H), 3.18 (dd, 2H), 2.31 (d, 2H), 1.94 (dm, 2H).
Example 24
8-Methyl-4-(piperidin-4-yl)pyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-2(1H)-one Hydrochloride
[0999] ##STR00254##
[1000] Tert-butyl 4-(8-methyl-4-oxo-1,4-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-2-yl)piperidine-1-carboxylate (50 mg, 0.130 mmol) was dissolved in methanol (1 mL). 4N HCl in dioxane (1 mL) was added and the mixture was irradiated with ultrasound for 15 min. The resulting suspension was diluted with dioxane (2 mL), filtered, the residue was washed with dioxane (2 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (43 mg, 93% of theory).
[1001] LC-MS (Method 2B): R.sub.t=1.12 min, MS (ESIPos): m/z=284 [M+HxHCl].sup.+
[1002] .sup.1H-NMR (400 MHz, D.sub.2O): =8.82 (d, 1H), 7.32 (d, 1H), 6.65 (s, 1H), 3.83 (t-like, 1H), 3.65 (d, 2H), 3.31 (dd, 2H), 2.87 (s, 3H), 2.48 (d, 2H), 2.04 (qm, 2H).
Example 25
3-Fluoro-7-(piperidin-4-yl)pyrido[3,2:3,4]pyrazolo[1,5-a]pyrimidin-9(10H)-one Hydrochloride
[1003] ##STR00255##
[1004] Tert-butyl 4-(3-fluoro-9-oxo-9,10-dihydropyrido[3,2:3,4]pyrazolo[1,5-a]pyrimidin-7-yl)piperidine-1-carboxylate (50.9 mg, 0.131 mmol) was dissolved in methanol (1 mL). 4N HCl in dioxane (1 mL) was added and the mixture was irradiated with ultrasound for 15 min. The resulting suspension was diluted with dioxane (2 mL), filtered, the residue was washed with dioxane (2 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (38.9 mg, 82% of theory).
[1005] LC-MS (Method 2B): R.sub.t=1.19 min, MS (ESIPos): m/z=270 [M+HxHCl].sup.+
[1006] .sup.1H-NMR (400 MHz, D.sub.2O): =8.42 (s, 1H), 7.69 (dd, 1H), 6.46 (s, 1H), 3.76 (t-like, 1H), 3.66 (d, 2H), 3.31 (dd, 2H), 2.47 (d, 2H), 2.01 (qm, 2H).
Example 26
10-Ethoxy-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1007] ##STR00256##
[1008] Tert-butyl 4-(10-ethoxy-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (135 mg, 0.327 mmol) was dissolved in methanol (2.5 mL). 4N HCl in dioxane (2.5 mL) was added and the mixture was irradiated with ultrasound for 15 min. The resulting suspension was diluted with dioxane (2 mL), filtered, the residue was washed with dioxane (2 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (120 mg, 95% purity, 0.33 mmol, 100% of theory).
[1009] LC-MS (Method 2B): R.sub.t=1.40 min, MS (ESIPos): m/z=313 [M+HxHCl].sup.+
[1010] .sup.1H-NMR (400 MHz, D.sub.2O): =7.35 (dd, 1H), 6.98 (d, 1H), 6.35 (d, 1H), 6.28 (s, 1H), 4.23 (q, 2H), 3.66 (d, 2H), 3.54 (t-like, 1H), 3.30 (dd, 2H), 2.44 (d, 2H), 1.96 (qm, 2H), 1.47 (t, 3H).
Example 27
7-Bromo-4-(piperidin-4-yl)pyrido[4,3:3,4]pyrazolo[1,5-a]pyrimidin-2(1H)-one Hydrochloride
[1011] ##STR00257##
[1012] Tert-butyl 4-(7-bromo-2-oxo-1,2-dihydropyrido[4,3:3,4]pyrazolo[1,5-a]pyrimidin-4-yl)piperidine-1-carboxylate (105 mg, 0.235 mmol) was dissolved in methanol (2 mL). 4N HCl in dioxane (2 mL) was added and the mixture was irradiated with ultrasound for 15 min. The resulting suspension was diluted with dioxane (2 mL), filtered, the residue was washed with dioxane (2 mL) and dried for 16 h at 50 C. in vacuo to yield the title compound (90 mg, 91% of theory).
[1013] LC-MS (Method 2B): R.sub.t=1.18 min, MS (ESIPos): m/z=350 [M+HxHCl].sup.+
[1014] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =12.88 (br. s, 1H), 9.29 (s, 1H), 9.02 (br. s, 1H), 8.92 (br. s, 1H), 8.32 (s, 1H), 6.98 (s, 1H), 3.95 (t-like, 1H), 3.46 (d, 2H), 3.20 (dd, 2H), 2.34 (d, 2H), 2.01 (dq, 2H).
Example 28
7-Fluoro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1015] ##STR00258##
[1016] Tert-butyl 4-(7-fluoro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (82.6 mg, 0.214 mmol) was dissolved in methanol (1 mL). 4N HCl in dioxane (1 mL) was added and the mixture was irradiated with ultrasound for 15 min at 40 C. The resulting solution was evaporated in vacuo and triturated with dioxane (2 mL), filtered, and dried for 16 h at 50 C. in vacuo to give the title compound (69.4 mg, 0.21 mmol, 100% of theory) as the yellowish hydrochloride salt.
[1017] LC-MS (Method 2B): R.sub.t=1.30 min, MS (ESIPos): m/z=287 [M+HxHCl].sup.+
[1018] .sup.1H-NMR (400 MHz, D.sub.2O): =7.56 (d, 1H), 7.18 (dd, 1H), 7.01 (dt, 1H), 6.39 (s, 1H), 3.74.3.62 (m, 3H), 3.33 (dd, 2H), 2.48 (d, 2H), 2.00 (qm, 2H).
Example 29
4-(Piperidin-4-yl)pyrido[3,4:3,4]pyrazolo[1,5-a]pyrimidin-2(1H)-one Hydrochloride
[1019] ##STR00259##
[1020] Tert-butyl 4-(2-oxo-1,2-dihydropyrido[3,4:3,4]pyrazolo[1,5-a]pyrimidin-4-yl)piperidine-1-carboxylate (80.0 mg, 75% purity, 0.152 mmol) was dissolved in methanol (1 mL). 4N HCl in dioxane (1 mL) was added and the mixture was irradiated with ultrasound for 15 min at 40 C. The resulting suspension was diluted with dioxane (2 mL), filtered, and dried for 16 h at 50 C. in vacuo to give the title compound (42.4 mg, 79% of theory).
[1021] LC-MS (Method 2B): R.sub.t=1.04 min, MS (ESIPos): m/z=270 [M+HxHCl].sup.+
[1022] .sup.1H-NMR (400 MHz, D.sub.2O): =9.50 (s, 1H), 8.46 (d, 1H), 8.14 (d, 1H), 6.78 (s, 1H), 3.93 (t-like, 1H), 3.67 (dd, 2H), 2.52 (d, 2H), 2.07 (qm, 2H).
Example 30
4-(Piperidin-4-yl)-7-(trifluoromethyl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1023] ##STR00260##
[1024] Tert-butyl 4-[2-oxo-7-(trifluoromethyl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (109 mg, 0.249 mmol) was dissolved in methanol (1 mL). 4N HCl in dioxane (2 mL) was added and the mixture was irradiated with ultrasound for 15 min at 40 C. The resulting solution was evaporated in vacuo and triturated with dioxane (2 mL), filtered, and dried for 16 h at 50 C. in vacuo to give the title compound (86 mg, 91% of theory).
[1025] LC-MS (Method 2B): R.sub.t=1.62 min, MS (ESIPos): m/z=337 [M+HxHCl].sup.+
[1026] .sup.1H-NMR (400 MHz, D.sub.2O): =7.92 (d, 1H), 7.76 (d, 1H), 7.06 (dd, 1H), 6.38 (s, 1H), 3.79 (t-like, 1H), 3.65 (d, 2H), 3.34 (dd, 2H), 2.46 (d, 2H), 1.98 (qm, 2H).
Example 31
10-Nitro-4-(piperidin-4-yl)-8-(trifluoromethyl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1027] ##STR00261##
[1028] Tert-butyl 4-[10-nitro-2-oxo-8-(trifluoromethyl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (80 mg, 0.166 mmol) was dissolved in methanol (1.3 mL). 4N HCl in dioxane (1.3 mL) was added and the mixture was irradiated with ultrasound for 15 min. The resulting suspension was diluted with dioxane (2 mL), filtered, and dried for 16 h at 50 C. in vacuo. The crude product product was again was dissolved in methanol (1 mL). 4N HCl in dioxane (1 mL) was added and the mixture was irradiated with ultrasound for 15 min. The resulting suspension was evaporated in vacuo. Methanol (5 mL) was added and the solution was evaporated in vacuo. Methanol (5 mL) was added and the solution was evaporated in vacuo again to give the title compound (40 mg, 58% of theory).
[1029] LC-MS (Method 2B): R.sub.t=1.71 min, MS (ESIPos): m/z=382 [M+HxHCl]+
[1030] .sup.1H-NMR (400 MHz, D.sub.2O): =8.71 (s, 1H), 8.58 (s, 1H), 6.62 (s, 1H), 3.94 (t-like, 1H), 3.68 (d, 2H), 3.36 (dd, 2H), 2.52 (d, 2H), 2.05 (qm, 2H).
Example 32
8,10-Dimethyl-4-(piperidin-4-yl)pyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-2(1H)-one Hydrochloride
[1031] ##STR00262##
[1032] Tert-butyl 4-(8,10-dimethyl-4-oxo-1,4-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-2-yl)piperidine-1-carboxylate (79.6 mg, 0.200 mmol) was dissolved in methanol (2 mL). 4N HCl in dioxane (2 mL) was added and the mixture was irradiated with ultrasound for 15 min. The resulting suspension was diluted with methanol (2 mL), filtered, washed with methanol (3 mL) and dried for 16 h at 50 C. in vacuo to give the title compound (65.2 mg, 88% of theory).
[1033] LC-MS (Method 2B): R.sub.t=1.39 min, MS (ESIPos): m/z=298 [M+HxHCl].sup.+
[1034] .sup.1H-NMR (400 MHz, D.sub.2O): =6.89 (s, 1H), 6.38 (s, 1H), 3.62 (d, 2H), 3.29-3.14 (3H), 2.86 (s, 3H), 2.71 (s, 3H), 2.33 (d, 2H), 2.04 (qm, 2H).
Example 33
2-Oxo-4-(piperidin-4-yl)-1,2-dihydropyrimido[1,2-b]indazole-10-carbonitrile Trifluoroacetate
[1035] ##STR00263##
[1036] Tert-butyl 4-(10-cyano-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (22 mg, 0.05 mmol) in dichloromethane (2 mL) was added TFA (0.1 mL) and the mixture was stirred for 16 h at RT. The resulting solution was evaporated in vacuo, dissolved in water (15 mL) and lyophilized to give the title compound (20 mg, 86% of theory).
[1037] LC-MS (Method 2B): R.sub.t=1.34 min, MS (ESIPos): m/z=294 [M+HxTFA].sup.+
[1038] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =12.62 (br. S, 1H), 8.75 (br. S, 1H), 8.44 (br. S, 1H), 8.02 (d, 1H), 7.70 (d, 1H), 7.62 (dd, 1H), 6.82 (s, 1H), 3.94 (t-like, 1H), 3.48 (d, 2H), 3.26-3.15 (m, 2H), 2.36 (d, 2H), 1.94 (qm, 2H).
Example 34
7-Bromo-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1039] ##STR00264##
[1040] Tert-butyl 4-(7-bromo-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (50.8 mg, 0.114 mmol) was dissolved in methanol (1.5 mL). 4N HCl in dioxane (1.5 mL) was added and the mixture was irradiated with ultrasound for 15 min. The resulting suspension was filtered, washed with dioxane (2 mL) and dried for 16 h at 50 C. in vacuo to give the title compound (40.8 mg, 94% of theory).
[1041] LC-MS (Method 1B): R.sub.t=0.52 min, MS (ESIPos): m/z=347 [M+HxHCl].sup.+
[1042] .sup.1H-NMR (400 MHz, D.sub.2O): =7.85 (d, 1H), 7.73 (d, 1H), 6.97 (dd, 1H), 6.40 (s, 1H), 3.83 (t-like, 1H), 3.66 (d, 2H), 3.35 (dd, 2H), 2.51 (d, 2H), 2.01 (qm, 2H).
Example 35
4-(Piperidin-4-yl)pyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-2(1H)-one Hydrochloride
[1043] ##STR00265##
[1044] Tert-butyl 4-(2-oxo-1,2-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-4-yl)piperidine-1-carboxylate (35.9 mg, 0.087 mmol) was dissolved in methanol (1 mL). 4N HCl in dioxane (1 mL) was added and the mixture was irradiated with ultrasound for 15 min at 40 C. The resulting suspension was filtered, washed with dioxane (2 mL) and dried for 16 h at 50 C. in vacuo to give the title compound (5.7 mg, 18% of theory).
[1045] LC-MS (Method 2B): R.sub.t=0.97 min, MS (ESIPos): m/z=270 [M+HxHCl].sup.+
[1046] .sup.1H-NMR (400 MHz, D.sub.2O): =8.95-8.72 (m, 2H), 7.49-7.33 (m, 1H), 6.66 (s, 1H), 3.85 (t-like, 1H), 3.66 (d, 2H), 3.32 (dd, 2H), 2.48 (d, 2H), 2.16-1.95 (m, 2H).
Example 36
10-Methyl-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1047] ##STR00266##
[1048] Tert-butyl 4-(10-methyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (54.1 mg, 0.141 mmol) was dissolved in methanol (1 mL). 4N HCl in dioxane (1 mL) was added and the mixture was irradiated with ultrasound for 15 min at 40 C. The resulting suspension was filtered, washed with dioxane (2 mL) and dried for 16 h at 50 C. in vacuo to give the title compound (39.7 mg, 88% of theory).
[1049] LC-MS (Method 2B): R.sub.t=1.35 min, MS (ESIPos): m/z=283 [M+HxHCl].sup.+
[1050] .sup.1H-NMR (400 MHz, D.sub.2O): =7.33-7.26 (m, 2H), 6.75-6.70 (m, 1H), 6.32 (s, 1H), 3.67 (d, 2H), 3.60 (t-like, 1H), 3.32 (dd, 2H), 2.52 (s, 3H), 2.45 (d, 2H), 1.97 (qm, 2H).
Example 37
4-(Piperidin-4-yl)-10-(trifluoromethoxy)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1051] ##STR00267##
[1052] Tert-butyl 4-[2-oxo-10-(trifluoromethoxy)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (52.3 mg, 0.116 mmol) was dissolved in methanol (2 mL). 4N HCl in dioxane (2 mL) was added and the mixture was irradiated with ultrasound for 15 min at 40 C. The resulting suspension was filtered, washed with dioxane (2 mL) and dried for 16 h at 50 C. in vacuo to give the title compound (43.8 mg, 93% of theory).
[1053] LC-MS (Method 2B): R.sub.t=1.60 min, MS (ESIPos): m/z=353 [M+HxHCl].sup.+
[1054] .sup.1H-NMR (400 MHz, D.sub.2O): =7.47-7.41 (m, 2H), 6.94 (br. s, 1H), 6.42 (s, 1H), 3.73-3.62 (m, 3H), 3.31 (dd, 2H), 2.47 (d, 2H), 2.00 (qm, 2H).
Example 38
7-(Piperidin-4-yl)pyrazino[2,3:3,4]pyrazolo[1,5-a]pyrimidin-9(10H)-one Hydrochloride
[1055] ##STR00268##
[1056] Tert-butyl 4-(9-oxo-9,10-dihydropyrazino[2,3:3,4]pyrazolo[1,5-a]pyrimidin-7-yl)piperidine-1-carboxylate (78.2 mg, 0.211 mmol) was dissolved in methanol (2 mL). 4N HCl in dioxane (2 mL) was added and the mixture was irradiated with ultrasound for 15 min at 40 C. The resulting suspension was filtered, washed with dioxane (2 mL) and dried for 16 h at 50 C. in vacuo to give the title (43.8 mg, 93% of theory).
[1057] LC-MS (Method 2B): R.sub.t=0.87 min, MS (ESIPos): m/z=271 [M+HxHCl].sup.+
[1058] .sup.1H-NMR (400 MHz, D.sub.2O): =8.71 (br. s, 1H), 8.52 (br. s, 1H), 6.55 (br. s, 1H), 3.90-3.56 (m, 3H), 3.35 (br. s, 2H), 2.49 (br. s, 2H), 2.04 (br. s, 2H).
Example 39
8-Chloro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1059] ##STR00269##
[1060] Tert-butyl 4-(8-chloro-4-oxo-1,4-dihydropyrimido[1,2-b]indazol-2-yl)piperidine-1-carboxylate, 2.1 mg, 0.005 mmol) was dissolved in 4N HCl in dioxane (1 mL), stirred for 1 min and evaporated in vacuo. Methanol (5 mL) was added and the solution was evaporated again. The residue was dissolved in methanol (0.5 mL) and water (2 mL) and then lyophilized to give the title compound (2.0 mg, 0.005 mmol, 100% of theory).
[1061] .sup.1H-NMR (400 MHz, D.sub.2O): =7.44 (dd, 1H), 7.28 (d, 1H), 6.79 (d, 1H), 6.32 (s, 1H), 3.68 (d, 2H), 3.51 (t, 1H), 3.32 (t, 2H), 2.45 (d, 2H), 1.98 (q, 2H), 2 exchangeable protons not visible.
Example 40
10-(Dimethylamino)-4-(piperidin-4-yl)pyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-2(1H)-one hydrochloride
[1062] ##STR00270##
[1063] A solution of tert-Butyl 4-[10-(dimethylamino)-2-oxo-1,2-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-4-yl]piperidine-1-carboxylate (8 mg, 0.02 mmol) in methanol (0.06 ml) was treated with HCl 4N in dioxane (0.06 ml) and the reaction mixture was left without stirring for 16 h at RT. The resulting precipitate was filtrated and dried under vacuo to yield the title compound (3.8 mg, 49% of theory).
[1064] LC-MS (Method 2B): R.sub.t=1.21 min, MS (ESIPos): m/z=313 [M+HxHCl].sup.+
[1065] .sup.1H-NMR (400 MHz, D.sub.2O): =7.88 (d, 1H), 6.61 (s, 1H), 6.39 (d, 1H), 3.75-3.48 (m, 9H), 3.30 (dd, 2H), 2.45 (d, 2H), 2.01 (dd, 2H).
Example 41
10-Chloro-4-(piperidin-4-yl)-8-(trifluoromethyl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1066] ##STR00271##
[1067] A solution of tert-Butyl 4-[10-chloro-2-oxo-8-trifluoromethy)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (83 mg, 0.18 mmol) in methanol (0.51 ml) was treated with HCl 4N in dioxane (0.51 ml) and the reaction mixture was left without stirring for 16 h at RT. The resulting precipitate was filtrated and dried under vacuo to yield the title compound (40 mg, 54% of theory).
[1068] LC-MS (Method 1B): R.sub.t=0.67 min, MS (ESIPos): m/z=371[M+HxHCl].sup.+
[1069] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =12.75 (br. s, 1H), 9.06 (br. s, 1H), 8.04 (s, 1H), 7.36 (s, 1H), 6.87 (br. s, 1H), 3.91 (dd, 1H), 3.45 (d, 2H), 3.19 (dd, 2H), 2.34 (d, 2H), 2.00 (dd, 2H).
Example 42
8-(4-Fluorophenyl)-4-(piperidin-4-yl)-10-(trifluoromethyl)pyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-2(1H)-one Hydrochloride
[1070] ##STR00272##
[1071] A solution of tert-Butyl 4-[8-(4-fluorophenyl)-2-oxo-10-(trifluoromethyl)-1,2-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-4-yl]piperidine-1-carboxylate (8 mg, 0.09 mmol) in methanol (0.26 ml) was treated with HCl 4N in dioxane (0.26 ml) and the reaction mixture was left without stirring for 16 h at RT. The resulting precipitate was filtrated and dried under vacuo (21 mg, 49% of theory).
[1072] LC-MS (Method 1B): R.sub.t=0.74 min, MS (ESIPos): m/z=432 [M+HxHCl].sup.+
[1073] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =8.75 (br. s, 1H), 8.50 (br. s, 1H), 8.41 (dd, 2H), 8.06 (s, 1H), 7.42 (dd, 2H), 6.88 (s, 1H), 3.96 (dd, 1H), 3.50 (d, 2H), 3.24 (d, 2H), 2.40-2.33 (m, 2H), 1.98 (dd, 2H).
Example 43
10-Bromo-4-(piperidin-4-yl)pyrido[3,4:3,4]pyrazolo[1,5-a]pyrimidin-2(1H)-one hydrochloride
[1074] ##STR00273##
[1075] A suspension of tert-Butyl 4-(10-bromo-2-oxo-1,2-dihydropyrido[3,4:3,4]pyrazolo[1,5-a]pyrimidin-4-yl)piperidine-1-carboxylate (164 mg, 0.37 mmol) in methanol (3.0 ml) was treated with HCl 4N in dioxane (3.0 ml) and then the reaction mixture was sonicated at RT for 15 min. The resulting precipitate was filtrated, washed with dioxane and dried under vacuo 16 h at 50 C. to yield the title compound (143 mg, 91% of theory).
[1076] LC-MS (Method 1B): R.sub.t=0.33 min, MS (ESIPos): m/z=350 [M+HxHCl].sup.+
[1077] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =9.24 (s, 1H), 8.95 (br. s, 1H), 8.91 (br. s, 1H), 8.30 (s, 1H), 6.95 (s, 1H), 3.95 (dd, 1H), 3.20 (dd, 2H), 2.35 (d, 2H), 1.98 (dd, 2H).
Example 44
8-Phenyl-4-(piperidin-4-yl)pyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-2(1H)-one Hydrochloride
[1078] ##STR00274##
[1079] A suspension of tert-Butyl 4-(2-oxo-8-phenyl-1,2-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-4-yl)piperidine-1-carboxylate (91 mg, 0.20 mmol) in methanol (0.59 ml) was treated with HCl 4N in dioxane (0.59 ml) and then the reaction mixture was left without stirring for 16 h at RT. The resulting precipitate was filtrated and dried under vacuo to yield the title compound (68 mg, 90% of theory).
[1080] LC-MS (Method 2B): R.sub.t=1.55 min, MS (ESIPos): m/z=346 [M+HxHCl].sup.+
[1081] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =8.77 (br. s, 1H), 8.57 (br. s, 1H), 8.46 (d, 1H), 8.20 (d, 1H), 7.73 (d, 1H), 7.57-7.52 (m, 3H), 6.34 (br. s, 1H), 3.80 (br. s, 1H), 3.46 (d, 2H), 3.19 (dd, 2H), 2.35 (d, 2H), 1.94 (dd, 1H).
Example 45
9-Phenyl-4-(piperidin-4-yl)pyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-2(1H)-one Hydrochloride
[1082] ##STR00275##
[1083] A suspension of tert-Butyl 4-(2-oxo-9-phenyl-1,2-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-4-yl)piperidine-1-carboxylate (57 mg, 0.13 mmol) in methanol (0.37 ml) was treated with HCl 4N in dioxane (0.37 ml) and then the reaction mixture was left without stirring for 16 h at RT. The resulting precipitate was filtrated and dried under vacuo to yield the title compound (45 mg, 93% of theory).
[1084] LC-MS (Method 2B): R.sub.t=1.54 min, MS (ESIPos): m/z=346 [M+HxHCl].sup.+
[1085] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =9.08 (d, 1H), 8.95 (br. s, 1H), 8.75 (br. s, 1H), 8.65 (s, 1H), 7.74 (d, 2H), 7.54 (dd, 2H), 7.42 (dd, 1H), 6.43 (br. s, 1H), 3.82 (dd, 1H), 3.46 (d, 2H), 3.20 (dd, 2H), 2.32 (d, 2H), 1.96 (dd, 2H).
Example 46
10-Phenyl-4-(piperidin-4-yl)pyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-2(1H)-one Hydrochloride
[1086] ##STR00276##
[1087] A suspension of tert-Butyl 4-(2-oxo-10-phenyl-1,2-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-4-yl)piperidine-1-carboxylate (39 mg, 0.09 mmol) in methanol (0.25 ml) was treated with HCl 4N in dioxane (0.25 ml) and then the reaction mixture was left without stirring at RT for 16 h. The resulting precipitate was filtrated and dried under vacuo to yield the title compound (32 mg, 97% of theory).
[1088] LC-MS (Method 2B): R.sub.t=1.5 min, MS (ESIPos): m/z=346 [M+HxHCl].sup.+
[1089] .sup.1H-NMR (400 MHz, D.sub.2O): =8.66 (d, 1H), 7.76 (d, 2H), 7.62 (dd, 1H), 7.56 (dd, 2H), 7.34 (d, 1H), 6.83 (s, 1H), 3.76 (dd, 1H), 3.61 (d, 2H), 3.26 (dd, 2H), 2.38 (d, 2H), 1.99 (dd, 2H).
Example 47
10-methyl-4-(piperidin-4-yl)pyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-2(1H)-one Hydrochloride
[1090] ##STR00277##
[1091] A suspension of tert-butyl 4-(10-methyl-2-oxo-1,2-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-4-yl)piperidine-1-carboxylate (40 mg, 0.11 mmol) in methanol (0.30 ml) was treated with HCl 4N in dioxane (0.30 ml) and then the reaction mixture was left without stirring for 16 h at RT. The resulting precipitate was filtrated and dried under vacuo to yield the title compound (27 mg, 81% of theory).
[1092] LC-MS (Method 2B): R.sub.t=1.14 min, MS (ESIPos): m/z=284 [M+HxHCl].sup.+
[1093] .sup.1H-NMR (400 MHz, D.sub.2O): =8.52 (s, 1H), 7.23 (s, 1H), 6.88 (s, 1H), 3.89-3.80 (m, 1H), 3.62 (m, 2H), 3.31 (s, 3H), 2.97-2.94 (m, 2H), 2.46 (s, 2H), 2.08-1.98 (m, 2H).
Example 48
9-Iodo-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1094] ##STR00278##
[1095] A suspension of tert-Butyl 4-(9-iodo-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (83 mg, 0.17 mmol) in methanol (0.48 ml) was treated with HCl 4N in dioxane (0.48 ml) and then the reaction mixture was left without stirring for 16 h at RT. The resulting precipitate was filtrated and dried under vacuo to yield the title compound: 77 mg (100% of theory).
[1096] LC-MS (Method 1B): R.sub.t=0.59 min, MS (ESIPos): m/z=395 [M+HxHCl].sup.+
[1097] .sup.1H-NMR (400 MHz, TFA): =8.85 (s, 1H), 8.53 (d, 1H), 7.94 (br. s, 1H), 7.90 (d, 1H), 7.76 (br. s, 1H), 7.28 (s, 1H), 4.35 (dd, 1H), 4.20 (d, 2H), 3.96 (dd, 2H), 2.91 (d, 2H), 2.68 (dd, 2H).
Example 49
4-(Piperidin-4-yl)pyrido[4,3:3,4]pyrazolo[1,5-a]pyrimidin-2(1H)-one
[1098] ##STR00279##
[1099] A suspension of compound tert-Butyl 4-(2-oxo-1,2-dihydropyrido[4,3:3,4]pyrazolo[1,5-a]pyrimidin-4-yl)piperidine-1-carboxylate (100 mg, 0.27 mmol) in methanol (0.78 ml) was treated with HCl 4N in dioxane (0.78 ml) and then the reaction mixture was left without stirring for 16 h at RT. The resulting precipitate was filtrated and dried under vacuo. The solid was diluted in small amount of water and treated with ammonia. The resulting precipitate was filtrated and dried under vacuo to yield the title compound (24 mg, 33% of theory).
[1100] LC-MS (Method 2B): R.sub.t=1.03 min, MS (ESIPos): m/z=270 [M+HxHCl].sup.+
[1101] .sup.1H-NMR (400 MHz, TFA): =9.98 (s, 1H), 8.50 (d, 1H), 8.28 (d, 1H), 7.91 (br. s, 1H), 7.51 (br. s, 1H), 7.33 (s, 1H), 4.39 (dd, 1H), 4.19 (d, 2H), 3.84 (dd, 2H), 2.93 (d, 2H), 2.65 (dd, 1H).
Example 50
()-trans-10-Bromo-4-(2-methylpiperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1102] ##STR00280##
[1103] A suspension of tert-butyl-4-(10-bromo-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)-2-methylpiperidine-1-carboxylate (Example 74A, enantiomerically pure trans-Isomer) (1.07 g, 2.32 mmol) in methanol (11.0 ml) was treated with HCl 4N in dioxane (11.0 ml). The reaction mixture was sonicated at RT for 30 minutes. The mixture was evaporated and the crude product was stirred in a mixture of dioxane/methanol 1/1. The solid was filtered, washed with dioxane and dried overnight under vacuo at 70 C. After that the solid was dissolved in water and lyophilized overnight to yield the title compound (373 mg, 40% of theory).
[1104] LC-MS (Method 1B): R.sub.t=0.58 min, MS (ESIPos): m/z=363 [M+HxHCl].sup.+
[1105] [].sup.20=13.16 (c. 0.380, methanol) WL=436 nm
[1106] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): 12.40 (br. s, 1H), 9.38 (s, 1H), 8.99 (s, 1H), 7.65 (d, 1H), 7.40-7.33 (m, 1H), 7.29 (d, 1H), 6.86 (s, 1H), 4.12-4.01 (m, 1H), 3.41-3.26 (m, 1H), 3.25-3.14 (m, 1H), 2.34-2.20 (m, 2H), 2.20-2.09 (m, 2H), 1.42 (d, 3H)
Example 51
()-trans-4-(2-Methylpiperidin-4-yl)-10-phenylpyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-2(1H)-one Hydrochloride
[1107] ##STR00281##
[1108] A suspension of tert-Butyl 2-methyl-4-(2-oxo-10-phenyl-1,2-dihydropyrido[2,3:3,4]pyrazolo[1,5-a]pyrimidin-4-yl)piperidine-1-carboxylate (Example 76A, enantiomerically pure trans-Isomer) (73 mg, 0.16 mmol) in methanol (0.46 ml) was treated with HCl 4N in dioxane (0.46 ml). The reaction mixture was left without stirring at RT for 16 h. The resulting solid was filtered and washed with dioxane and finally dried under vacuo to yield the title compound (48 mg, 77% of theory).
[1109] LC-MS (Method 1B): R.sub.t=0.50 min, MS (ESIPos): m/z=360 [M+HxHCl].sup.+
[1110] [].sup.20=26.80 (c. 0.49, methanol) WL=589 nm
[1111] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): 9.21 (br. s, 1H), 8.87 (d, 1H), 8.00-7.89 (m, 2H), 7.65-7.55 (m, 3H), 7.32-7.31 (m, 1H), 7.05-6.95 (m, 1H), 4.14-4.03 (m, 1H), 3.76-3.66 (m, 1H), 3.41-3.30 (m, 1H), 3.28-3.18 (m, 1H), 2.34-2.11 (m, 4H), 1.44 (s, 3H).
Example 52
()-trans-10-Ethoxy-4-(2-methylpiperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1112] ##STR00282##
[1113] A suspension of tert-butyl 4-(10-ethoxy-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)-2-methylpiperidine-1-carboxylate (Example 75A, enantiomerically pure trans-Isomer) (90 mg, 0.21 mmol) in methanol (0.61 ml) was treated with HCl 4N in dioxane (0.61 ml). The reaction mixture was left without stirring at RT for 16 h. The mixture was evaporated and the residue was sonicated in dioxane. The salt was filtered, washed with dioxane and dried overnight under vacuo to yield the title compound (66 mg, 85% of theory).
[1114] LC-MS (Method 1B): R.sub.t=0.54 min, MS (ESIPos): m/z=327 [M+HxHCl].sup.+
[1115] [].sup.20=6.420 (c. 0.405, methanol) WL=578 nm
[1116] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): 9.00 (br. s, 1H), 8.71 (br. s, 1H), 7.28 (t, 1H), 7.04 (d, 1H), 6.35 (d, 1H), 4.24 (q, 2H), 3.74-3.65 (br. s, 1H), 3.35-3.19 (m, 2H), 2.30-2.00 (m, 4H), 1.15 (t, 3H), 1.40 (d, 3H).
Example 53
2-Oxo-4-(piperidin-4-yl)-1,2-dihydropyrimido[1,2-b]indazole-10-carbonitrile Hydrochloride
[1117] ##STR00283##
[1118] Tert-butyl 4-(10-cyano-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (320 mg, 0.81 mmol) was dissolved in 1,4-dioxane (2 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 2.0 mL, 8.1 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with 1,4-dioxane to afford the title compound (275 mg, 92% of theory).
[1119] LC-MS (Method 1B): R.sub.t=0.46 min, MS (ESIPos): m/z=294 [M+HxHCl].sup.+
[1120] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =12.65 (br. s, 1H), 9.13-8.70 (m, 2H), 8.03 (d, 1H), 7.71 (d, 1H), 7.62 (dd, 1H), 6.85 (s, 1H), 4.00-3.86 (m, 1H), 3.45 (d, 2H), 3.20 (d, 2H), 2.35 (d, 2H), 1.99 (d, 2H).
Example 54
10-(4-Methoxyphenyl)-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one hydrochloride
[1121] ##STR00284##
[1122] Tert-butyl-4-[10-(4-methoxyphenyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidin-1-carboxylat (312 mg, 0.66 mmol) was dissolved in 1,4-dioxane (2 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 1.6 mL, 6.6 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with 1,4-dioxane and diethyl ether to afford the title compound (244 mg, 78% of theory).
[1123] LC-MS (Method 1B): R.sub.t=0.70 min, MS (ESIPos): m/z=375 [M+HxHCl].sup.+
[1124] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =9.04-8.77 (m, 2H), 7.64 (d, 2H), 7.59 (d, 1H), 7.49 (dd, 1H), 7.05 (d, 2H), 6.95 (d, 1H), 6.63 (br. s, 1H), 3.57 (s, 3H), 3.46 (d, 2H), 3.21 (d, 2H), 2.36 (d, 2H), 1.98 (d, 2H).
Example 55
4-(Piperidin-4-yl)-10-[4-(trifluoromethyl)phenyl]pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1125] ##STR00285##
[1126] Tert-butyl 4-{2-oxo-10-[4-(trifluoromethyl)phenyl]-1,2-dihydropyrimido[1,2-b]indazol-4-yl}piperidine-1-carboxylate (180 mg, 0.35 mmol) was dissolved in 1,4-dioxane (2 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 0.9 mL, 3.5 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with 1,4-dioxane and diethyl ether to afford the title compound (144 mg, 84% of theory).
[1127] LC-MS (Method 1B): R.sub.t=0.80 min, MS (ESIPos): m/z=413 [M+HxHCl].sup.+
[1128] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =9.06-8.81 (m, 2H), 7.94 (d, 2H), 7.83 (d, 2H), 7.71 (d, 1H), 7.57 (dd, 1H), 7.09 (d, 1H), 6.68 (br. s, 1H), 3.46 (d, 2H), 3.22 (d, 2H), 2.36 (d, 2H), 1.99 (dd, 2H).
Example 56
10-Phenyl-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1129] ##STR00286##
[1130] Tert-butyl 4-(2-oxo-10-phenyl-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (470 mg, 1.06 mmol) was dissolved in 1,4-dioxane (2 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 2.6 mL, 10.6 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with 1,4-dioxane and diethyl ether to afford the title compound (375 mg, 85% of theory).
[1131] LC-MS (Method 1B): R.sub.t=0.69 min, MS (ESIPos): m/z=345 [M+HxHCl].sup.+
[1132] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =9.07 (br. s., 2H), 7.83-7.59 (m, 3H), 7.58-7.33 (m, 4H), 7.00 (d, 1H), 6.66 (br. s., 1H), 4.07-3.85 (m, 1H), 3.45 (d, 2H), 3.21 (d, 2H), 2.36 (d, 2H), 2.00 (d, 2H).
Example 57
10-(2-Fluorophenyl)-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one hydrochloride
[1133] ##STR00287##
[1134] Tert-butyl 4-[10-(2-fluorophenyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (590 mg, 1.28 mmol) was dissolved in 1,4-dioxane (5 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 3.2 mL, 12.8 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with 1,4-dioxane and diethyl ether to afford the title compound (501 mg, 90% of theory).
[1135] LC-MS (Method 1B): R.sub.t=0.62 min, MS (ESIPos): m/z=363 [M+HxHCl].sup.+
[1136] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =9.02 (br. s., 2H), 7.69 (d, 1H), 7.61-7.44 (m, 3H), 7.40-7.23 (m, 2H), 6.98 (d, 1H), 6.67 (br. s., 1H), 4.04-3.87 (m, 1H), 3.45 (d, 2H), 3.21 (d, 2H), 2.36 (d, 2H), 1.99 (dd, 2H).
Example 58
4-(Piperidin-4-yl)-10-(pyridin-3-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1137] ##STR00288##
[1138] Tert-butyl 4-[2-oxo-10-(pyridin-3-yl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (450 mg, 1.01 mmol) was dissolved in 1,4-dioxane (2 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 2.5 mL, 10.1 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with 1,4-dioxane and diethyl ether to afford the title compound (349 mg, 83% of theory).
[1139] LC-MS (Method 1B): R.sub.t=0.36 min, MS (ESIPos): m/z=346 [M+HxHCl].sup.+
[1140] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =9.27 (s, 1H), 9.06 (br. s., 1H), 8.98 (d, 1H), 8.91-8.80 (m, 1H), 8.13 (dd, 1H), 7.81 (d, 1H), 7.64 (dd, 1H), 7.24 (d, 1H), 6.75 (br. s, 1H), 4.04-3.90 (m, 1H), 3.46 (d, 2H), 3.31-3.10 (m, 2H), 2.35 (d, 2H), 2.09-1.87 (m, 2H)
Example 59
4-(Piperidin-4-yl)-10-(pyridin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1141] ##STR00289##
[1142] Tert-butyl 4-[2-oxo-10-(pyridin-4-yl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (33 mg, 0.07 mmol) was dissolved in 1,4-dioxane (1 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 0.3 mL, 0.74 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with 1,4-dioxane. The residue was dissolved in methanol and concentrated in vacuo to afford the title compound (30 mg, 97% of theory).
[1143] LC-MS (Method 1B): R.sub.t=0.25 min, MS (ESIPos): m/z=346 [M+HxHCl].sup.+
[1144] .sup.1H-NMR (500 MHz, D.sub.2O): =8.85 (d, 2H), 8.19 (d, 2H), 7.81 (d, 1H), 7.66 (dd, 1H), 7.32 (d, 1H), 6.53 (s, 1H), 3.80 (t, 1H), 3.69 (d, 2H), 3.35 (dd, 2H), 2.50 (d, 2H), 2.10-1.96 (m, 2H)
Example 60
10-Bromo-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1)-one Hydrochloride
[1145] ##STR00290##
[1146] Tert-butyl 4-(10-bromo-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (860 mg, 1.92 mmol) was dissolved in 1,4-dioxane (20 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 4.8 mL, 19.2 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with 1,4-dioxane to afford the title compound (805 mg, 100% of theory).
[1147] LC-MS (Method 3B): R.sub.t=1.40 min, MS (ESIPos): m/z=349 [M+HxHCl].sup.+
[1148] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =8.97-8.65 (m, 1H), 7.65 (d, 1H), 7.37 (dd, 1H), 7.31 (d, 1H), 6.75 (br. s, 1H), 3.50-3.39 (m, 2H), 3.28-3.11 (m, 2H), 2.40-2.27 (m, 2H), 2.04-1.88 (m, 2H).
Example 61
10-Cyclopropyl-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1149] ##STR00291##
[1150] Tert-butyl 4-(10-cyclopropyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (25 mg, 0.06 mmol) was dissolved in 1,4-dioxane (2 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 0.15 mL, 0.61 mmol). The mixture was stirred at RT for 72 h. The resulting solid was filtered and washed with 1,4-dioxane to afford the title compound (22 mg, 94% of theory).
[1151] LC-MS (Method 1B): R.sub.t=0.57 min, MS (ESIPos): m/z=309 [M+HxHCl].sup.+
[1152] .sup.1H-NMR (500 MHz, D.sub.2O): =7.36-7.26 (m, 2H), 6.72-6.65 (m, 1H), 6.40-6.35 (m, 1H), 3.72-3.57 (m, 3H), 3.39-3.25 (m, 2H), 2.51-2.39 (m, 2H), 2.24-2.15 (m, 1H), 2.06-1.88 (m, 2H), 1.15-1.03 (m, 2H), 0.76-0.69 (m, 2H).
Example 62
10-Isopropyl-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1153] ##STR00292##
[1154] Tert-butyl 4-(10-isopropyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (33 mg, 0.08 mmol) was dissolved in 1,4-dioxane (1 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 0.2 mL, 0.80 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with 1,4-dioxane to afford the title compound (30 mg, 97% of theory).
[1155] LC-MS (Method 2B): R.sub.t=1.63 min, MS (ESIPos): m/z=311 [M+HxHCl].sup.+
[1156] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =9.01-8.67 (m, 2H), 7.44 (s, 2H), 6.94 (d, 1H), 6.66 (br. s, 1H), 3.51-3.39 (m, 2H), 3.30-3.11 (m, 2H), 2.41-2.29 (m, 2H), 2.06-1.88 (m, 2H), 1.35 (d, 6H).
Example 63
10-Cyclopentyl-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1157] ##STR00293##
[1158] Tert-butyl 4-(10-cyclopentyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (23 mg, 0.05 mmol) was dissolved in 1,4-dioxane (1 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 0.1 mL, 0.53 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with 1,4-dioxane to afford the title compound (21 mg, 97% of theory).
[1159] LC-MS (Method 1B): R.sub.t=0.68 min, MS (ESIPos): m/z=337 [M+HxHCl].sup.+
[1160] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =8.94-8.80 (m, 1H), 8.78-8.57 (m, 1H), 7.47-7.32 (m, 2H), 6.94 (d, 1H), 6.64 (br. s, 1H), 4.28-4.08 (m, 1H), 4.01-3.86 (m, 1H), 3.77-3.62 (m, 3H), 3.28-3.11 (m, 2H), 2.42-2.29 (m, 2H), 2.25-2.07 (m, 2H), 2.05-1.59 (m, 7H)
Example 64
10-(2-Chlorophenyl)-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1161] ##STR00294##
[1162] Tert-butyl 4-[10-(2-chlorophenyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (300 mg, 0.63 mmol) was dissolved in 1,4-dioxane (12 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 1.6 mL, 6.26 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with 1,4-dioxane to afford the title compound (220 mg, 78% of theory).
[1163] LC-MS (Method 1B): R.sub.t=0.70 min, MS (ESIPos): m/z=379 [M+HxHCl].sup.+
[1164] .sup.1H-NMR (500 MHz, DMSO-d.sub.6): =9.24-9.06 (m, 1H), 7.69 (d, 1H), 7.58 (d, 1H), 7.54 (dd, 1H), 7.50-7.41 (m, 3H), 6.89 (d, 1H), 6.66 (br. s., 1H), 3.95 (t, 1H), 3.45 (d, 2H), 3.27-3.13 (m, 2H), 2.36 (d, 2H), 2.01 (d, 2H).
Example 65
10-(2-Methoxyphenyl)-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one hydrochloride
[1165] ##STR00295##
[1166] Tert-butyl 4-[10-(2-methoxyphenyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (200 mg, 0.42 mmol) was dissolved in 1,4-dioxane (8 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 1.1 mL, 4.21 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with 1,4-dioxane to afford the title compound (22 mg, 12% of theory).
[1167] LC-MS (Method 1B): R.sub.t=0.66 min, MS (ESIPos): m/z=375 [M+HxHCl].sup.+
[1168] .sup.1H-NMR (500 MHz, D.sub.2O): =7.51 (br. s., 3H), 7.29-6.96 (m, 3H), 6.83 (br. s., 1H), 6.35 (br. s., 1H), 3.33 (br. s., 2H), 2.43 (br. s., 2H), 1.99 (br. s., 2H)
Example 66
10-Chloro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one
[1169] ##STR00296##
[1170] 10-chloro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one hydrochloride (4.00 g, 11.8 mmol) was dissolved in hydrochloric acid (1.0 M in water) and treated with sodium hydroxide solution (1.0 M in water). The precipitate was collected by filtration, washed with water, and dried under vacuo to afford the title compound (3.05 g, 85% of theory).
[1171] LC-MS (Method 1B): R.sub.t=0.47 min, MS (ESIPos): m/z=303 [M+H].sup.+
[1172] .sup.1H-NMR (500 MHz, DCOOD): =7.50 (d, 1H), 7.41-7.33 (m, 1H), 7.05 (d, 1H), 6.58 (s, 1H), 3.83 (t, 1H), 3.76 (d, 2H), 3.39 (dd, 2H), 2.47 (d, 2H), 2.16-2.02 (m, 2H).
Example 67
4-(Piperidin-4-yl)-10-[2-(trifluoromethyl)phenyl]pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1173] ##STR00297##
[1174] Tert-butyl 4-{2-oxo-10-[2-(trifluoromethyl)phenyl]-1,2-dihydropyrimido[1,2-b]indazol-4-yl}piperidine-1-carboxylate (200 mg, 0.39 mmol) was dissolved in 1,4-dioxane (8 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 1.0 mL, 3.90 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with 1,4-dioxane to afford the title compound (102 mg, 54% of theory).
[1175] LC-MS (Method 1B): R.sub.t=0.73 min, MS (ESIPos): m/z=413 [M+HxHCl].sup.+
[1176] .sup.1H-NMR (500 MHz, D.sub.2O): =7.95 (s, 1H), 7.72 (s, 2H), 7.64 (d, 1H), 7.52 (br. s, 1H), 7.29 (br. s, 1H), 6.90 (br. s, 1H), 6.36 (s, 1H), 3.77 (t, 1H), 3.66 (d, 2H), 3.32 (dd, 2H), 2.44 (d, 2H), 2.06-1.89 (m, 2H).
Example 68
()-trans-10-Chloro-4-(2-methylpiperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1177] ##STR00298##
[1178] A suspension of tert-butyl 4-(10-chloro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)-2-methylpiperidine-1-carboxylate (Example 49A, enantiomerically pure trans-Isomer) (270 mg, 0.65 mmol) in methanol (1.8 ml) was treated with HCl 4N in dioxane (1.8 ml). The reaction mixture was left at RT without stirring for 16 h. The mixture was evaporated and the crude product was stirred in dioxane. The solid was filtered, washed with dioxane and dried overnight under vacuo at 60 C. After that the solid was dissolved in water and methanol and lyophilized overnight to yield the title compound (117 mg, 77% of theory).
[1179] LC-MS (Method 1B): RT=0.53 min, MS (ESIPos): m/z=317 [M+HxHCl].sup.+
[1180] [].sup.20=3.04 (c. 0.46, methanol) WL=589 nm
[1181] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): 12.44 (br. s, 1H), 9.22 (br. s, 1H), 8.87 (br. s, 1H), 7.60 (d, 1H), 7.73 (t, 1H), 7.10 (d, 1H), 6.86 (br. s, 1H), 4.13-3.97 (m, 1H), 3.76-3.64 (m, 1H), 3.26-3.12 (m, 1H), 2.35-2.20 (m, 2H), 2.21-2.06 (m, 2H), 1.42 (d, 3H).
Example 69
10-Chloro-9-methyl-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1182] ##STR00299##
[1183] Tert-butyl 4-(10-chloro-9-methyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (220 mg, 0.53 mmol) was dissolved in 1,4-dioxane (2 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 1.3 mL, 5.3 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with 1,4-dioxane to afford the title compound (182 mg, 89% of theory).
[1184] LC-MS (Method 1B): R.sub.t=0.52 min, MS (ESIPos): m/z=317 [M+HxHCl].sup.+
[1185] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =9.10-8.80 (m, 2H), 7.53 (d, 1H), 7.42 (d, 1H), 6.64 (br. s, 1H), 3.97-3.81 (m, 1H), 3.44 (d, 1H), 3.18 (dd, 2H), 2.42 (s, 2H), 2.33 (d, 2H), 2.06-1.86 (m, 2H).
Example 70
10-Bromo-9-fluoro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)one Hydrochloride
[1186] ##STR00300##
[1187] Tert-butyl 4-(10-bromo-9-fluoro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (376 mg, 0.81 mmol) was dissolved in 1,4-dioxane (3 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 2.0 mL, 8.1 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with 1,4-dioxane to afford the title compound (350 mg, 99% of theory).
[1188] LC-MS (Method 1B): R.sub.t=0.51 min, MS (ESIPos): m/z=365 [M+HxHCl].sup.+
[1189] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =9.14-8.87 (m, 1H), 7.73 (dd, 1H), 7.53 (dd, 1H), 6.78 (br. s., 1H), 3.44 (d, 2H), 3.18 (d, 2H), 2.33 (d, 2H), 1.99 (d, 2H).
Example 71
10-Bromo-7-fluoro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1190] ##STR00301##
[1191] Tert-butyl 4-(10-bromo-7-fluoro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (424 mg, 0.91 mmol) was dissolved in 1,4-dioxane (3 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 2.3 mL, 9.1 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with methanol and 1,4-dioxane to afford the title compound (330 mg, 83% of theory).
[1192] LC-MS (Method 1B): R.sub.t=0.52 min, MS (ESIPos): m/z=365 [M+HxHCl].sup.+
[1193] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =12.69-12.49 (m, 1H), 8.91 (br. s, 1H), 8.70 (br. s, 1H), 7.32-7.17 (m, 2H), 6.84 (br. s, 1H), 4.04-3.88 (m, 1H), 3.45 (d, 2H), 3.29-3.14 (m, 2H), 2.34 (d, 2H), 2.06-1.88 (m, 2H).
Example 72
10-sec-Butyl-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(11H)-one Hydrochloride
[1194] ##STR00302##
[1195] Tert-butyl 4-(10-sec-butyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (27 mg, 0.06 mmol) was dissolved in 1,4-dioxane (1 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 0.2 mL, 0.64 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with methanol and 1,4-dioxane to afford the title compound (26 mg, 100% of theory).
[1196] LC-MS (Method 1B): R.sub.t=0.70 min, MS (ESIPos): m/z=325 [M+HxHCl].sup.+
[1197] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =9.04-8.93 (m, 1H), 8.91-8.76 (m, 1H), 7.50-7.35 (m, 2H), 6.91 (d, 1H), 6.66 (br. s, 1H), 4.00-3.87 (m, 2H), 3.45 (d, 2H), 3.22 (br. s., 2H), 2.35 (d, 2H), 2.06-1.90 (m, 2H), 1.89-1.62 (m, 2H), 1.32 (d, 3H), 0.85 (t, 3H).
Example 73
10-Isobutyl-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1198] ##STR00303##
[1199] Tert-butyl 4-(10-isobutyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (92 mg, 0.22 mmol) was dissolved in 1,4-dioxane (2 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 0.6 mL, 2.2 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with methanol and 1,4-dioxane to afford the title compound (85 mg, 99% of theory).
[1200] LC-MS (Method 2B): R.sub.t=1.73 min, MS (ESIPos): m/z=325 [M+HxHCl].sup.+
[1201] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =9.07-8.80 (m, 1H), 7.45 (d, 1H), 7.37 (dd, 1H), 6.80 (d, 1H), 6.66 (br. s., 1H), 3.45 (d, 2H), 3.20 (d, 2H), 3.08 (d, 2H), 2.35 (d, 2H), 2.14-2.05 (m, 1H), 1.98 (dd, 2H), 0.94 (d, 6H).
Example 74
10-Bromo-9-methyl-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1202] ##STR00304##
[1203] Tert-butyl 4-(10-bromo-9-methyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (220 mg, 0.48 mmol) was treated with hydrochloric acid (4 M solution in 1,4-dioxane, 20.0 mL, 80 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with methanol and 1,4-dioxane to afford the title compound (184 mg, 97% of theory).
[1204] LC-MS (Method 1B): R.sub.t=0.56 min, MS (ESIPos): m/z=361 [M+HxHCl].sup.+
[1205] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =9.09-8.79 (m, 2H), 7.58 (d, 1H), 7.43 (d, 1H), 6.70 (s, 1H), 3.99-3.83 (m, 1H), 3.44 (d, 2H), 3.18 (d, 2H), 2.46 (s, 3H), 2.33 (d, 2H), 1.97 (d, 2H).
Example 75
10-Bromo-7-methyl-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1206] ##STR00305##
[1207] Tert-butyl 4-(10-bromo-7-methyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (220 mg, 0.48 mmol) was treated with hydrochloric acid (4 M solution in 1,4-dioxane, 20.0 mL, 80 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with methanol and 1,4-dioxane to afford the title compound (145 mg, 76% of theory).
[1208] LC-MS (Method 1B): R.sub.t=0.62 min, MS (ESIPos): m/z=361 [M+HxHCl].sup.+
[1209] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =8.97-8.84 (m, 1H), 8.83-8.66 (m, 1H), 7.23-7.13 (m, 2H), 6.74 (s, 1H), 3.99-3.86 (m, 1H), 3.46 (d, 2H), 3.30-3.12 (m, 2H), 2.53 (br. s., 3H), 2.38 (d, 2H), 2.06-1.89 (m, 2H).
Example 76
10-Isopropoxy-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1210] ##STR00306##
[1211] Tert-butyl 4-(10-isopropoxy-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (134 mg, 0.31 mmol) was dissolved in 1,4-dioxane (5 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 3.6 mL, 14.4 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with methanol and 1,4-dioxane to afford the title compound (125 mg, 99% of theory).
[1212] LC-MS (Method 1B): R.sub.t=1.55 min, MS (ESIPos): m/z=327 [M+HxHCl].sup.+
[1213] .sup.1H-NMR (500 MHz, D.sub.2O): =7.35 (dd, 1H), 6.97 (d, 1H), 6.39 (d, 1H), 6.27 (s, 1H), 4.83-4.76 (m, 1H), 3.70-3.62 (m, 2H), 3.58-3.49 (m, 1H), 3.35-3.26 (m, 2H), 2.47-2.39 (m, 2H), 2.01-1.90 (m, 2H), 1.45 (d, 6H).
Example 77
9-Fluoro-10-phenyl-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one hydrochloride
[1214] ##STR00307##
[1215] Tert-butyl 4-(9-fluoro-2-oxo-10-phenyl-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (67 mg, 0.15 mmol) was dissolved in 1,4-dioxane (2 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 1.6 mL, 6.7 mmol). The mixture was stirred at RT for 4 h. The resulting solid was filtered and washed with methanol and 1,4-dioxane to afford the title compound (62 mg, 98% of theory).
[1216] LC-MS (Method 2B): R.sub.t=1.70 min, MS (ESIPos): m/z=363 [M+HxHCl].sup.+
[1217] .sup.1H-NMR (500 MHz, D.sub.2O): =7.56 (dd, 3H), 7.49 (dd, 1H), 7.34-7.26 (m, 3H), 6.32 (s, 1H), 3.69-3.59 (m, 3H), 3.33-3.23 (m, 2H), 2.39-2.29 (m, 2H), 1.98-1.85 (m, 2H).
Example 78
10-(2,6-Difluorophenyl)-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1218] ##STR00308##
[1219] Tert-butyl 4-[10-(2,6-difluorophenyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (105 mg, 0.22 mmol) was treated with hydrochloric acid (4 M solution in 1,4-dioxane, 20.0 mL, 80.0 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with methanol and 1,4-dioxane to afford the title compound (66 mg, 73% of theory).
[1220] LC-MS (Method 1B): R.sub.t=0.67 min, MS (ESIPos): m/z=381 [M+HxHCl].sup.+
[1221] .sup.1H-NMR (500 MHz, D.sub.2O): =7.59 (br. s, 1H), 7.54-7.37 (m, 2H), 7.09 (br. s, 2H), 6.89 (br. s, 1H), 6.39 (s, 1H), 3.73-3.59 (m, 3H), 3.37-3.24 (m, 2H), 2.43-2.28 (m, 2H), 2.02-1.86 (m, 2H).
Example 79
10-Chloro-8-methyl-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1222] ##STR00309##
[1223] Tert-butyl 4-(10-chloro-8-methyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (320 mg, 0.77 mmol) was dissolved in 1,4-dioxane (10 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 8.8 mL, 35.3 mmol). The mixture was stirred at RT for 4 h. The resulting solid was filtered and washed with methanol and 1,4-dioxane to afford the title compound (290 mg, 97% of theory).
[1224] LC-MS (Method 2B): R.sub.t=1.50 min, MS (ESIPos): m/z=317 [M+HxHCl].sup.+
[1225] .sup.1H-NMR (500 MHz, D.sub.2O): =6.95 (s, 1H), 6.64 (s, 1H), 6.27 (s, 1H), 3.68 (d, 2H), 3.56-3.47 (m, 1H), 3.37-3.25 (m, 2H), 2.43 (d, 2H), 2.25 (s, 3H), 2.03-1.91 (m, 2H).
Example 80
4-(Piperidin-4-yl)-10-[2-(trifluoromethoxy)phenyl]pyrimido[1,2-b]indazol-2(1H)-on Hydrochloride
[1226] ##STR00310##
[1227] Tert-butyl 4-{2-oxo-10-[2-(trifluoromethoxy)phenyl]-1,2-dihydropyrimido[1,2-b]indazol-4-yl}piperidine-1-carboxylate (107 mg, 0.20 mmol) was dissolved in 1,4-dioxane (5 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 5.0 mL, 20.0 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with 1,4-dioxane to afford the title compound (70 mg, 74% of theory).
[1228] LC-MS (Method 1B): R.sub.t=0.73 min, MS (ESIPos): m/z=429 [M+HxHCl].sup.+
[1229] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =11.81 (br. s, 1H), 8.93-8.71 (m, 1H), 8.70-8.48 (m, 1H), 7.72-7.45 (m, 6H), 6.94 (d, 1H), 6.63 (br. s, 1H), 4.06-3.87 (m, 1H), 3.51-3.39 (m, 2H), 3.32-3.12 (m, 2H), 2.43-2.28 (m, 2H), 2.04-1.84 (m, 2H).
Example 81
10-Bromo-8-fluoro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1230] ##STR00311##
[1231] Tert-butyl 4-(10-bromo-8-fluoro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (23 mg, 0.05 mmol) was dissolved in 1,4-dioxane (1 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 0.6 mL, 2.3 mmol). The mixture was stirred at RT for 4 h. Concentration in vacuo afforded the title compound (21 mg, 97% of theory).
[1232] LC-MS (Method 1B): R.sub.t=0.57 min, MS (ESIPos): m/z=365 [M+HxHCl].sup.+
[1233] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =9.03-8.75 (m, 1H), 7.42 (dd, 1H), 7.31 (dd, 1H), 6.77 (br. s, 1H), 3.96-3.83 (m, 1H), 3.45 (d, 2H), 3.26-3.10 (m, 2H), 2.32 (d, 2H), 2.05-1.87 (m, 2H).
Example 82
4-(Piperidin-4-yl)-10-(pyridin-2-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1234] ##STR00312##
[1235] Tert-butyl 4-[2-oxo-10-(pyridin-2-yl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (339 mg, 0.76 mmol) was dissolved in 1,4-dioxane (5 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 3.8 mL, 15.2 mmol). The mixture was stirred at RT for 4 h. The resulting solid was filtered and washed with 1,4-dioxane to afford the title compound (306 mg, 96% of theory).
[1236] LC-MS (Method 1B): R.sub.t=0.59 min, MS (ESIPos): m/z=346 [M+HxHCl].sup.+
[1237] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =8.89 (br. s., 3H), 8.40 (d, 1H), 8.27-8.15 (m, 1H), 7.87-7.80 (m, 1H), 7.79-7.64 (m, 2H), 7.56 (dd, 1H), 6.40 (s, 1H), 3.91-3.80 (m, 1H), 3.43 (d, 2H), 3.26-3.11 (m, 2H), 2.31 (d, 2H), 2.04-1.88 (m, 2H).
Example 83
4-(Piperidin-4-yl)-10-(1,3-thiazol-2-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1238] ##STR00313##
[1239] Tert-butyl 4-[2-oxo-10-(1,3-thiazol-2-yl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (279 mg, 0.62 mmol) was dissolved in 1,4-dioxane (5 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 3.8 mL, 15.2 mmol). The mixture was stirred at RT for 4 h. The resulting solid was filtered and washed with 1,4-dioxane to afford the title compound (259 mg, 99% of theory).
[1240] LC-MS (Method 1B): R.sub.t=0.61 min, MS (ESIPos): m/z=352 [M+HxHCl].sup.+
[1241] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =13.64 (br. s, 1H), 9.13-8.67 (m, 2H), 8.22 (d, 1H), 8.01 (d, 1H), 7.78-7.70 (m, 2H), 7.51 (dd, 1H), 6.34 (s, 1H), 3.87-3.76 (m, 1H), 3.44 (d, 2H), 3.26-3.10 (m, 2H), 2.32 (d, 2H), 1.96 (d, 2H).
Example 84
4-(Piperidin-4-yl)-10-(3-thienyl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1242] ##STR00314##
[1243] Tert-butyl 4-[2-oxo-10-(3-thienyl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (98 mg, 0.22 mmol) was dissolved in 1,4-dioxane (8 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 1.1 mL, 4.4 mmol). The mixture was stirred at RT for 4 h. The resulting solid was filtered and washed with 1,4-dioxane to afford the title compound (34 mg, 40% of theory). LC-MS (Method 1B): R.sub.t=0.61 min, MS (ESIPos): m/z=351 [M+HxHCl].sup.+
[1244] .sup.1H-NMR (500 MHz, D.sub.2O): =7.59 (br. s, 1H), 7.34 (br. s., 1H), 7.30-7.20 (m, 2H), 7.05 (br. s, 1H), 6.81-6.72 (m, 1H), 6.23 (br. s., 1H), 3.64 (d, 2H), 3.48-3.37 (m, 1H), 3.31-3.15 (m, 2H), 2.28 (d, 2H), 1.97-1.79 (m, 2H).
Example 85
10-(2-Methylphenyl)-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1245] ##STR00315##
[1246] Tert-butyl 4-[10-(2-methylphenyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (150 mg, 0.33 mmol) was dissolved in 1,4-dioxane (13 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 1.6 mL, 6.5 mmol). The mixture was stirred at RT for 4 h. Concentration in vacuo afforded the title compound (123 mg, 95% of theory).
[1247] LC-MS (Method 1B): R.sub.t=0.67 min, MS (ESIPos): m/z=359 [M+HxHCl].sup.+
[1248] .sup.1H-NMR (500 MHz, D.sub.2O): =7.58 (d, 1H), 7.54-7.48 (m, 1H), 7.47-7.39 (m, 2H), 7.30 (t, 1H), 7.09 (d, 1H), 6.78 (d, 1H), 6.35 (s, 1H), 3.87-3.62 (m, 3H), 3.37-3.27 (m, 2H), 2.48-2.38 (m, 2H), 2.00 (s, 5H).
Example 86
10-(1-Methyl-1H-pyrazol-5-yl)-4-(piperidin-4-yl)pyrimido[1,2-b]indazo-2(1H)-one Hydrochloride
[1249] ##STR00316##
[1250] Tert-butyl 4-[10-(1-methyl-1H-pyrazol-5-yl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (140 mg, 0.31 mmol) was dissolved in 1,4-dioxane (6 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 3.6 mL, 14.4 mmol). The mixture was stirred at RT for 4 h. Concentration in vacuo afforded the title compound (110 mg, 92% of theory).
[1251] LC-MS (Method 1B): R.sub.t=0.52 min, MS (ESIPos): m/z=349 [M+HxHCl].sup.+
[1252] .sup.1H-NMR (500 MHz, D.sub.2O): =7.85 (d, 1H), 7.71 (d, 1H), 7.59 (dd, 1H), 7.10 (d, 1H), 6.56 (d, 1H), 6.47 (s, 1H), 3.79 (s, 4H), 3.69 (d, 2H), 3.39-3.30 (m, 2H), 2.47 (d, 2H), 2.07-1.95 (m, 2H).
Example 87
10-(1-Methyl-1H-pyrazol-4-yl)-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1253] ##STR00317##
[1254] Tert-butyl 4-[10-(1-methyl-1H-pyrazol-4-yl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (121 mg, 0.27 mmol) was dissolved in 1,4-dioxane (6 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 3.1 mL, 12.4 mmol). The mixture was stirred at RT for 4 h. Concentration in vacuo afforded the title compound (128 mg, 99% of theory).
[1255] LC-MS (Method 1B): R.sub.t=0.53 min, MS (ESIPos): m/z=349 [M+HxHCl].sup.+
[1256] .sup.1H-NMR (500 MHz, D.sub.2O): =7.93 (s, 1H), 7.79 (s, 1H), 7.05 (dd, 1H), 6.97 (d, 1H), 6.57 (d, 1H), 6.24 (s, 1H), 3.89 (s, 3H), 3.71 (d, 2H), 3.33-3.24 (m, 2H), 3.24-3.15 (m, 1H), 2.26 (d, 2H), 1.92-1.80 (m, 2H).
Example 88
4-(Piperidin-4-yl)-10-(2-thienyl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1257] ##STR00318##
[1258] Tert-butyl 4-[2-oxo-10-(2-thienyl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (101 mg, 0.22 mmol) was dissolved in 1,4-dioxane (5 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 2.6 mL, 10.3 mmol). The mixture was stirred at RT for 4 h. Concentration in vacuo afforded the title compound (85 mg, 98% of theory).
[1259] LC-MS (Method 1B): R.sub.t=0.66 min, MS (ESIPos): m/z=351 [M+HxHCl].sup.+
[1260] .sup.1H-NMR (500 MHz, D.sub.2O): =7.51 (d, 1H), 7.28 (d, 1H), 7.23 (dd, 1H), 7.16 (dd, 1H), 7.08 (d, 1H), 6.82 (d, 1H), 6.23 (s, 1H), 3.59 (d, 2H), 3.52-3.42 (m, 1H), 3.20 (t, 2H), 2.27 (d, 2H), 1.91-1.77 (m, 2H).
Example 89
10-Bromo-8-methyl-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1261] ##STR00319##
[1262] Tert-butyl 4-(10-bromo-8-methyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (404 mg, 0.88 mmol) was dissolved in 1,4-dioxane (18 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 10.0 mL, 40.0 mmol). The mixture was stirred at RT for 4 h. Concentration in vacuo afforded the title compound (360 mg, 95% of theory).
[1263] LC-MS (Method 1B): R.sub.t=0.60 min, MS (ESIPos): m/z=361 [M+HxHCl].sup.+
[1264] .sup.1H-NMR (500 MHz, D.sub.2O): =6.87 (s, 1H), 6.62 (s, 1H), 6.25 (s, 1H), 3.74-3.66 (m, 2H), 3.51-3.42 (m, 1H), 3.36-3.27 (m, 2H), 2.44-2.37 (m, 2H), 2.18 (s, 3H), 2.03-1.91 (m, 2H).
Example 90
10-Chloro-9-fluoro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1265] ##STR00320##
[1266] Tert-butyl 4-(10-chloro-9-fluoro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (428 mg, 1.02 mmol) was dissolved in 1,4-dioxane (20 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 11.7 mL, 46.7 mmol). The mixture was stirred at RT for 4 h. Concentration in vacuo afforded the title compound (378 mg, 91% of theory).
[1267] LC-MS (Method 1B): R.sub.t=0.55 min, MS (ESIPos): m/z=321 [M+HxHCl].sup.+
[1268] .sup.1H-NMR (500 MHz, D.sub.2O): =7.23 (dd, 1H), 7.12 (dd, 1H), 6.38 (s, 1H), 3.69 (d, 2H), 3.57-3.48 (m, 1H), 3.36-3.28 (m, 2H), 2.44 (d, 2H), 2.05-1.94 (m, 2H).
Example 91
4-(Piperidin-4-yl)-10-(1H-1,2,4-triazol-1-yl)pyrimido[1,2-b]indazol-2(1H)-one hydrochloride
[1269] ##STR00321##
[1270] Tert-butyl 4-[2-oxo-10-(1H-1,2,4-triazol-1-yl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (96 mg, 0.22 mmol) was dissolved in 1,4-dioxane (2.2 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 0.55 mL, 2.2 mmol). The mixture was stirred at RT for 16 h. The resulting solid was filtered and washed with 1,4-dioxane to afford the title compound (72 mg, 87% of theory).
[1271] LC-MS (Method 1B): R.sub.t=0.43 min, MS (ESIPos): m/z=336 [M+HxHCl].sup.+
[1272] .sup.1H-NMR (500 MHz, D.sub.2O): =9.07 (s, 1H), 8.24 (s, 1H), 7.35-7.26 (m, 2H), 7.15 (d, 1H), 6.34 (s, 1H), 3.69 (d, 2H), 3.60-3.50 (m, 1H), 3.39-3.28 (m, 2H), 2.43 (d, 2H), 2.05-1.91 (m, 2H).
Example 92
9-Fluoro-10-(2-fluorophenyl)-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1273] ##STR00322##
[1274] Tert-butyl 4-[9-fluoro-10-(2-fluorophenyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (42 mg, 0.09 mmol) was dissolved in 1,4-dioxane (1 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 1.0 mL, 4.0 mmol). The mixture was stirred at RT for 4 h. Concentration in vacuo afforded the title compound (36 mg, 86% of theory).
[1275] LC-MS (Method 1B): R.sub.t=0.70 min, MS (ESIPos): m/z=381 [M+HxHCl].sup.+
[1276] .sup.1H-NMR (500 MHz, D.sub.2O): =7.63-7.52 (m, 2H), 7.37-7.29 (m, 3H), 7.27-7.20 (m, 1H), 6.35 (s, 1H), 3.69-3.60 (m, 3H), 3.34-3.24 (m, 2H), 2.40-2.30 (m, 2H), 1.98-1.86 (m, 2H).
Example 93
10-(2-Ethoxyphenyl)-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1277] ##STR00323##
[1278] Tert-butyl 4-[10-(2-ethoxyphenyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (150 mg, 0.31 mmol) was dissolved in 1,4-dioxane (6 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 3.5 mL, 14.1 mmol). The mixture was stirred at RT for 4 h. Concentration in vacuo afforded the title compound (173 mg).
[1279] LC-MS (Method 1B): R.sub.t=0.68 min, MS (ESIPos): m/z=389 [M+HxHCl].sup.+
[1280] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =9.07-8.76 (m, 1H), 7.60 (d, 1H), 7.51 (d, 1H), 7.41 (dd, 1H), 7.33 (dd, 1H), 7.12 (d, 1H), 7.03 (dd, 1H), 6.90 (d, 1H), 6.60 (br. s, 1H), 4.00 (q, 2H), 3.61-3.53 (m, 1H), 3.45 (d, 2H), 3.29-3.12 (m, 2H), 2.36 (d, 2H), 2.04-1.87 (m, 2H), 0.78 (t, 3H)
Example 94
10-(2-Isopropoxyphenyl)-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1281] ##STR00324##
[1282] Tert-butyl 4-[10-(2-isopropoxyphenyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (130 mg, 0.26 mmol) was dissolved in 1,4-dioxane (5 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 3.0 mL, 12.0 mmol). The mixture was stirred at RT for 4 h. Concentration in vacuo afforded the title compound (153 mg).
[1283] LC-MS (Method 1B): R.sub.t=0.72 min, MS (ESIPos): m/z=403 [M+HxHCl].sup.+
[1284] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =9.07-8.80 (m, 1H), 7.59 (d, 1H), 7.49 (dd, 1H), 7.39 (dd, 1H), 7.32 (dd, 1H), 7.11 (d, 1H), 7.02 (dd, 1H), 6.90 (d, 1H), 6.55 (br. s, 1H), 4.55-4.46 (m, 1H), 3.57 (s, 1H), 3.45 (d, 2H), 3.22 (m, 2H), 2.35 (d, 2H), 2.03-1.88 (m, 2H), 0.96 (d, 6H).
Example 95
10-(2-Fluorophenyl)-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one
[1285] ##STR00325##
[1286] 10-(2-fluorophenyl)-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one hydrochloride (100 mg, 0.23 mmol) was dissolved in hydrochloric acid (1.0 M in water) and treated with sodium hydroxide solution (1.0 M in water). The precipitate was collected by filtration, washed with water, and dried under vacuo to afford the title compound (35 mg, 42% of theory).
[1287] LC-MS (Method 1B): R.sub.t=0.68 min, MS (ESIPos): m/z=363 [M+H].sup.+
Example 96
4-(Piperidin-4-yl)-10-(1H-pyrazol-1-yl)pyrimido[1,2-b]indazol-2(1H)-one hydrochloride
[1288] ##STR00326##
[1289] Tert-butyl 4-[2-oxo-10-(1H-pyrazol-1-yl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (380 mg, 0.87 mmol) was dissolved in 1,4-dioxane (14 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 5.0 mL, 20.0 mmol). The mixture was stirred at RT for 8 h. Concentration in vacuo and trituration with acetonnitrile afforded the title compound (338 mg).
[1290] .sup.1H-NMR (500 MHz, D.sub.2O): =7.67 (s, 1H), 7.24 (s, 1H), 6.67 (dd, 1H), 6.52 (d, 1H), 6.28 (s, 1H), 6.20 (d, 1H), 5.94 (s, 1H), 3.68-3.59 (m, 2H), 3.26-3.15 (m, 2H), 3.09-2.98 (m, 1H), 2.23-2.14 (m, 2H), 1.88-1.76 (m, 2H).
Example 97
10-(2-Fluoro-6-methoxyphenyl)-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1291] ##STR00327##
[1292] Tert-butyl 4-[10-(2-fluoro-6-methoxyphenyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (21 mg, 0.043 mmol) was dissolved in 1,4-dioxane (0.6 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 0.2 mL, 0.8 mmol). The mixture was stirred at RT for 4 h. Concentration in vacuo afforded the title compound (18 mg, 96% of theory).
[1293] LC-MS (Method 1B): R.sub.t=0.66 min, MS (ESIPos): m/z=393 [M+HxHCl].sup.+
[1294] .sup.1H-NMR (500 MHz, D.sub.2O): =8.46 (s, 1H), 7.73-7.66 (m, 1H), 7.66-7.52 (m, 2H), 7.17-6.99 (m, 3H), 6.42 (s, 1H), 3.88-3.78 (m, 1H), 3.77-3.71 (m, 3H), 3.70-3.61 (m, 2H), 3.40-3.27 (m, 2H), 2.56-2.43 (m, 2H), 2.09-1.94 (m, 2H).
Example 98
4-(Piperidin-4-yl)-10-(2H-1,2,3-triazol-2-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1295] ##STR00328##
[1296] Tert-butyl 4-[2-oxo-10-(2H-1,2,3-triazol-2-yl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (750 mg, 1.71 mmol) was dissolved in 1,4-dioxane (25 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 8.0 mL, 32.0 mmol). The mixture was stirred at RT for 16 h. Concentration in vacuo afforded the title compound (730 mg, 96% of theory).
[1297] LC-MS (Method 1B): R.sub.t=0.58 min, MS (ESIPos): m/z=336 [M+HxHCl].sup.+
[1298] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =12.24 (br. s, 1H), 8.94 (br. s, 1H), 8.75 (br. s, 1H), 8.45 (s, 2H), 7.80 (d, 1H), 7.66 (d, 1H), 7.55 (dd, 1H), 6.38 (s, 1H), 3.84 (br. s., 1H), 3.44 (d, 2H), 3.19 (d, 2H), 2.32 (d, 2H), 1.94 (d, 2H).
Example 99
4-(Piperidin-4-yl)-10-(1H-1,2,3-triazol-1-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1299] ##STR00329##
[1300] Tert-butyl 4-[2-oxo-10-(1H-1,2,3-triazol-1-yl)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (237 mg, 0.54 mmol) was dissolved in 1,4-dioxane (8 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 1.4 mL, 5.6 mmol). The mixture was stirred at 60 C. for 6 h. The precipitate was collected by filtration and dried to afford the title compound (210 mg, 88% of theory).
[1301] LC-MS (Method 1B): R.sub.t=0.44 min, MS (ESIPos): m/z=336 [M+HxHCl].sup.+
[1302] .sup.1H-NMR (500 MHz, D.sub.2O): =8.39 (s, 1H), 7.88 (s, 1H), 7.12-7.05 (m, 2H), 6.91-6.83 (m, 1H), 6.26 (s, 1H), 3.70 (d, 2H), 3.42 (t, 1H), 3.31 (t, 2H), 2.40 (d, 2H), 2.04-1.92 (m, 2H).
Example 100
10-Chloro-7-methyl-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1303] ##STR00330##
[1304] Tert-butyl 4-(10-chloro-7-methyl-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)piperidine-1-carboxylate (230 mg, 0.55 mmol) was dissolved in 1,4-dioxane (2 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 1.4 mL, 5.6 mmol). The mixture was stirred at RT for 16 h. The precipitate was collected by filtration, washed with dioxane, and dried to afford the title compound (194 mg, 90% of theory).
[1305] LC-MS (Method 1B): R.sub.t=0.58 min, MS (ESIPos): m/z=317 [M+HxHCl].sup.+
[1306] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =9.01-8.71 (m, 1H), 7.21 (d, 1H), 7.01 (d, 1H), 6.67 (br. s, 1H), 3.98-3.83 (m, 1H), 3.21 (d, 2H), 2.37 (d, 2H), 1.98 (d, 2H).
Example 101
(+)-Cis-10-Chloro-4-(2-methylpiperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride [Enantiomerically Pure Cis-Isomer]
[1307] ##STR00331##
[1308] A suspension of (+)-cis-Tert-butyl 4-(10-chloro-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl)-2-methylpiperidine-1-carboxylate [enantiomerically pure cis-Isomer] (40 mg, 0.09 mmol) in methanol (0.053 ml) was treated with HCl 4N in dioxane (0.35 ml). The reaction mixture was stirred 1 h at rt. The mixture was evaporated and the crude was stirred in dichloromethane, evaporated and dried under vacuo to yield the title compound (22 mg, 66% of theory).
[1309] LC-MS (Method 5B): RT=0.54 min, MS (ESIPos): m/z=317 [M+HxHCl].sup.+
[1310] [].sup.20=+0.37 (c. 0.27, methanol) WL=589 nm
[1311] .sup.1H-NMR (400 MHz, MeOD): 7.41 (d, 1H), 7.27 (t, 1H), 6.96 (d, 1H), 6.41 (s, 1H), 4.08-3.98 (m, 1H), 3.83-3.74 (m, 1H), 3.57 (dm, 1H), 3.45-3.36 (m, 1H), 3.30-3.24 (m, 1H), 2.39-2.31 (m, 1H), 2.21 (dd, 1H), 2.08-1.98 (m, 1H), 1.47 (d, 3H).
Example 102
[2-oxo-4-(piperidin-4-yl)-1,2-dihydropyimido[1,2-b]indazol-10-yl]acetonitrile Hydrocloride
[1312] ##STR00332##
[1313] Tert-butyl 4-[10-(cyanomethyl)-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (12 mg, 0.03 mmol) was dissolved in methanol (0.08 mL) and then 4N HCl in dioxane (0.07 mL) was added and the mixture was stirred at room temperature overnight. The resulting suspension was filtered and the solid was washed with methanol and dried for 16 h in vacuo to give the title compound (5 mg, 53% of theory).
[1314] LC-MS (Method 3B): R.sub.t=1.30 min, MS (ESIPos): m/z=307 [M+HxHCl].sup.+
[1315] .sup.1H-NMR (400 MHz, D.sub.2O): =7.32 (d, 1H), 7.24 (dd, 1H), 6.76 (d, 1H), 6.39 (s, 1H), 3.98 (s, 2H), 3.60 (d, 2H), 3.51 (dd, 1H), 3.25 (dd, 2H), 2.35 (d, 2H), 1.89 (dd, 2H)
Example 103
10-(1H-imidazol-5-yl)-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1316] ##STR00333##
[1317] tert-butyl 4-{2-oxo-10-[1-(tetrahydro-2H-pyran-2-yl)-1H-imidazol-5-yl]-1,2-dihydropyrimido[1,2-b]indazol-4-yl}piperidine-1-carboxylate (55 mg, 0.11 mmol) was dissolved in 1,4-dioxane (1.5 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 0.53 mL, 2.12 mmol). The solvent was removed and the residue treated with acetonitrile. The resulting solid was filtered and washed with acetonitrile to afford the title compound (36.5 mg, 82% of theory).
[1318] LC-MS (Method 6B): R.sub.t=0.90 min, MS (ESIPos): m/z=335 [M+HxHCl].sup.+
[1319] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =ppm 15.89 (br. s, 1H), 9.09-9.39 (m, 3H), 8.65 (s, 1H), 7.70-7.83 (m, 2H), 7.60 (d, 1H), 6.83 (s, 1H), 3.84-4.06 (m, 1H), 3.44 (m, 2H), 3.00-3.28 (m, 2H), 2.30-2.41 (m, 2H), 1.99-2.15 (m, 2H).
Example 104
4-(piperidin-4-yl)-10-(1H-pyrrol-2-yl)pyrimido[1,2-b]indazol-2(1H)-one hydrochloride
[1320] ##STR00334##
[1321] tert-butyl 4-{10-[1-(tert-butoxycarbonyl)-1H-pyrrol-2-yl]-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl}piperidine-1-carboxylate (140 mg, 0.26 mmol) was dissolved in 1,4-dioxane (2.5 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 1.3 mL, 5.2 mmol). The solvent was removed and the residue treated with acetonitrile. The resulting solid was filtered and washed with acetonitrile to afford the title compound (79.4 mg, 74% of theory).
[1322] LC-MS (Method 5B): R.sub.t=1.48 min, MS (ESIPos): m/z=334 [M+HxHCl].sup.+
[1323] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =ppm 13.39 (br. s., 1H), 9.18 (br. s., 2H), 7.34-7.64 (m, 3H), 7.15 (br. s., 1H), 6.96 (br. s, 1H), 6.82 (s, 1H), 6.24 (d, 1H), 4.00 (t, 1H), 3.45 (d, 2H), 3.06-3.29 (m, 2H), 2.38 (d, 2H), 1.88-2.13 (m, 2H).
Example 105
10-hydroxy-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrobromide
[1324] ##STR00335##
[1325] 10-Methoxy-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one hydrochloride (Example 8) (25 mg, 0.08 mmol) was dissolved in acetic acid (2 mL) and treated with hydrobromic acid (58% in water, 0.5 mL, 9.2 mmol). The mixture was heated to 125 C. for 16h, then the solvents were removed and the resulting solid was dried in high vacuum to afford the title compound (32.5 mg, quant.).
[1326] LC-MS (Method 7B): R.sub.t=1.14 min, MS (ESIPos): m/z=285.1 [M+HxHBr].sup.+
[1327] .sup.1H-NMR (400 MHz, D.sub.2O-d.sub.6): =ppm 6.89-7.04 (m, 1H), 6.56 (d, 1H), 6.02 (s, 1H), 5.93-5.99 (m, 1H), 3.50-3.63 (m, 2H), 3.19 (br. s., 3H), 2.20-2.31 (m, 2H), 1.72-1.89 (m, 2H).
Example 106
2-oxo-4-(piperidin-4-yl)-1,2-dihydropyrimido[1,2-b]indazole-10-carboxylic Acid Hydrochloride
[1328] ##STR00336##
[1329] 4-[1-(tert-butoxycarbonyl)piperidin-4-yl]-2-oxo-1,2-dihydropyrimido[1,2-b]indazole-10-carboxylic acid (185 mg, 0.45 mmol) was dissolved in 1,4-dioxane (2 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 2.2 mL, 9.0 mmol) for 18h at rt. The resulting solid was filtered and washed with acetonitrile to afford the title compound (99.5 mg, 64% of theory).
[1330] LC-MS (Method 5B): R.sub.t=0.33 min, MS (ESIPos): m/z=313.2 [M+HxHCl].sup.+
[1331] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =ppm 13.90-14.33 (br. s, 1H), 11.84 (br. s., 1H), 9.02 (br. s, 1H), 8.85 (br. s, 1H), 7.90 (d, 1H), 7.81 (d, 1H), 7.52 (t, 1H), 6.32 (s, 1H), 3.73-3.87 (m, 1H), 3.43 (m, 3H), 3.17 (m, 2H), 2.30 (d, 2H), 1.95 (m, 2H).
Example 107
4-(piperidin-4-yl)-10-(2,2,2-trifluoroethoxy)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1332] ##STR00337##
[1333] tert-butyl 4-[2-oxo-10-(2,2,2-trifluoroethoxy)-1,2-dihydropyrimido[1,2-b]indazol-4-yl]piperidine-1-carboxylate (188 mg, 0.40 mmol) was dissolved in 1,4-dioxane (2.5 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 1.3 mL, 5.2 mmol). The resulting solid was filtered and washed with acetonitrile to afford the title compound (150 mg, 92% of theory).
[1334] LC-MS (Method 8B): R.sub.t=0.71 min, MS (ESIPos): m/z=367 [M+HxHCl].sup.+
[1335] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =ppm (br. s, 2H), 7.30-7.44 (m, 1H), 7.21 (d, 1H), 6.61 (d, 1H), 6.44 (br. s, 1H), 4.98 (q, 2H), 3.75-3.91 (m, 1H), 3.42 (d, 2H), 3.16 (m, 2H), 2.31 (d, 2H), 1.98 (d, 2H).
Example 108
10-amino-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one Hydrochloride
[1336] ##STR00338##
[1337] tert-butyl 4-{10-[(tert-butoxycarbonyl)amino]-2-oxo-1,2-dihydropyrimido[1,2-b]indazol-4-yl}piperidine-1-carboxylate (80 mg, 0.17 mmol) was dissolved in 1,4-dioxane (2 mL) and treated with hydrochloric acid (4 M solution in 1,4-dioxane, 1.3 mL, 5.2 mmol) for 3 d. The resulting solid was filtered and washed with 1,4-dioxane and acetonitrile to afford the title compound (46 mg, 78% of theory).
[1338] LC-MS (Method 7B): R.sub.t=1.13 min, MS (ESIPos): m/z=384 [M+HxHCl].sup.+
[1339] .sup.1H-NMR (400 MHz, DMSO-d.sub.6): =ppm 9.12 (br. s., 2H), 7.26 (br. s., 1H), 6.88-7.07 (m, 1H), 6.53-6.69 (m, 1H), 6.28-6.49 (m, 1H), 3.73-3.97 (m, 1H), 3.43 (m, 2H), 3.17 (m, 2H), 2.32 (m, 2H), 1.99 (m, 2H).
X-ray diffractometry:
Synthesis of 10-Chloro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one (example 66) maleate
[1340] Approximately 100 mg of 10-Chloro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one (example 66) were solved in hexafluoroisopropanol without any heating. This solution was added to a solution of an equimolar amount of maleic acid solved in water. This solution was evaporated at room temperature and atmospheric pressure. The resulting solid was analyzed by x ray powder diffraction and corresponds to 10-Chloro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one (example 66) in form of its maleate.
Synthesis of 10-Chloro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one (example 66) Acetate
[1341] Approximately 100 mg of 10-Chloro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one (example 66) were solved in hexafluoroisopropanol without any heating. This solution was added to a solution of an equimolar amount of acetic acid solved in water. This solution was evaporated at room temperature and atmospheric pressure. The resulting solid was analyzed by x ray powder diffraction and corresponds to 10-Chloro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one (example 66) in form of its acetate.
Synthesis of 10-Chloro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one (example 66) Sulfate
[1342] Approximately 100 mg of 10-Chloro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one (example 66) were solved in hexafluoroisopropanol without any heating. This solution was added to a solution of an equimolar amount of sulfuric acid solved in water. This solution was evaporated at room temperature and atmospheric pressure. The resulting solid was analyzed by x ray powder diffraction and corresponds to 10-Chloro-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one (example 66) in form of its sulfate.
Measurement Conditions of X-Ray Diffractometry:
[1343] Transmission diffractometer PANalytical XPert PRO with PIXcel counter (multichannel):
TABLE-US-00001 Source of raw data XRPD measurement Scan-Axis Gonio Starting position [2Th.] 2.0066 End position [2Th.] 37.9906 Material of anode Cu Wavelength K-Alpha1 [] 1.54060 Wavelength K-Alpha2 [] 1.54443 K-A2/K-A1 ratio 0.50000 Generator 40 mA, 40 kV Primary monochromator focussing X-ray mirror Sample rotation yes
TABLE-US-00002 TABLE 1 X-ray diffractogram of the maleate, acetate, and sulfate of 10-Chloro- 4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one (example 66) Peak List [2 Theta] Maleate Acetate Sulfate 9.6 8.3 5.6 13.5 9.1 10.7 17.4 12.3 13.8 22.1 24.3 20.3 23.1 25.0 20.8 23.7 26.7 25.8 26.7 28.3 27.6
B. ASSESSMENT OF THE PHARMACOLOGICAL ACTIVITY
[1344] The following abbreviations are used: [1345] Brij polyoxyethylene lauryl ether [1346] CaCl.sub.2 calciumchloride [1347] CFT clot formation time [1348] CM5 carboxymethylated dextran biosensor chips [1349] CT clotting time [1350] DMSO dimethylsulfoxide [1351] EDC N-ethyl-N-(3-dimethylaminopropyl)-carbodiimide hydrochloride [1352] FVIII factor eight [1353] HEPES hydroxyethyl-piperazineethanesulfonic acid [1354] HCl hydrochloric acid [1355] IC.sub.50 half-maximal inhibitory concentration [1356] K.sub.D dissociation constant [1357] MCF maximum clot firmness [1358] ML maximum lysis [1359] NaCl sodium chloride [1360] NHS N-hydroxysuccinimide [1361] OD optical density [1362] PBS phosphate buffered saline [1363] P-20 hybond P20 [1364] Rmax response at saturation [1365] RU response units [1366] SPR surface plasmon resonance [1367] TF tissue factor [1368] tPA tissue plasminogen activator [1369] v/v volume/volume
[1370] The pharmacological effect of the compounds of formula (I-A) or (I-B) according to the invention can be shown in the following assays:
B-1. Biacore Assay
Assay Description Surface Plasmon Resonance Plasminogen Inh.
Definitions
[1371] The term surface plasmon resonance, as used herein, refers to an optical phenomenon that allows for the analysis of the reversible associations of biological molecules in real time within a biosensor matrix, for example using the Biacore system (GE Healthcare Biosciences, Uppsala, Sweden). Biacore uses the optical properties of surface plasmon resonance (SPR) to detect alterations in the refractive index of a buffer, which changes as molecules in solution interact with the target immobilized on the surface. In brief, proteins are covalently bound to the dextran matrix at a known concentration and a ligand for the protein is injected through the dextran matrix. Near infrared light, directed onto the opposite side of the sensor chip surface is reflected and also induces an evanescent wave in the gold film, which in turn, causes an intensity dip in the reflected light at a particular angle known as the resonance angle. If the refractive index of the sensor chip surface is altered (e.g. by compound binding to the protein bound to the surface) a shift occurs in the resonance angle. This angle shift can be measured. These changes are displayed with respect to time along the y-axis of a sensorgram, which depicts the association and dissociation of any biological reaction. For further descriptions see Jinsson U et al al., 1993 Ann Biol Clin.; 51(1):19-26.; Johnsson B et al, Anal Biochem. 1991; 198(2):268-77.; Day Y et al, Protein Science, 2002; 11, 1017-1025; Myskza D G, Anal Biochem., 2004; 329, 316-323
[1372] The term K.sub.D, as used herein, is intended to refer to the dissociation constant of a particular compound/target protein complex.
Biological Activity
[1373] The biological activity (e.g. as inhibitors of plasminogen) of the compounds of the invention can be measured using the assays set forth in the examples below, for example the surface plasmon resonance (SPR) experiments described in Example 1. The level of activity exhibited by a given compound in the SPR assay can be defined in terms of the K.sub.D value.
Example 1
[1374] The ability of the compounds of the invention to bind human plasminogen protein may be determined using surface plasmon resonance (SPR). K.sub.D values may be measured using a Biacore T200 or Biacore 4000 instrument (GE Healthcare, Uppsala, Sweden).
[1375] Cloning, expression, and purification of recombinant human plasminogen kringle 1 domain protein is performed according to a protocol based on published methods (Menhart et al, Biochemistry, 1991, 30, 1948-1957) with modifications as follows: Briefly, an E. coli expression construct coding for the amino acid sequence MKYLLPTAAAGLLLLAAQPAMAHHHHHHHHHHMDYDIPTTENLYFQG followed by the human plasminogen kringle 1 domain protein sequence amino acids 101 to 181 (numbering based on Uniprot acc no P00747) and a stop codon is synthesized (GeneArt, Regensburg, Germany) and cloned into a modified pET22b vector (Novagen, Darmstadt, Germany), allowing for periplasmatic expression in E. coli and immobilized metal ion affinity chromatography employing a deca-histidine tag. E. coli BL21DE3 cells (Novagen) are transformed, grown and harvested and their periplasmatic fraction released using a buffer comprising 50 mM Tris pH 8 and 500 mM sucrose (modified from Menhart et al, Biochemistry, 1991, 30, 1948-1957). The periplasmatic fraction is then sequentially filtered using 8 m, 3 m and 1.2 m cellulose nitrate filters (Sartorius Stedim, Gtittingen, Germany) and the filtrate subjected to Ni-Sepharose HP chromatography (GE Healthcare) according to the manufacturer's instructions. The resulting eluate is then subjected to a Desalting Hi Prep 26/10 column (GE Healthcare) equilibrated in buffer (100 mM sodium phosphate pH 8, 300 mM NaCl) followed by a lysine sepharose 4B (GE Healthcare) chromatography step according to the manufacturer's instructions. The resulting fractions of highly purified protein at concentrations of approximately 0.5 mg/ml are buffer exchanged against buffer (100 mM sodium phosphate pH 8, 300 mM NaCl) and stored at 80 C.
[1376] For SPR measurements, recombinant human plasminogen kringle 1 protein is immobilized using standard amine coupling (Johnsson B et al, Anal Biochem. 1991 Nov. 1; 198(2):268-77). Briefly, carboxymethylated dextran biosensor chips (CM5, GE Healthcare) are activated with N-ethyl-N-(3-dimethylaminopropyl)-carbodiimide hydrochloride (EDC) and N-hydroxysuccinimide (NHS) according to the supplier's instructions. Purified recombinant human plasminogen kringle 1 protein is diluted in 10 mM sodium acetate pH 4.5 into 10 g/ml and injected on the activated chip surface. Subsequently, 1 M ethanolamine-HCl (GE Healthcare) is injected to block unreacted groups, resulting in approximately 400 response units (RU) of immobilized protein. A reference surface is generated by treatment with NHS-EDC and ethanolamine-HCl. Compounds are dissolved in an aqueous 1% v/v acetic acid solution to a concentration of 20 mM, followed by addition of 1 vol of 100% dimethylsulfoxide (DMSO, Sigma-Aldrich, Germany) resulting in a compound concentration of 10 mM and subsequently diluted in running buffer (PBS pH 7.4, 0.05% v/v Surfactant P-20 (GE Healthcare), 1% v/v DMSO). For affinity measurements, five-fold serial dilutions of compound (0.64 nM to 10 M) are injected over immobilized protein. The resulting sensorgrams are double-referenced against the reference surface as well as against blank injections. The double-referenced steady state responses are plotted against the test compound concentration and a fit using the equation Response=Rmax*[compound]/([compound]+K.sub.D)+offset is generated. Parameters Rmax (response at saturation), K.sub.D (dissociation constant) and the offset parameter are calculated using a nonlinear least squares fit as implemented in the Biacore evaluation software (GE Healthcare).
B-2. Plasma-Based Clot Lysis Assay (5%)
[1377] The clot-lysis test system configures the kinetics of clot formation and degradation in vitro and allows quantifying modulation of the process by selected test compounds.
[1378] The test compounds were dissolved in 1% acetic acid and further complemented with an equal volume of DMSO. The resulting stock solutions were serially diluted in 0.5% acetic acid/50% DMSO. 1 L aliquots of these solutions were placed into 384 well microplates (Greiner, black, transparent bottom), followed by 30 L of diluted human citrated plasma (platelet-poor, final concentration: 5%; supplemented with fibrinogen, final concentration: 3 M; dilution buffer: 20 mM HEPES, 150 mM NaCl, 0.01% Brij (pH 7)). The reactions were started by addition of 20 L of CaCl.sub.2 (final concentration: 10 mM), and tPA (tissue plasminogen activator, final concentration: 0.2 nM) in dilution buffer, followed by an additional volume of 20 L dilution buffer for improved mixing. The reactions were incubated at 37 C. Clot formation and degradation was monitored spectrophotometrically by kinetic optical density measurements at 405 nm. IC50 values were determined by comparing the resulting time courses with the time course of a blank control reaction.
Results B-2.
[1379]
TABLE-US-00003 IC50 IC50 IC50 Example (nM) Example (nM) Example (nM) 1 51 2 30 3 28 4 28 5 37 6 94 7 95 8 46 9 36 10 34 11 26 12 32 13 31 14 50 15 48 16 34 17 22 18 38 19 26 20 22 21 30 22 26 23 28 24 34 25 21 26 29 27 13 28 33 29 28 30 46 31 97 32 210 33 21 36 18 37 44 38 60 39 24 40 38 41 23 42 110 43 100 44 48 45 37 46 17 47 24 48 36 49 36 50 14 51 15 52 13 53 10 54 15 55 14 56 14 57 13 58 15 59 16 60 14 61 24 62 18 63 13 64 19 65 25 66 15 67 13 68 25 69 20 70 35 71 15 72 14 73 23 74 15 75 16 76 15 77 11 78 15 79 11 80 18 81 16 82 20 83 41 84 23 85 18 86 15 87 25 88 26 89 36 90 24 91 27 92 27 93 28 94 35 95 18 96 26 97 30 98 27 99 29 100 30 101 35 103 110 104 35 105 74 106 420 107 34 108 35
B-3. Plasma-Based Clot Lysis Assay (85%)
[1380] For induction of clot formation and subsequent clot lysis (fibrinolysis) a mixture of tissue factor (1 M) and tissue plasminogen activator (tPA, 0.04 M) was added to human plasma (final concentration 85%). The test compounds or saline controls were added simultaneously to TF and tPA. The functional activity is triggered with CaCl.sub.2(12.5 mM) and was monitored by measuring the optical density at 405 nM (OD.sub.405). Fibrinolysis was evaluated as a relative decrease of OD after maximal clot formation. (Sperzel M, Huetter J, 2007, J Thromb Haemost 5(10): 2113-2118).
B-4. Thrombelastometry
[1381] Whole blood Thrombelastometry measurements are performed to confirm the potency of the compounds in inhibiting fibrinolysis and improving firmness of the clots (as seen in plasma based assays), for example using the ROTEM system (Tem International GmbH, Munich, Germany). The ROTEM system is a diagnostic (viscoelastic) technique which provides information on hemostasis. It includes a four-channel instrument, a computer, activators and disposable cups and pins. Kinetic changes in the blood sample are detected optically (light reflection) and data obtained from the reflected light is then processed into a graphical output by an integrated computer. Characteristic curves and numeric paremeters are generated. Thrombelastographic parameters of ROTEM hemostatic systems include: Clotting Time (CT), which reflects the reaction time (the time required to obtain 2 mm amplitude following the initiation of data collection) to initiate blood clotting; Clot Formation Time (CFT), provides information about the kinetics of clot formation; the alpha angle to reflect clotting propagation. Maximum Clot Firmess (MCF) is defined as maximum amplitude which reflects the firmness of the clot (clot quality) and Maximum Lysis (ML) indicates fibrinolysis. For induction of clot formation and subsequent clot lysis a mixture of tissue factor (TF) and tissue plasminogen activator (tPA) is added to 300 L freshly drawn citrated whole blood. Blood from patients with coagulation disorders and antibodies against coagulation factors (e.g. to neutralize FVIII activity and render the blood hemophilic) may be used. TF and tPA concentrations are adjusted dependent on the different conditions and species the whole blood is drawn from. Data are collected for 2 hours using a computer-controlled ROTEM system.
[1382] For induction of clot formation and subsequent clot lysis in human whole blood or human Factor VIII depleted whole blood, a mixture of tissue factor (final concentration 0.5 M) and tissue plasminogen activator (tPA, final concentration 10 nM) is added to 300 L citrated human whole blood. The test compounds or controls are added simultaneously to TF and tPA.
[1383] For induction of clot formation and subsequent clot lysis (fibrinolysis) in rat whole blood, a mixture of tissue factor (final concentration 1 M) and tissue plasminogen activator (tPA, final concentration 50 nM) is added to 300 L citrated rat whole blood. The test compounds or controls are added simultaneously to TF and tPA. Or in the case of ex vivo experiments the test compounds are dosed to the animal, blood is drawn at different time points after administration and added to the test cup.
[1384] For induction of clot formation and subsequent clot lysis (fibrinolysis) in hemophilia A dog plasma or whole blood, a mixture of tissue factor (TF) and tissue plasminogen activator (tPA) is added to 300 L citrated hemophilia A whole blood or plasma. TF and tPA concentrations are titrated and adjusted according to the current needs and technical requirements. Different concentrations of rFVIII are added to the test system in vitro (1-100%). The test compounds or controls are added simultaneously to TF and tPA. In the case of ex vivo experiments the test compounds are dosed to the animal, blood is drawn at different time points after administration and added to the test cup.
B-5. In Vivo Assays
[1385] To determine the protective effect of compounds on clot stability and blood loss in vivo, different bleeding models in different species are employed. Animals may be anticoagulated with different anticoagulants to induce a bleeding tendency. Genetically modified animals to mimick blood coagulation disorders may be used or antibodies to neutralize activity of different coagulation factors may be administered. Compounds of the invention are administered orally or parenterally at various indicated doses, at varying time courses prior to the injury. Injuries and endpoints may vary dependent on the mimicked disease condition.
B-5.1 Tail Bleeding in Hyperfibrinolytic Rats
[1386] In anaesthetized rats hyperfibrinolysis is induced by a continuous infusion of tPA (8 mg/kg/h) for twenty-five minutes via the right jugular vein. The right jugular vein is exposed and cannulated with saline-filled polyethylene catheters. The catheter is connected to a syringe pump (Braun, Melsungen, Germany) for the infusion of tPA. Hemostatic efficacy is evaluated in a rat bleeding model, where 8 mg/kg/h tPA is continuously infused to prolong bleeding time beyond control values. Test compounds or vehicle are administered by oral gavage at different time points before induction of anesthesia or intravenously through a second catheter in the contralateral jugular vein starting ten minutes after initiating tPA infusion. All infusions are stopped twenty-five minutes after onset of tPA administration. Twentyfive minutes after starting the tPA infusion, the rat tail is fully transected 2 mm from the tip of the tail. The tail is submerged in 37 C. physiological saline and bleeding is observed for 30 minutes. The time of bleeding is defined as the interval between the initial transection and the visual cessation of bleeding. A value of 30 minutes is assigned to those animals where bleeding does not stop during the entire observation period.
B-5.2 Tail Bleeding in Dabigatran-anticoagulated Rats Animals are treated orally at different time points prior to induction of bleeding. In anaesthetized, anticoagulated rats bleeding is induced by a bolus and continuous infusion (jugular vein) of the thrombin-inhibitor Dabigatran (bolus 1 mg/kg followed by an infusion of 0.3 mg/kg/ml/h) for 15 minutes. 15 minutes after Dabigatran infusion the rat tail is fully transected 2 mm from the tip of the tail. Bleeding is observed for 30 minutes after the tail is submerged in 37 C. physiological saline. Blood loss is evaluated visually in 30 second intervals utilizing a scoring system (0=no blood flow; 1=weak, breaking to no blood flow; 2=reduced blood flow; 3=continuous blood flow; 4=strong, continuous blood flow). Initial bleeding time until the first visual cessation of bleeding as well as cumulative bleeding time over the entire observation period of 30 minutes is evaluated.
C. EXEMPLARY EMBODIMENTS OF PHARMACEUTICAL COMPOSITIONS
[1387] The compounds of formula (I-A) or (I-B) according to the invention can be converted into pharmaceutical preparations in the following ways:
Tablet:
Composition:
[1388] 100 mg of the compound according to the invention, 50 mg of lactose (monohydrate), 50 mg of maize starch (native), 10 mg of polyvinylpyrrolidone (PVP 25) (from BASF, Ludwigshafen, Germany) and 2 mg of magnesium stearate.
[1389] Tablet weight 212 mg, diameter 8 mm, radius of curvature 12 mm.
Production:
[1390] The mixture of compound according to the invention, lactose and starch is granulated with a 5% strength solution (m/m) of the PVP in water. The granules are dried and then mixed with the magnesium stearate for 5 minutes. This mixture is compressed in a conventional tablet press (see above for format of the tablet). A guideline compressive force for the compression is 15 kN.
Suspension which can be Administered Orally:
Composition:
[1391] 1000 mg of the compound according to the invention, 1000 mg of ethanol (96%), 400 mg of Rhodigel (xanthan gum from FMC, Pennsylvania, USA) and 99 g of water.
[1392] 10 ml of oral suspension correspond to a single dose of 100 mg of the compound according to the invention.
Production:
[1393] The Rhodigel is suspended in ethanol, and the compound according to the invention is added to the suspension. The water is added while stirring. The mixture is stirred for about 6 h until the swelling of the Rhodigel is complete.
Solution which can be Administered Orally:
Composition:
[1394] 500 mg of the compound according to the invention, 2.5 g of polysorbate and 97 g of polyethylene glycol 400. 20 g of oral solution correspond to a single dose of 100 mg of the compound according to the invention.
Production:
[1395] The compound according to the invention is suspended in the mixture of polyethylene glycol and polysorbate with stirring. The stirring process is continued until the compound according to the invention has completely dissolved.
i.v. solution:
[1396] The compound according to the invention is dissolved in a concentration below the saturation solubility in a physiologically tolerated solvent (e.g. isotonic saline, 5% glucose solution and/or 30% PEG 400 solution). The solution obtained is sterilized by filtration and used to fill sterile and pyrogen-free injection containers.