METHODS AND COMPOSITIONS FOR INDUCING AN IMMUNE RESPONSE USING CONSERVED ELEMENT CONSTRUCTS
20180346520 ยท 2018-12-06
Assignee
- THE UNITED STATES OF AMERICA AS REPRESENTED BY THE SECRETARY OF THE DEPARTMENT OF HEALTH AND
- HUMAN SERVICES (Rockville, MD, US)
- University Of Washington (Seattle, WA)
Inventors
- Barbara K. Felber (Rockville, MD)
- George N. Pavlakis (Rockville, MD)
- James I. Mullins (Seattle, WA)
- Antonio Valentin (Frederick, MD)
- Siriphan Manocheewa (Seattle, WA, US)
Cpc classification
A61K39/21
HUMAN NECESSITIES
A61K39/39
HUMAN NECESSITIES
A61K9/0009
HUMAN NECESSITIES
A61K39/00
HUMAN NECESSITIES
A61K2039/55561
HUMAN NECESSITIES
C12N2740/16234
CHEMISTRY; METALLURGY
A61K9/0019
HUMAN NECESSITIES
C07K14/161
CHEMISTRY; METALLURGY
C12N2740/16222
CHEMISTRY; METALLURGY
C07K14/535
CHEMISTRY; METALLURGY
C12N2740/16122
CHEMISTRY; METALLURGY
C12N2740/16134
CHEMISTRY; METALLURGY
International classification
A61K39/21
HUMAN NECESSITIES
A61K39/39
HUMAN NECESSITIES
C07K14/535
CHEMISTRY; METALLURGY
Abstract
The invention provides methods and compositions for eliciting broad immune responses to HIV envelope proteins. The methods include use of nucleic acids constructs that encode conserved elements of HIV Env to induce immune responses.
Claims
1. A method of inducing an immune response to a protein of interest, the method comprising: priming an immune response to the protein of interest, wherein priming comprises administering at least one nucleic acid construct encoding a conserved element polypeptide, wherein the conserved elements are from the protein of interest and the polypeptide comprises at least three conserved elements, each from 8 to 50 amino acids in length where the conserved elements are joined by non-naturally occurring linkers, with the proviso that a nucleic acid construct encoding the fill-length protein, or a substantially full-length region thereof, is not administered in the priming step; boosting the immune response to the protein of interest, wherein bolting comprises co-administering (i) a nucleic acid construct encoding the full-length protein, or substantially full-length protein, and (ii) the nucleic acid construct encoding the conserved element polypeptide.
2. The method of claim 1, wherein the boosting step comprises administering the nucleic acid of (i) and the nucleic acid of (ii) at the same time.
3. The method of claim 1or 2, wherein the nucleic acid constructs are administered intramuscularly by in vivo electroporation.
4. The method of any one of claims 1 to 3, wherein the priming and boosting steps further comprise administering a second conserved element nucleic acid construct that encodes a second conserved element polypeptide that comprises at least one variant of a conserved element contained in the first conserved element polypeptide, wherein the variant in the second polypeptide differs from the variant in the first polypeptide by 1, 2, 3, 4, or 5 amino acids.
5. The method of claim 4, the first and second conserved element nucleic acid constructs are administered sequentially.
6. The method of claim 4. the first and second conserved element nucleic acid constructs are administered concurrently.
7. The method of any one of claims 1 to 6, wherein the protein of interest is HIV-1 Gag and the conserved elements are from HIV-1 p24.sup.gag.
8. The method of claim 7, wherein one conserved element polypeptide comprises at least 7 conserved elements from different regions of p24.sup.gag; and each of the conserved elements has a conserved element sequence shown in Table 2.
9. The method of claim 8, wherein one conserved element polypeptide comprises conserved elements that each have a sequence set forth in SEQ ID NOS:26, 27, 28, 29, 30, 31, and 32; and a second conserved element polypeptide comprises conserved elements that each have a sequence set forth in SEQ ID NOS: 33, 34, 35, 36, 37, 38, and 39.
10. The method of claim 9, wherein one Gag conserved element polypeptide comprises the amino acid sequence of SEQ ID NO:40 and the second Gag conserved element polypeptide comprises the amino acid sequence of SEQ ID NO:41.
11. The method of claim 9 or 10, wherein the conserved element polypeptides encoded by the first and second nucleic acid Gag conserved element nucleic acid constructs are each fused to a GM-CSF signal peptide.
12. The method of any one of claims 1 to 6, wherein the protein of interest is an HIV-1 Env sequence.
13. The method of claim 12, wherein one conserved element polypeptide comprises at least 12 conserved elements from different conserved regions of Env of HIV-1 Group M and each of the conserved elements has a conserved element sequence shown in Table 1.
14. The method of claim 13, wherein one conserved element polypeptide comprises conserved elements that each have a sequence set forth in SEQ ID NOS:1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, and 22; and a second conserved element polypeptide comprises conserved elements that each have a sequence set forth in SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, and 23.
15. The method of claim 14. wherein one Env conserved element polypeptide comprises the amino acid sequence of SEQ ID NO 24 and the second Gag conserved element polypeptide comprises the amino acid sequence of SEQ ID NO:25.
16. The method of claim 14 or 15, wherein the conserved element polypeptides encoded by the first and second nucleic acid Env conserved element nucleic acid constructs are each fused to a GM-CSF signal peptide.
17. The method of any one of claims 4 to 16, wherein the first and second nucleic acid conserved element nucleic acid constructs are contained in the same vector.
18. The method of claims 4 to 16, wherein the first and second nucleic acid constructs are contained in different vectors.
19. The method of any one of claims 1 to 18, wherein boosting is performed at least about two weeks after the priming step.
20. The method of any one of claim 1 to 19, wherein the priming step comprises two or three administrations of the one or more conserved element polypeptides, each separated by at least about 2 weeks; and the boosting step comprises two co-administrations, each separated by at least about 2 weeks.
21. A method of inducing an immune response to HIV Gag in a subject, the method comprising: priming an immune response to HIV Gag, wherein priming comprises administering to the subject a CE-encoding expression vector that comprises a nucleic acid sequence encoding p24.sup.GagCE1 as set forth in Table 2 fused at the N-terminus to a human GM-CSF signal peptide and a nucleic acid sequence encoding p24.sup.GagCE2 as set forth in Table 2 fused at the N-terminus to a human GM-CSF signal peptide; wherein the subject is not co-administered or has not previously been administered a recombinant nucleic acid construct encoding a full-length or substantiallyl full-length HIV Gag polypeptide; boosting an immune response to HIV Gag, wherein boosting comprises co-delivering the CE-encoding expression vector with an expression vector that encodes full-length HIV-1 p55.sup.gag or substantially full-length HIV-1 p55.sup.gag.
22. The method of claim 21, wherein the boosting step is performed about two months after the priming step.
23. The method of claim 21 or 22, wherein the method comprises two or three priming steps, each separated by about two months; and two boost steps, each separated by about two months.
24. A nucleic acid encoding an immunogenic HIV Env conserved element polypeptide, wherein the HIV Env conserved element polypeptide comprises at least five conserved elements selected from SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:4; SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO16, SEQ ID NO:18, SEQ ID NO:20, and SEQ ID NO:22; and the conserved elements are separated by linkers of 1 to 5 amino acids in length.
25. The nucleic acid of claim 24, wherein the HIV Env conserved element polypeptide comprises at least six, seven, eight, nine, ten, or eleven conserved elements selected from SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, and SEQ ID NO:22
26. The nucleic acid of claim 24, wherein the HIV Env conserved element polypeptide comprises the conserved elements of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ NO:8, SEQ ID NO:10, SEQ NO:12, SEQ NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, and SEQ ID NO:22.
27. The nucleic acid of claim 24, 25, or 26, wherein the HIV Env conserved element polypeptide further comprises a V1V2 variable region sequence.
28. The nucleic acid of claim 24, wherein the HIV Env conserved element polypeptide comprises SEQ ID NO:24.
29. A nucleic acid encoding an immunogenic HIV Env conserved element polypeptide, wherein the HIV Env conserved element polypeptide comprises at least five conserved elements selected from SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, and SEQ ID NO:23; and the conserved elements are separated by linkers of 1 to 5 amino acids in length.
30. The nucleic acid of claim 29, wherein the HIV Env conserved element polypeptide comprises at least six, seven, eight, nine, ten, or eleven conserved elements selected from SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, and SEQ ID NO:23.
31. The nucleic acid of claim 29, wherein the HIV Env conserved element polypeptide comprises the conserved elements of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, and SEQ ID NO:23.
32. The nucleic acid of claim 29, 30, or 31, further comprising a V1V2 variable region sequence.
33. The nucleic acid of claim 29, wherein the HIV Env conserved element polypeptide comprises SEQ ID NO:25.
34. The nucleic acid of any one of claims 24 to 33, wherein the HIV Env conserved element polypeptide comprises a signal peptide.
35. The nucleic acid of claim 34, wherein the signal peptide is the signal peptide of GM-CSF.
36. An immunogenic HIV Env conserved element polypeptide comprising at least five conserved elements selected from SEQ ID NO: 1, SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ NO:20, and SEQ ID NO:22, wherein the conserved elements are separated by linkers of 1 to 5 amino acids in length
37. The immunogenic HIV Env conserved element polypeptide of claim 36, wherein the polypeptide comprises at least six, seven, eight, nine, ten, or eleven conserved elements selected from SEQ NO:1, SEQ NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ NO:8, SEQ NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, and SEQ ID NO:22
38. The immunogenic HIV Env conserved element polypeptide of claim 36, wherein the polypeptide comprises the conserved elements of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO: 10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, and SEQ ID NO:22.
39. The immunogenic HIV Env conserved element polypeptide of claim 36, 37, or 38, wherein the polypeptide further comprises a V1V2 variable region sequence.
40. The immunogenic HIV Env conserved element polypeptide of claim 36, wherein the polypeptide comprises SEQ ID NO:24.
41. An immunogenic HIV Env conserved element polypeptide comprising at least five conserved elements selected from SEQ ID NO: 1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, and SEQ ID NO:23; wherein the conserved elements are separated by linkers of 1 to 5 amino acids in length.
42. The immunogenic HIV Env conserved element polypeptide of claim 41, wherein the polypeptide comprises at least six, seven, eight, nine, ten, or eleven conserved elements selected from SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, and SEQ ID NO:23.
43. The immunogenic HIV Env conserved element polypeptide of claim 41, wherein the polypeptide comprises the conserved elements of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, and SEQ ID NO:23.
44. The immunogenic HIV Env conserved element polypeptide of claim 41, 42, or 43, wherein the polypeptide further comprises a V1V2 variable region sequence.
45. The immunogenic HIV Env conserved element polypeptide of claim 41, wherein the polypeptide comprises SEQ ID NO:25.
46. A composition comprising: a first nucleic acid construct encoding a first immunogenic HIV Env conserved element polypeptide that comprises at least five conserved elements selected from SEQ ID NO:1, SEQ NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, and SEQ ID NO:22, wherein the conserved elements are separated by linkers of 1 to 5 amino acids in length; and a second nucleic acid construct encoding a second immunogenic HIV Env conserved element polypeptide comprises at least five conserved elements selected from SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, and SEQ ID NO:23, wherein the conserved elements are separated by linkers of 1 to 5 amino acids in length.
47. The composition of claim 46, wherein the first immunogenic HIV Env conserved element polypeptide comprises at least six, seven, eight, nine, ten, or eleven conserved elements selected from SEQ ID NO:1. SEQ NO:2, SEQ ID NO:4, SEQ NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, and SEQ ID NO:22; and the second immunogenic HIV Env conserved element polypeptide comprises at least six, seven, eight, nine, ten, or eleven conserved elements selected from SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ 1D NO:15, SEQ SEQ ID NO:19, SEQ ID NO:21, and SEQ ID NO:23.
48. The composition of claim 46, wherein the first immunogenic HIV Env conserved element polypeptide comprises the conserved elements of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, and SEQ ID NO:22.
49. The composition of claim 46, wherein the second immunogenic HIV Env conserved element polypeptide comprises the conserved elements of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, and SEQ ID NO:23.
50. The composition of claim 46, wherein the first immunogenic HIV Env conserved element polypeptide comprises the conserved elements of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, and SEQ ID NO:22; and the second immunogenic HIV Env conserved element polypeptide comprises the conserved elements of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, and SEQ NO:23.
51. The compositions of any one of claims 46 to 50, wherein the first immunogenic HIV Env conserved element polypeptide or the second immunogenic HIV Env conserved element polypeptide; or both the first immunogenic HIV Env conserved element polypeptide and the second immunogenic HIV Env conserved element polypeptide further comprise a V1V2 variable region sequence.
52. The composition of claim 46, wherein the first immunogenic HIV Env conserved element comprises the amino acid sequence of SEQ ID NO:24 and the second immunogenic HIV Env conserved element polypeptide comprises the amino acid sequence of SEQ ID NO:25.
53. The composition of any one of claims 46 to 52, wherein the first nucleic acid and second nucleic acid are contained in separate expression vectors,
54. The composition of any one of claims 46 to 52, wherein the first nucleic acid and second nucleic acid are contained in the same expression vector.
55. A composition comprising: a first immunogenic HIV Env conserved element polypeptide comprising at least five conserved elements selected from SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ NO:18, SEQ ID NO:20, and SEQ ID NO:22, wherein the conserved elements are separated by linkers of 1 to 5 amino acids in length; and a second immunogenic HIV Env conserved element polypeptide comprises at least five conserved elements selected from SEQ NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, and SEQ ID NO:23, wherein the conserved elements are separated by linkers of 1 to 5 amino acids in length.
56. The composition of claim 55, wherein the first immunogenic HIV Env conserved element polypeptide comprises at least six, seven, eight, nine, ten, or eleven conserved elements selected from SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, and SEQ ID NO:22; and the second immunogenic HIV Env conserved element polypeptide comprises at least six, seven, eight, nine, ten, or eleven conserved elements selected from SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, and SEQ ID NO:23.
57. The composition of claim 55, wherein the first immunogenic HIV Env conserved element polypeptide comprises the conserved elements of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, and SEQ ID NO:22.
58. The composition of claim 55, wherein the second immunogenic HIV Env conserved element polypeptide comprises the conserved elements of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, and SEQ ID NO:23.
59. The composition of claim 55, wherein the first immunogenic HIV Env conserved element polypeptide comprises the conserved elements of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, and SEQ ID NO:22; and the second immunogenic HIV Env conserved element polypeptide comprises the conserved elements of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ NO:17, SEQ ID NO:19, SEQ ID NO:21, and SEQ ID NO:23.
60. The composition of any one of claims 55 to 59, wherein the first immunogenic HIV Env conserved element polypeptide or the second immunogenic HIV Env conserved element polypeptide; or both the first immunogenic HIV Env conserved element polypeptide and the second immunogenic HIV Env conserved element polypeptide further comprise a V1V2 variable region sequence.
61. The composition of claim 55, wherein the first immunogenic HIV Env conserved element comprises the amino acid sequence of SEQ ID NO:24 and the second immunogenic HIV Env conserved element polypeptide comprises the amino acid sequence of SEQ NO:25.
62. A method of inducing an immune response to HIV Env, the method comprising administering a nucleic acid construct of any one of claims 24 to 35 to a subject or an HIV Env conserved element polypeptide of any one of claims 36 to 45 to the subject.
63. A method of inducing an immune response to HIV Env, the method comprising administering: a first nucleic acid encoding a first immunogenic HIV Env conserved element polypeptide that comprises at least five conserved elements selected from SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, and SEQ ID NO:22, wherein the conserved elements are separated by linkers of 1 to 5 amino acids in length; and a second nucleic acid encoding a second immunogenic HIV Env conserved element polypeptide comprises at least five conserved elements selected from SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, and SEQ ID NO:23, wherein the conserved elements are separated by linkers of 1 to 5 amino acids in length.
64. The method of claim 63, wherein: the first immunogenic HIV Env conserved element polypeptide comprises at least six, seven, eight, nine, ten, or eleven conserved elements selected from SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, and SEQ ID NO:22; and the second immunogenic HIV Env conserved element polypeptide comprises at least six, seven, eight, nine, ten, or eleven conserved elements selected from SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, and SEQ ID NO:23.
65. The method of claim 63, wherein: the first immunogenic HIV Env conserved element polypeptide comprises the conserved elements of SEQ NO:1, SEQ NO:2, SEQ ID NO:4, SEQ NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, and SEQ NO:22; and the second immunogenic HIV Env conserved element polypeptide comprises the conserved elements of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, and SEQ ID NO:23.
66. The method of any one of claims 63 to 65, wherein the first immunogenic HIV Env conserved element polypeptide or the second immunogenic HIV Env conserved element polypeptide; or both the first immunogenic HIV Env conserved element polypeptide and the second immunogenic HIV Env conserved element polypeptide further comprise a V1V2 variable region sequence.
67. The method of claim 63, wherein the first immunogenic HIV Env conserved element comprises the amino acid sequence of SEQ ID NO:24 and the second immunogenic HIV Env conserved element polypeptide comprises the amino acid sequence of SEQ ID NO:25.
68. The method of any one of claims 63 to 67, wherein the first nucleic acid and second nucleic acid are contained in separate expression vectors.
69. The method of any one of claims 63 to 67, wherein the first nucleic acid and second nucleic acid are contained in the same expression vector.
70. The method of any one of claims 63 to 67, wherein the first and the second nucleic acids are administered sequentially.
71. The method of any one of claims 63 to 67, wherein the first and second nucleic acids are administered concurrently.
72. The method of any one of claims 63 to 71, wherein a nucleic acid encoding a full-length Env polypeptide, or substantially full-length Env polypeptide, is administered as a boost after the first and the second nucleic acid encoding the first and the second HIV conserved element polypeptides.
73. The method of any one of claims 63 to 72, wherein the nucleic acid constructs are administered intramuscularly by in vivo electroporation.
74. A method of inducing an immune response to HIV Env, the method comprising administering: a first immunogenic HIV Env conserved element polypeptide that comprises at least five conserved elements selected from SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, and SEQ NO:22, wherein the conserved elements are separated by linkers of 1 to 5 amino acids in length; and a second immunogenic HIV Env conserved element polypeptide comprises at least five conserved elements selected from SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, and SEQ ID NO:23, wherein the conserved elements are separated by linkers of 1 to 5 amino acids in length.
75. The method of claim 74, wherein the first immunogenic Env conserved element polypeptide comprises at least six, seven, eight, nine, ten, or eleven conserved elements selected from SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:4, SEQ NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, and SEQ ID NO:22; and the second immunogenic HIV Env conserved element polypeptide comprises at least six, seven, eight, nine, ten, or eleven conserved elements selected from SEQ NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO.21, and SEQ ID NO:23.
76. The method of claim 74, wherein the first immunogenic HIV Env conserved element polypeptide comprises the conserved elements of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, and SEQ ID NO:22; and the second immunogenic HIV Env conserved element polypeptide comprises the conserved elements of SEQ ID NO:1, SEQ ID NO:3, SEQ NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ NO:21, and SEQ ID NO:23.
77. The method of any one of claims 74 to 76, wherein the first immunogenic HIV Env conserved element polypeptide or the second immunogenic HIV Env conserved element polypeptide; or both the first immunogenic My Env conserved element polypeptide and the second immunogenic HIV Env conserved element polypeptide further comprise a V1V2 variable region sequence.
78. The method of claim 74, wherein the first immunogenic HIV Env conserved element comprises the amino acid sequence of SEQ ID NO:24 and the second immunogenic HIV Env conserved element polypeptide comprises the amino acid sequence of SEQ ID NO:25.
79. The method of any one of claims 74 to 78, wherein the first and the second immunogenic HIV Env conserved element polypeptides are administered sequentially.
80. The method of any one of claims 74 to 78, wherein the first and the second immunogenic HIV Env conserved element polypeptides are administered concurrently.
81. The method of any one of claims 74 to 80, wherein a full-length Env polypeptide, or substantially fill-length Env polypeptide, is administered after the first and the second second HIV conserved element polypeptides.
82. An HIV Gag CE polypeptide comprising: (a) SEQ ID NO:27, SEQ ID NO:29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, and/or SEQ NO:37; or (b) SEQ ID NO:28, SEQ NO:30, SEQ ID NO:32, SEQ ID NO:34, SEQ NO:36, and/or SEQ ID NO:38.
83. An HIV Gag CE polypeptide comprising: P24CE8-1, p24CE9-1, p24CE3-1, p24CE10-1, p24CE5-1, p24CE11-1, p24CE6-1, p24CE12-1, p24CE13-1 as shown in
84. The method of any one of claims 62 to 81, further comprising administering an immunogenic composition to induce an immune response to HIV Gag, wherein the immunogenic composition is an HIV Gag CE polypeptide comprising p24 CE1, CE2, CE3, CE4, CE5, CE6, and CE7 as shown in
85. The method of any one of claims 62 to 81, further comprising administering an immunogenic composition to induce an immune response to HIV Gag, wherein the method comprises administering an HIV Gag CE polypeptide comprising P24CE8-1, p24CE9-1, p24CE3-1, p24CE10-1, p24CE5-1, p24CE11-1, p24CE6-1, p24CE12-1, p24CE13-1 as shown in
86. A nucleic acid construct encoding an HIV Gag CE polypeptide of claim 82 or 83.
87. The method of claim 84 or 85, wherein the HIV Gag CE polypeptide is administered as a nucleic acid that encodes the HIV Gag CE polypeptide.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0117]
[0118]
[0119]
[0120]
[0121]
[0122]
[0123]
[0124]
[0125]
[0126]
[0127]
[0128]
[0129]
[0130]
[0131]
[0132]
[0133]
[0134]
[0135]
[0136]
[0137]
[0138]
[0139]
[0140]
[0141]
DETAILED DESCRIPTION OF THE INVENTION
Terminology
[0142] A conserved region as used herein refers to a protein sequence that is conserved across a protein that has high sequence diversity in nature, e.g, a viral protein such as HIV Env or HIV Gag. A conserved region need not have 100% sequence identity across the diversity of naturally occurring sequence of the protein, but the amino acid sequence variability in the naturally occurring conserved region sequences is low, typically 10% or less. A conserved element in the context of the present invention is a segment of a conserved region that is at least 8 amino acids, or greater, in length. In some embodiments, a conserved element is greater than 8 amino acids in length, e.g.. 9. 10, 11, 12, 13, 14, 15, 16, 17, 18. 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, or 45 or more amino acids in length. Typically, a conserved element is less than 50 amino acids in length, A conserved element need not be 100% conserved across the diversity of HIV sequences, e.g., HIV Gag sequences or HIV Env sequences. The sequence variability in the naturally occurring conserved element sequence is low, however, typically 10% or less.
[0143] In the context of this invention, a conserved element pair as it relates to a conserved element immunogenic composition, conserved elements of HIV Gag or HIV Env, refers to two versions of a conserved element sequence that have amino acid changes relative to one another such that the two sequence together cover at least 90% of naturally occurring sequences. For example, an HIV Env conserved element pair refers to two versions of a conserved element sequence that have amino acid changes relative to one another such that the two sequence together cover at least 90% of naturally occurring HIV Env variants belonging to the HIV-1 M group.
[0144] A variable region element in the context of HIV Env is a sequence from a variable region of HIV Env, e.g., the V1V2 region, that may also be included in an immunogenic HIV Env CE polypeptide of the invention if recognition of this region is associated with lower viral loads in published studies or if amino acid substitutions in that region are known to decrease viral replication fitness, or if recognition of the region has been associated with vaccine efficacy, or if amino acid substitutions in that region are associated with changes in predicted protein stability.
[0145] A nucleic acid vaccine as used herein includes both naked DNA vaccines, e.g., plasmid vaccine, and viral vector-based nucleic acid vaccines that are comprised by a viral vector and/or delivered as viral particles.
[0146] The term nucleic acid refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form. The term encompasses nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are synthetic, naturally occurring, and non-naturally occurring, which have similar binding properties as the reference nucleic acid, and which are metabolized in a manner similar to the reference nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated. Degenerate codon substitutions can be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); Rossolini et al., Mol. Cell, Probes 8:91-98 (1994)). The term nucleic acid is used interchangeably with gene, cDNA, oligonucleotide, and polynucleotide. A nucleic acid encompasses RNA as well as DNA.
[0147] The terms identical or percent identity, in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (e.g., about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher, identity over a specified region (e.g., a polypeptide sequence comprising collinear conserved elements), when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters (see, e.g., NCBI web site or the like), or by manual alignment and visual inspection. In the present invention, in the context of comparison of a particular conserved element sequence with a variant of that sequence, identity is defined over the length of the conserved element reference sequence. In some embodiments, percent identity of one conserved element to a corresponding variant conserved element is determined by visual inspection.
[0148] The term operably linked refers to a functional linkage between a first nucleic acid sequence and a second nucleic acid sequence, such that the first and second nucleic acid sequences are transcribed into a single nucleic acid sequence. Operably linked nucleic acid sequences need not be physically adjacent to each other. The tem operably linked also refers to a functional linkage between a nucleic acid expression control sequence (such as a promoter, or array of transcription factor binding sites) and a transcribable nucleic acid sequence, wherein the expression control sequence directs transcription of the nucleic acid corresponding to the transcribable sequence.
[0149] Amino acids can be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, can be referred to by their commonly accepted single-letter codes.
[0150] The terms mammal or mammalian refer to any animal within the taxonomic classification mammalia. A mammal can refer to a human or a non-human primate. A mammal can also refer to a domestic animal, including for example, canine, feline, rodentia, including lagomorpha, murine, rattus, Cricetinae (hamsters), etc. A mammal can refer to an agricultural animal, including for example, bovine, ovine, porcine, equine, etc.
[0151] The terms treating and treatment refer to delaying the onset of, retarding or reversing the progress of, or alleviating or preventing either the disease or condition to which the term applies, or one or more symptoms of such disease or condition.
[0152] An immunogen refers to a molecule, typically a protein molecule in the current invention, containing one or more epitopes (either linear, conformational or both) that will stimulate a host's immune system to make a humoral and/or cellular antigen-specific response. Normally, an epitope will comprise between about 7 and 15 amino acids, such as, 9, 10, 12 or 15 amino acids, The term immunogen includes isolated immunogens as well as inactivated organisms, such as viruses.
[0153] In the present description, any concentration range, percentage range, ratio range, or integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one tenth and one hundredth of an integer), unless otherwise indicated, As used herein, about means +10% of the indicated range, value, sequence, or structure, unless otherwise indicated. It should be understood that the terms a and an as used herein refer to one or more of the enumerated components unless otherwise indicated or dictated by its context. The use of the alternative (e.g., or) should be understood to mean either one, both, or any combination thereof of the alternatives unless otherwise indicated.
Aspects of the Disclosure
[0154] The invention is based, in part, on the discovery that administration of one or more polypeptides comprising conserved elements, separated by non-naturally occurring linkers and collinearly arranged, from an immunogen of interest, e.g., a viral antigen such as HIV Gag or HIV Env, can provide an enhanced immune response when one or more conserved element nucleic acid constructs is administered to a subject as a prime followed by co-administration to the subject of a nucleic acid construct encoding a full-length antigen, or substantially a full-length antigen, with the conserved element construct(s) as a boost. In typical embodiments, the prime and/or boost components of an immunization protocol in accordance with the invention are administered as nucleic acids that encode the polypeptides. In some embodiments, prime and/or boost immunization components are administered as polypeptides.
[0155] The immunogen can be any protein for which it is desired to induce an immune response, but is often a viral protein that exhibits sequence diversity in naturally occurring variants. In some embodiments, the viral protein is a retrovirus protein, such as a lentiviral protein. In some embodiments, the viral protein is a retroviral Gag or Env protein, such as an HIV Gag or HIV Env protein.
[0156] The invention is additionally based, in part, on the discovery that administration of one or more polypeptides comprising conserved elements, separated by linkers and collinearly arranged, of HIV Env conserved element proteins as described herein can provide a robust immune response compared to administration of a full-length Env protein to a subject. In some aspects, the disclosure thus provides HIV Env conserved element polypeptides, nucleic acids encoding HIV Env conserved element polypeptides, and methods of using such polypeptide and nucleic acids to induce an immune response.
HIV Env Conserved Element Immunogenic Compositions.
[0157] In one aspect, the disclosure provides HIV Env conserved element compositions. In some embodiments, an HIV Env conserved element composition is administered in the form of a nucleic acid construct that encodes an HIV Env conserved element immunogenic polypeptide. Alternatively, the HIV Env conserved element immunogenic composition may may be administered in polypeptide from. Accordingly, the invention provide immunogenic HIV Env conserved element polypeptides and nucleic acid constructs that encode these polypeptides.
[0158] A nucleic acid construct encoding an HIV Env conserved element polypeptide in accordance with the invention typically encodes a polypeptide that comprises at least six of the conserved elements set forth in SEQ ID NOS:1-23 and 70-85. In some embodiments, the nucleic acid construct encodes a polypeptide that comprises at least 8, typically, at least 9, 10, 11, 12, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, or more consecutive amino acids from the conserved elements of SEQ ID NOS:1-23 and 70-85.
[0159] In some embodiments, a nucleic acid construct encoding an HIV Env conserved element polypeptide encodes a polypeptide that comprises at least one, two, three, four, five, six, seven, eight, nine, ten, or eleven, or all twelve of the conserved elements set forth in SEQ ID NOs. 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, or 22. In some embodiments, a nucleic acid construct encoding an HIV Env conserved element polypeptide encodes a polypeptide that comprises at least one, two, three, four, five, six, seven, eight, nine, ten, or eleven, or all twelve of the conserved elements set forth in SEQ ID NOs. 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, or 23. In some embodiments, a conserved element sequence has at least 8, typically, at least 9, 10, or 11 consecutive amino acids from CE6 (SEQ ID NO:1). In some embodiments, a conserved element sequence has at least 10, typically at least 11, 12, 13, or 14 consecutive amino acids from CE1(SEQ ID NO:2 or SEQ ID NO:3). In some embodiments, a conserved element sequence has at least 15, typically at least 16, 17, 18, 19, 20, or 21 consecutive amino acids from CE7 (SEQ NO:4 or SEQ ID NO:5). In some embodiments, a conserved element sequence has at least 10, typically at least 11, 12, 13, 14, or 15 consecutive amino acids from CE8 (SEQ ID NO:6 or SEQ ID NO:7). In some embodiments, a conserved element sequence has at least 15, typically at least 16, 17, 18, 19, 20, 21, 22, or 23 consecutive amino acids from CE9 (SEQ ID NO:8 or SEQ ID NO:9). In some embodiments, a conserved element sequence has at least 15, typically at least 16, 17, 18, 19, 20, or 21 consecutive amino acids from CE10 (SEQ ID NO:10 or SEQ ID NO:11). In some embodiments, a conserved element sequence has at least 8, typically, at least 9, 10, 11, 12, or 13 consecutive amino acids from CE11 (SEQ ID NO:12 or SEQ ID NO:13). In some embodiments, a conserved element sequence has at least 8, typically, at least 9, 10, 11, or 12 consecutive amino acids from CE12 (SEQ ID NO:14 or SEQ NO:15). In some embodiments, a conserved element sequence has at least 9, typically, at least 10, 11, 12, 13, or 14 consecutive amino acids from CE 13 (SEQ NO:16 or SEQ ID NO:17). In some embodiments, a conserved element sequence has at least 20, and typically at least 21, 22, 23, 24, 25, 26, 26, 27, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, or 43 consecutive amino acids from CE4 (SEQ ID NO:18 or SEQ ID NO:19). In some embodiments, a conserved element sequence has at least 15, typically at least 16, 17, 18, 19, or 20 consecutive amino acids from CE15 (SEQ ID NO:20 or SEQ ID NO:21), In some embodiments, a conserved element sequence has at least 8, typically, at least 9, 10, 11, 12, or 13 consecutive amino acids from CE16 (SEQ ID NO:22 or SEQ ID NO:23).
[0160] In some embodiments, an HIV Env CE polypeptide may comprise a CE set forth in any one of SEQ ID NOS:70-85. In some embodiments, a conserved element sequence has at least 10, typically, at least 11, 12, 13, 14, 15, or 16 consecutive amino acids of EnvCE17 (SEQ ID NO:70 or SEQ ID NO:71). In some embodiments, a conserved element sequence has at least 20, 21, 22, 23, 24, 25, or 26 consecutive amino acids of CE18 (SEQ ID NO:72 or SEQ ID NO:73). In some embodiments, a conserved element sequence has at least 15, typically at least 16, 17, 18, or 19 consecutive amino acids from CE19 (SEQ ID NO:74 or SEQ ID NO:75). In some embodiments, a conserved element sequence has at least 8, 9, or 10 consecutive amino acids of CE20 (SEQ ID NO:76 or SEQ ID NO:77). In some embodiments, a conserved element sequence has at least 14, typically at least 15, 16, or 17 consecutive amino acids of CE21 (SEQ ID NO:78 or SEQ ID NO:79). In some embodiments, a conserved element sequence has at least 25, typically at least 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, or 45 consecutive amino acids of CE22 (SEQ NO:80 or SEQ ID NO:81. In some embodiments, a conserved element sequence has at least 12, typically at least 13, 14, or 15 consecutive amino acids of CE23 (SEQ ID NO:82 or SEQ ID NO:83). In some embodiments, a conserved element sequence has at least 15, typically at least 16, 17, 19, or 19 consecutive amino acids of CE24 (SEQ ID NO:84 or SEQ ID NO:85).
[0161] In some embodiments, an HIV Env CE polypeptide comprises the twelve HIV Env conserved element sequences CE6, CE1, CE7, CE8, CE9, CE 10, CE11, CE12, CD13, CE14, CE15 and CE16, in this order or in any other order. In some embodiments, an HIV Env CE polypeptide may further comprise HIV Env conserved element sequence CE20 and/or CE23. In some embodiments, an HIV Env CE polypeptide conserved element polypeptide comprises CE17, CE18, CE19, CE21, CE22, and/or CE24 in replace of CE8, CE9, CE10, CE11, CE14, and/or CE15, respectively.
[0162] In some embodiments, an HIV Env CE polypeptide of the invention comprises Env conserved elements CE6, CE1, CE7, CE17, CE18, CE19, CE20, CE21, CE12, CE13, CE22, CE23, CE24, and CE16.
[0163] In some embodiments, an HIV Ens' CE polypeptide in accordance with the invention has at least 90%, or at least 91%, 92%, 93%, 94%. 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO:24 or SEQ ID NO:25. In some embodiments, the HIV Env CE polypeptide has at least 90%, or at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the Env-CE1-V1V2 Bal polypeptide sequence shown in
[0164] In the present disclosure, the HIV Env conserved elements contained within conserved element polypeptides of the invention are not contiguous in the native Env proteir sequence. Further, the conserved elements present in an HIV Env conserved element polypeptide are separated by polypeptide sequences that don't naturally occur in native protein sequences. The individual conserved elements are typically joined to one another in the nucleic acid construct by a peptide linker, such as an alanine-containing linker.peptide linker sequences contain Ala and may also include other amino acids such as Gly, Val, Glu, Asp, Lys, or Phe. The linker sequence may range in length, e.g., from 1 to 5 amino acids, or even longer, in length, but is typically no longer than 6, 7, or 8 amino acids in length. In some embodiments, the linker sequence is 3 amino acids in length. In some embodiments, the linker sequence is AAV, AAE, GAK, AAD, AAK, GAV, VAV, or AAF.
[0165] The conserved elements may be present in any order in the construct, they need not occur in the order of the naturally occurring sequence. For example, a conserved element that occurs toward the N-terminus of a protein may be encoded at the C-terminal end of the construct.
[0166] In some embodiments, a nucleic acid encoding an HIV Env conserved element polypeptide in accordance with the invention encodes a polypeptide that comprises at least five or more, or at least six, seven, eight, nine, ten, or eleven, of the conserved elements set forth in SEQ ID NOS:1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, or 22. In sonic embodiments, a nucleic acid encoding an HIV Env conserved element polypeptide in accordance with the invention encodes a polypeptide that comprises the twelve conserved elements set forth in SEQ IL) NOS:1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, and 22. In some embodiments, such a nucleic acid construct encodes a polypeptide comprising the amino acid sequence of SEQ ID NO:24. In sonic embodiments, a nucleic acid encoding an HIV Env conserved element polypeptide in accordance with the invention encodes a polypeptide comprising at least five or more, or at least six, seven, eight, nine, ten, or eleven, of the conserved elements set forth in SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, or 23. In some embodiments, a nucleic acid encoding an HIV Env conserved element polypeptide in accordance with the invention encodes a polypeptide that comprises the twelve conserved elements set forth in SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, and 23. In some embodiments, such a nucleic acid construct encodes a polypeptide that comprises the amino acid sequence of SEQ ID NO:25. In some embodiments, a nucleic acid construct encoding a polypeptide comprising SEQ ID NO:24 is administered in conjunction with a nucleic acid construct encoding a polypeptide comprising SEQ ID NO:25.
[0167] In some embodiments, an HIV Env CE polypeptide comprising Env conserved elements SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:70, SEQ ID NO:72, SEQ ID NO:74, SEQ ID NO:76, SEQ ID NO:78, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:80, SEQ ID NO:82, SEQ ID NO:84, and SEQ ID NO:22 is administered in conjunction with an HIV Env CE polypeptide comprising SEQ NO:1, SEQ NO:3, SEQ NO:5, SEQ ID NO:71, SEQ ID NO:73, SEQ ID NO:75, SEQ ID NO:77, SEQ ID NO:79, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:81, SEQ ID NO:83, SEQ ID NO:85, and SEQ ID NO:23.
[0168] In some embodiments, a nucleic acid encoding an HIV Env conserved element polypeptide in accordance with the invention encodes a polypeptide that differs from SEQ ID NO:24 by no more than 1, 2, 3, 4, 5, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids. in some embodiments, a nucleic acid encoding an HIV Env conserved element polypeptide in accordance with the invention encodes a polypeptide that differs from SEQ ID NO:25 by no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids.
[0169] In some embodiments, an HIV Env conserved element polypeptide further comprises one or more sequences from an HIV Env variable region, e.g., the V1V2 region. The variable region sequences are well known in the art and are hounded by cysteine residues.
[0170] In the present disclosure, an HIV Env conserved element nucleic acid construct as described herein is typically employed in a vaccination regimen that also employs a nucleic acid encoding full-length Env protein, or substantially full-length Env protein, from which the conserved elements are obtained. In the context of the present invention, substantially full-length refers to the region of the Env protein that includes all of the conserved elements, i.e., a sufficient length of a naturally occurring Env protein is provided that includes all of the conserved elements that are used in the conserved element construct.
Administrative Regimens
[0171] In a further aspect, the disclosure provides an enhanced administration regimen for conserved element immunogenic compositions that provides a robust immune response. Thus, the invention additionally provides a method of inducing an immune response, where the method comprises administering one or more nucleic acid constructs encoding a conserved element polypeptide, followed by administering a nucleic acid construct encoding a full-length or substantially full-length polypeptide, where the nucleic acid construct encoding a full-length or substantially full-length polypeptide is administered in conjunction with the nucleic acid construct encoding the conserved element polypeptide.
[0172] In some embodiments, the immunogenic compositions employed in the enhanced administration regimens as described in this section relate to a viral protein, e.g., a retrovirus protein such as Gag. Illustrative conserved elements of Gag are described herein. See, also e.g., U.S. Patent Application Publication No. 20110269937; Rolland et al., PLoS Pathog 3: e157, 2007; Mothe et al., PLoS One 7: e29717, 2012; and US20150056237.
[0173] Each conserved element included in a CE polypeptide in accordance with the enhanced methods of generating an immune response of the disclosure is generally 50 amino acids or fewer in length, but is at least 8 amino acids in length. In some embodiments, the conserved element is at least 8 amino acids in length and 45, 40, 35, 30, 25, 20, or 15 amino acids, or fewer, in length. In some embodiments, the conserved element is 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, or 45 amino acids in length.
[0174] In preferred embodiments, more than one nucleic acid construct encoding the conserved elements of interest are used where one construct encodes a first set of conserved elements, e.g., from HIV Gag or HIV Env, and the second construct encodes a second set of conserved elements where one or more elements, often most or all of the conserved elements, of the second set of conserved elements differ from the first set by 5 or fewer amino acids. That is, one conserved element present in the two sets contains a limited number of substitutions (e.g., 1, 2, 3, 4, or 5) relative to the corresponding conserved element. The residues where the sequences differ, however, are at sites of naturally occurring variation in the naturally occurring protein sequences, so that each of the conserved elements in the first arid second sets corresponds to a naturally occurring protein sequence. In some embodiments, each element of the second set is at least 80% or at least 90% identical to the corresponding element in the first set of conserved sequences. The nucleic acid construct encoding the first set of conserved elements and the nucleic acid construct encoding the second set of conserved elements may be present in the same vector or different vectors.
[0175] As explained above regarding HIV Env conserved element constructs, in the enhanced methods of generating an immune response as described herein, the conserved elements contained within conserved element polypeptides are not contiguous in the naturally occurring protein sequence. Further, the conserved elements present in a conserved element polypeptide generated in accordance with the invention are separated by polypeptide sequences that do not naturally occur in the protein sequence. The individual conserved elements are typically joined to one another in the nucleic acid construct by a peptide linker, such as an alanine-containing linker. Linker sequences are well known in the art. Typical peptide linker sequences contain Ala and may also include other amino acids such as Gly, Val, Glu, Asp, Lys, or Phe. The linker sequence may range in length, e.g., from 1 to 5 amino acids, or even longer, in length, but is typically no longer than 6, 7, or 8 amino acids in length. In some embodiments, the linker sequence is 3, 4, or 5 amino acids in length. In sonic embodiments, the linker sequence is AAV, AAE, GAK, AAD, AAK, GAV, VAV, or AAF. In some embodiments, the linker is AA, AAAE, AAAA, AAK, AG, AA, LAK, AAK, AAAAL, and the like.
[0176] The conserved elements may be present in any order in the construct, they need not occur in the order of the naturally occurring sequence. For example, a conserved element that occurs toward the N-terminus of a protein may be encoded at the C-terminal end of the construct.
[0177] In some embodiments, the protein of interest is HIV Gag. A nucleic acid construct encoding a conserved element polypeptide for use in the invention encodes a polypeptide that comprises at least one, two, three, four, five, six, or seven conserved elements set forth in Table 2. In some embodiments, the nucleic acid construct encodes a polypeptide that comprises at least 8, typically, at least 9, 10, 11, 12, 14, 15, 16, 17, 18, 19, 20, or more consecutive amino acids from a conserved element set forth in Table 2. See also, e.g. US20150056237, incorporated by reference, which teaches HIV Gag conserved elements. In some embodiments, a Gag CE polypeptide used in accordance with the methods of the invention comprises a p24Gag CE polypeptide having the sequence of the p24GagCE1 polypeptide of Table 2:
TABLE-US-00001 (SEQIDNO:40) VIPMFSALSEGATPQDLNAAVGGHQAAMQMLKDTINEEAAEWDRAAAEP RGSDIAGTTSTLQEQIGWAAAKRWIILGLNKIVRMYSPTSIAAKYVDRF YKTLRAEQAAGLEEMMTACQGVGGPGHKAAISPRTLNAWVKV.
[0178] In some embodiments, a Gag CE polypeptide used in accordance with the methods of the invention comprises a p24Gag CE polypeptide having the sequence of the p24GagCE2 polypeptide of Table 2:
TABLE-US-00002 (SEQIDNO:41) VIPMFTALSEGATPQDLNAAVGGHQAAMQMLKETINEEAAEWDRAAAEP RGSDIAGTTSTLQEQIAWAAAKRWIILGLNKIVRMYSPVSIAAKYVDRF FKTLRAEQAAGLEEMMTACQGVGGPSHKAALSPRTLNAWVKV.
[0179] In some embodiments, a nucleic acid encoding an HIV Gag conserved element polypeptide for use in the invention encodes a polypeptide that comprises the conserved elements set forth in Table 2 SEQ ID NOS:26-32. In some embodiments, such a nucleic acid construct encodes a polypeptide comprising the amino acid sequence of p24 Gag CE1 as shown in Table 2. In some embodiments, a nucleic acid encoding a conserved element encodes a polypeptide comprising the conserved elements set forth in SEQ ID NOS:33-39. In some embodiments, such a nucleic acid construct encodes a polypeptide that comprises the p24 Gag CE2 amino acid sequence as shown in Table 2. In some embodiments, a nucleic acid construct encoding a polypeptide comprising the p24 Gag CEI sequences SEQ ID NOs 26-32 set forth in Table 2 is administered with a nucleic acid construct encoding a polypeptide comprising the p24 Gag CE2 sequences SEQ ID NOS:33-39 set forth in Table 2. In some embodiments, the nucleic acid sequence encoding p24gag CE1 is present in the same vector as the nucleic acid sequence encoding p24gag CE2.
[0180] In some embodiments, a nucleic acid encoding p24GagCE1 as set forth in Table 2 is co-administered with a nucleic acid encoding p24GagCE2 as set forth in Table 2 where each of the p24GagCE1 and p24GagCE2 polypeptides is expressed as a fusion protein having a human GM-CSF signal peptide at the N-terminus.
[0181] In some embodiments, a nucleic acid encoding a Gag conserved element polypeptide encodes at least one conserved element set forth in the alternative CE sequences shown in Table 2.
[0182] In some embodiments, an immunogen of interest is HIV Env. In some embodiments, a nucleic acid construct encoding an HIV Env conserved element polypeptide employed in accordance with the invention typically encodes a polypeptide that comprises a conserved element as decribed herein. Thus, in some embodiments, the nucleic acid construct encodes a polypeptide that comprises at least 8, typically, at least 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, or more consecutive amino acids from the Env conserved elements shown in Table 1. In sonic embodiments, an Env CE polypeptide used in accordance with the methods of the invention comprises an Env CE1 polypeptide comprising 12 conserved element: CE6, CE1-1, CE7-1, CE8-1, CE9-1, CE10-1, CE11-1, CE12-1, CE13-1, CE14-1, CE15-1, and CE16-1 as shown in Table 1. In some embodiments, the Env CE1 polypeptide comprises the Env CE1 polypeptide sequence of Table 1 (linkers are underlined):
TABLE-US-00003 WVTVYYGVPVWAAVHNVWATHACVPTDPAAEISLWDQSLKPCVKLTPLC VTLGAKFEPIPIHYCTPAGFAGAKVQCTHGIRPVVSTQLLLNGSLAEAA DSGGDPEIVMHSFNCGGEFFYCGAKDNWRSELYKYKVVAAKARRRVVQR EKRAGAVGFLGTAGSTMGAASVAVLTVQARLLLSGIVQQQNNLLRAIEA QQHLLQLTVWGIKQLQARAADWLWYIKIFIMIVGGLVGLRIAAFRVRKG YSPLSLQT.
[0183] In some embodiments, an Env CE polypeptide used in accordance with the methods of the invention comprises an Env CE2 polypeptide comprising 12 conserved element: CE6, CE1-2, CE7-2, CE8-2, CE9-2, CE10-2, CE11-2, CE12-2, CE13-2, CE14-2, CE15-2, and CE16-2 as shown in Table 1. In some embodiments, the Env CE2 polypeptide comprises the sequence of the Env CE2 polypeptide of Table 1 (linkers are underlined):
TABLE-US-00004 WVTVYYGVPVWAAVHNIWATHACVPTDPAAEISLWDESLKPCVKLTPLC VTLGAKFDPIPIHYCAPAGYAGAKVQCTHGIKPVVSTQLLLNGSLAEAA DAGGDLEITTHSFNCRGEFFYCGAKNNWRSELYKYKVVAAKAKRRVVER EKRAGAVGFLGAAGSTMGAASVAVLTVQARQLLSGIVQQQSNLLKAIEA QQHMLQLTVWGIKQLQTRAADWLWYIRIFIMIVGGLIGLRIAAFRVRQG YSPLSFQT.
[0184] In some embodiments, a nucleic acid encoding an HIV Env conserved element polypeptide for use in accordance with the disclosure encodes a polypeptide that comprises at the twelve conserved elements set forth in SEQ ID NOS:1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, and 22. In some embodiments, a nucleic acid encoding an HIV Env conserved element polypeptide in accordance with the disclosure encodes a polypeptide comprising the twelve conserved elements set forth in SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, and 23.
[0185] In some embodiments, an HIV Env CE polypeptide comprising Env conserved elements SEQ ID NO:1, SEQ ID NO:2, SEQ NO:4, SEQ NO:39, SEQ ID NO:41, SEQ ID NO:43, SEQ ID NO:45, SEQ ID NO:47, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:49, SEQ ID NO:51, SEQ ID NO:53, and SEQ ID NO:22 is administered in conjunction with an HIV Env CE polypeptide comprising SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:40, SEQ ID NO:42, SEQ ID NO:44, SEQ ID NO:46, SEQ ID NO:48, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:50, SEQ ID NO:52, SEQ ID NO:54, and SEQ ID NO:23.
[0186] In some embodiments, a nucleic acid encoding an HIV Env conserved element polypeptide in accordance with the invention encodes a polypeptide that differs from SEQ ID NO:24 by no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids. In some embodiments, a nucleic acid encoding an HIV Env conserved element polypeptide in accordance with the invention encodes a polypeptide that differs from SEQ ID NO:25 by no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids.
[0187] An HIV Env conserved element construct can be administered in conjunction with immunogenic constructs to induce immune response to additional regions of HIV, e.g., Gag or a non-structural protein such as Nef. In typical embodiments, the additional immunogenic compositions encode conserved element polypeptides to the HIV protein of interest, e.g., Gag.
[0188] In some aspects, the disclosure further provides Gag conserved elements in addition to those described above for use in a CE immunogenic compositions. In some embodiments, an HIV Gag CE polypeptide comprises a CE as set forth below:
TABLE-US-00005 p24CE8-1 (SEQIDNO:57) QPISPRTLNAWVKV p24CE8-2 (SEQIDNO:58) QALSPRTLNAWVKV p24CE9-1 (SEQIDNO:59) EEKAFSPEVIPMFSALSEGATPQDLNTMLN p24CE9-2 (SEQIDNO:60) EEKGFNPEVIPMFTALSEGATPQDLNMMLN p24CE10-1 (SEQIDNO:61) PRGSDIAGTTSTLQEQIGWMT p24CE10-2 (SEQIDNO:62) PRGSDIAGTTSTLQEQIAWMT p24CE11-1 (SEQIDNO:63) SILDIRQGPKEPFRDYVDRF p24CE11-2 (SEQIDNO:64) SILDIKQGPKEPFRDYVDRF p24CE12-1 (SEQIDNO:65) QNSNPDCKTILKALG p24CE12-2 (SEQIDNO:66) QNANPDCKTILKALG p24CE13-1 (SEQIDNO:67) LEEMMTACQGVGGPGHKARILAEAM p24CE13-2 (SEQIDNO:68) LEEMMTACQGVGGPSHKARVLAEAM.
[0189] Thus, in one aspect the disclosure provides an HIV Gag CE polypeptide that comprises one or more, or two, or three, or four, or five, or all of, the CEs of SEQ ID NOs:57, 59, 61, 63, 65, or 67; or one or more, or two, or three, or four, or five, or all of, the CEs of SEQ ID NOs:58, 60, 62, 64, 66, or 68.
[0190] These alternative CE elements are typically employed with Gag CE elements from U.S. Patent Application Publication No. 20150056237, the sequences of which are shown in
[0191] In some embodiments, the invention provides Gag CE polypeptides that includethe following CE: [0192] P24CE8-1, p24CE9-1, p24CE3-1, p24CE10-1, p24CE5-1, p24CE11-1, p24CE6-1, p24CE12-1, p24CE13-1; or a Gag CE polypeptide that comprises P24CE8-2, p24CE9-2, p24CE3-2, p24CE10-2, p24CE5-2, p24CE11-2, p24CE6-2, p24CE12-2, p24CE13-2. The two polypeptides are typically used in conjunction with one another to cover almost all of the diversity observed in those conserved elements in naturally occurring HIV Gag sequences. Each of the two Gag CE polypeptides include CE elements that correspond to one another, but that different at a small number of amino acid positions see,
[0193] In some embodiments, an HIV Gag CE polypeptide may comprise p24CE8 instead of p24CE1; p24CE9 instead of p24CE2; and/or p24CE13 instead of p24CE7 as shown in
[0194] In the present disclosure, a conserved element nucleic acid construct is employed in an immunization regimen that also employs a nucleic acid encoding full-length protein, or substantially fill-length protein, from which the conserved elements are obtained. In the context of the present disclosure, substantially full-length refers to the region of the protein that includes all of the conserved elements, i.e., a sufficient length of a naturally occurring protein is provided that includes all of the conserved elements that are used in the conserved element construct. In the present disclosure, administration of a nucleic acid construct encoding a full-length protein excludes administration of a viral genome, e.g., an HIV genome, that comprises a nucleic acid sequence that encodes the protein. In some embodiments, a nucleic acid construct used in accordance with a treatment protocol of the present disclosure that encodes a full-length Gag or Env protein may also encode additional viral proteins, but does not encode a full complement of viral proteins. For example, such a nucleic acid construct may exclude sequences that encode one or more regulatory polypeptides such as Tat.
[0195] A nucleic acid construct encoding a full-length protein, or substantially full-length protein, is administered following administration of the one or more constructs encoding the CE polypeptide(s), such that the CE polypeptide(s) acts as a prime and the full-length polypeptide, or substantially full-length polypeptide, is a boost. In the present disclosure, the boost preferably comprises co-administering the one or more nucleic acid constructs encoding CE polypeptide(s) with the nucleic acid construct encoding the full-length polypeptide, or substantially full-length polypeptides. The boost is typically administered anywhere from about one, about two, about three, or about four months; or even about one year, or longer, following administration of the initial priming vaccines. Multiple boost vaccinations may be used, and different full-length proteins may be used in a sequence of boosts. A priming vaccination can itself be one or multiple, e.g., 2, 3, 4, or 5, administrations of the CE polypeptide(s). CE polypeptides and a full-length polypeptide, or substantially full-length polypeptide, are preferably administered to the host by way of administration of expression constructs that encode the polypeptides, although in some embodiments, the polypeptides are administered in a protein form. Protein forms may be employed in either the priming or boosting administrations.
[0196] In the present disclosure, nucleic acid constructs encoding the CE polypeptides that are administered in the priming component of the vaccine regimen are administered first, i.e., the subject has not been administered a nucleic acid that encodes the full-length, or substantially full-length, polypeptide either prior to or concurrently with administration of the CE constructs. Thus, for example, a method of the invention for inducing an immune response in the subject can comprise administering one or more nucleic acid constructs encoding a Gag CE polypeptide construct as the priming immunization followed by administration of a full-length, or substantialliy full-length Gag polypeptide as a boosting step, where the boosting step also comprises co-administration of the CE constructs again.
[0197] The initial priming administration of the CE constructs may also comprise administering CE constructs for another polypeptide for which it is desired to elicit an immune response. Thus, one or more Gag CE constructs may be administered sequentially or concurrently with one or more Env CE constructs in the initial priming phase of the vaccination regimen. As noted above, the priming administration occurs before administration of either full-length, or substantially full-length, form of either antigen.
[0198] Nucleic acids encoding multiple CE polypeptides, typically two CE polypeptides, i.e., a conserved element polypeptide pair, are administered in combination. In the context of the current invention, nucleic acid constructs encoding CE polypeptides administered in combination also referred to herein as co-administration, may be administered together or separately, For example, a nucleic acid construct encoding a second CE polypeptide may be administered after (e.g., anywhere from 1 minutes to 60 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, or up to 2 weeks) administration of a first nucleic acid construct encoding a CE polypeptide, but is typically administered at the same time as the first nucleic acid construct. In some embodiments, the nucleic acid construct encoding the second CE polypeptide is administered within 24 hours of administration of the nucleic acid construct encoding the first CE polypeptide.
[0199] Similarly, for co-administration of one or more CE polypeptides with the full-length, or substantially full-length polypeptide, administered as the boost, the co-administration may be formed by administering the constructs together, or they may be administered separately. For example, one or more nucleic acid constructs encoding a CE polypeptide(s) may he administered shortly before (e.g., anywhere from 1 minutes to 60 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, usually within 24 hours) or after, a nucleic acid construct encoding the full-length polypeptide, or the substantially full-length polypeptide.
[0200] In some mbodiments, in a boosting administration, the one or more CE nucleic acid constructs are co-delivered with a nucleic acid construct encoding a full-length, or substantially full-length, protein. In the context of this disclosure, co-delivery refers to administering the nucleic acid constructions together at the same site, e.g., administering them in the same mixture.
[0201] In some embodiments, a nucleic acid immunization regimen in accordance with the disclosure comprises performing at least two priming administrations with one or more CE nucleic acids constructs, which encode a conserved element pair, either on separate vectors or the same vector, followed by performing at least two boosting administrationsof the CE nucleic acid construct(s) co-delivered with the construct encoding the full-length polypeptide or substantially full-length polypeptide. In some embodiments, priming vaccinations can be performed at least about two weeks apart. In some embodiments, priming vaccinations are performed at least about one month apart or separated by several months. Boost vaccinations are typically administered at least about one month, often at least about 2, 3, 4, 5, 6, 7, 8, 9, 10, or 11 months; or 1 or more years after the priming vaccinations.
[0202] In the methods of the disclosure, a nucleic acid construct encoding a CE polypeptide is directly introduced into the cells of the individual receiving the immunogenic composition, i.e., the CE polypeptide is administered to the host via expression in the host cells of the nucleic acid construct encoding the polypeptide. This approach is described, for instance, in Wolff et. at., Science 247:1465 (1990) as well as U.S. Pat. Nos. 5,580,859; 5,589,466; 5,804,566; 5,739,118; 5,736,524; 5,679,647; and WO 98/04720. Examples of DNA-based delivery technologies include, naked DNA, facilitated (hupivicaine, polymers, peptide-mediated) delivery, and cationic lipid complexes or liposomes. In some embodiments, nucleic acids are administered using ballistic delivery as described, for instance, in U.S. Pat. No. 5,204,253 or pressure (see, e.g., U.S. Pat. No. 5,922,687).
[0203] In some mbodiments, the immunogenic compositions of the disclosure are administered by injection or electroporation, or a combination of injection and electroporation. For example, the nucleic acid can be administered using intramuscular or intradermal injection and may include in vivo electroporation to enhance DNA uptake.
[0204] In some embodiments, e.g., where a nucleic acid construct of the invention is encoded by a viral vector, the nucleic acid construct can be delivered by infecting the cells with the virus containing the vector. This can be performed using well-known delivery.
[0205] For embodiments that employ administration of a polypeptide as a protein form, rather than expressing the protein in the host cell using a nucleic acid construct, the proteins are typically produced in an in vitro cell expression system and isolated for administration to the subject. Such cellular expression systems are well known in the art.
[0206] Nucleic acid constructs may be employed as plasmid expression vectors or may be administered as a virus. In some embodiments, the nucleic acid constructs encoding the conserved elements and/or full-length HIV polypeptides are one or more purified nucleic acid molecules, for example, one or more DNA plasmid-based vectors (naked DNA).
[0207] In some embodiments, a nucleic acid construct encoding a CE immunogenic polypeptide is contained within a viral vector and administered as a virus. Viral delivery systems include adenovirus vectors, adeno-associated viral vectors, herpes simplex viral vectors, retroviral vectors, pox viral vectors, lentiviral vectors, alphavirus vectors, poliovirus vectors, and other positive and negative stranded RNA viruses, viroids, and virusoids, or portions thereof. Methods of constructing and using such vectors are well known in the art.
[0208] For example, recombinant viruses in the pox family of viruses can be used for delivering the nucleic acid molecules. These include vaccinia viruses and avian poxviruses, such as the fowlpox and canarypox viruses. Methods for producing recombinant pox viruses are known in the art and employ genetic recombination. See, e.g., WO 91/12882; WO 89/03429; and WO 92/03545. A detailed review of this technology is found in U.S. Pat. No. 5,863,542. Representative examples of recombinant pox viruses include ALVAC, TROVAC, and NYVAC.
[0209] A number of adenovirus vectors, including Ad2, Ad5, and Ad7 have also been described that can be used to deliver one or more of the nucleic acid constructs as described herein (Haj-Ahmad and Graham, J. Virol. (1986) 57:267-274; Bett et al., J. Virol. (1993) 67:5911-5921; Mittereder et al., Human Gene Therapy (1994) 5:717-729; Seth et al., J. Virol. (1994) 68:933-940; Barr et al., Gene Therapy (1994) 1:51-58; Berkner, K. L. BioTechniques (1988) 6:616-629; and Rich et al., Human Gene Therapy (1993) 4:461-476). Additionally, various adeno-associated virus (AAV) vector systems have been developed for gene delivery. AAV vectors can he readily constructed using techniques well known in the art. See, e.g., U.S. Pat. Nos. 5,173,414 and 5,139,941; International Publication Nos. WO 92/01070 (published 23 Jan. 1992) and WO 93/03769 (published 4 Mar. 1993); Lebkowski et al., Molec. Cell. Biol. (1988) 8:3988-3996; Vincent et al., Vaccines 90 (1990) (Cold Spring Harbor Laboratory Press); Carter, B. J. Current Opinion in Biotechnology (1992) 3:533-539; Muzvczka, N. Current Topics in Microhiol. and Immunol. (1992) 158:97-129; Kotin, R. M. Human Gene Therapy (1994) 5:793-801; Shelling and Smith, Gene Therapy (1994) 1:165-169; and Zhou et al., J. Exp. Med. (1994) 179:1867-1875.
[0210] Retroviruses also provide a platform for gene delivery systems. A number of retroviral systems have been described (U.S. Pat. No. 5,219,740; Miller and Rosman. BioTechniques (1989) 7:980-990; Miller, A. D., Human Gene Therapy (1990) 1:5-14; Scarpa et al., Virology (1991) 180:849-852; Burns et al., Proc. Natl. Acad. Sci. USA (1993) 90:8033-8037; and Boris-Lawrie and Temin, Cur, Opin. Genet. Develop. (1993) 3:102-109. Additional gene delivery systems include lentiviral vectors that employ lentiviral vector backbones.
[0211] Members of the Alphavirus genus, such as, but not limited to, vectors derived from the Sindhis, Semliki Forest, and Venezuelan Equine Encephalitis viruses, can also be used as viral vectors to deliver one or more nucleic acid constructs of the disclosure. For a description of Sindbis-virus derived vectors useful for the practice of the instant methods, see, Dubensky et al, J. Virol. (1996) 70:508-519; and International Publication Nos. WO 95/07995 and WO 96/17072; as well as, Dubensky, Jr., T. W., et al., U.S. Pat. No. 5,843,723, issued Dec. 1, 1998, and Dubensky, Jr., T. W., U.S. Pat. No. 5,789,245, issued Aug. 4, 1998).
Expression Constructs Encoding Fusion Polypeptides Comprising a Degradation Signal or Signal Peptide Sequence
[0212] In some embodiments, a nucleic acid encoding a conserved element polypeptide encodes a form in which the conserved element is fused to a sequence to enhance the immune response, such as a signal peptide sequence or a sequence that targets the protein for lysosomal degradation. Such embodiments typically results in enhanced immune responses in comparison to embodiments where the conserved element vaccine is not fused to a signal peptide or degradation signal.
Lysosomal Targeting Sequence
[0213] In some embodiments, signals that target proteins to the lysosome may be employed. For example, the lysosome associated membrane proteins1 and 2 (LAMP-1 and LAMP-2) include a region that targets proteins to the lysosome. Examples of lysosome targeting sequences are provided, e.g., in U.S. Pat. Nos. 5,633,234; 6,248,565; and 6,294,378.
[0214] Destabilizing sequences present in particular proteins are well known in the art. Exemplary destabilization sequences include c-myc aa 2-120; cyclin A aa 13-91; Cyclin B aa 13-91; IkB aa 20-45; -Catenin aa 19-44; -Catenin aa 18-47, c-Jun aa1-67; and c-Mos aa1-35; and fragments and variants, of those segments that mediate destabilization. Such fragments can be identified using any method. For example, polypeptide half-life can be determined by a pulse-chase assay that detects the amount of polypeptide that is present over a time course using an antibody to the polypeptide, or to a tag linked to the polypeptide. Exemplary assays are described, e.g., in WO02/36806, which is incorporated by reference.
[0215] Variants of such sequences, e.g., that have at least 90% identity, usually at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater, identity to the sequences noted above, e.g., a LAMP degradation sequence, can be employed in this invention.
[0216] Additional degradation signals that can be used to modify retroviral antigens, e.g., HIV antigens in accordance with the invention include the F-box degradation signal, such as the F- BOX signal 47aa (182-228) from protein beta-TrCP (Liu, et al., Biochem Biophys Res Comm. 313:1023-1029, 2004). Accordingly, in sonic embodiments, an expression vector for use in the invention may encode a fusion protein where an F-box degradation signal is attached to an HIV polypeptide, e.g., an HIV Env CE polypeptide as described herein.
Targeting to the Proteasome and Other Degradation Signals
[0217] Many polypeptide sequences that target a protein for degradation are known in the art. One example of destabilizing sequences are so-called PEST sequences, which are abundant in the amino acids Pro, Asp, Glu, Ser, Thr (they need not be in a particular order), and can occur in internal positions in a protein sequence. A number of proteins reported to have PEST sequence elements are rapidly targeted to the 26S proteasome. A PEST sequence typically correlates with a) predicted surface exposed loops or turns and b) serine phosphorylation sites, e.g., the motif S/TP is the target site for cyclin dependent kinases.
[0218] Additional destabilization sequences relate to sequences present in the N-terminal region. In particular the rate of ubiquitination, which targets proteins for degradation by the 26S proteasome can be influenced by the identity of the N-terminal residue of the protein. Thus, destabilization sequences can also comprise such N-terminal residues, N-end rule targeting (see, e.g., Tobery et at., J Exp. Med. 185:909-920.).
[0219] Other targeting signals include the destruction box sequence that is present, e.g., in cyclins. Such a destruction box has a motif of 9 amino acids, R1(A/T)2(A)3L4(G)5X6(1/V)7(G/T)8(N)9, in which the only invariable residues are R and L in positions 1 and 4, respectively. The residues shown in parenthesis occur in most destruction sequences. (see, e.g., Hershko Ciechanover, Annu. Rev. Biochem. 67:425-79, 1998). In other instances, destabilization sequences lead to phosphorylation of a protein at a serine residue (e.g., 1b).
[0220] In some embodiments, a conserved element polypeptide of the invention is fused to a LAMP degradation sequence. For example, the methods of the invention may employ a polypeptide in which SEQ ID NO:24 or SEQ ID NO:25, or SEQ ID NO:40 or 41, is fused to a LAMP degradation sequence.
Expression Constructs that Encode Secreted Fusion Proteins
[0221] A secretory polypeptide in the context of this invention is a polypeptide signal sequence that results in secretion of the protein to which it is attached. In some embodiments, the secretory polypeptide is a chemokine, cytokine, or lymphokine, or a fragment of the chemokine, cytokine, or lymphokine that retains immunostimulatory activity. Examples of chemokine secretory polypeptides include MCP-3 and IP-10. In other embodiments, the secretory polypeptide is a polypeptide signal sequence from a secreted protein such as tissue plasminogen activator (tPA) protein, growth hormone, GM-CSF, a cytokine, or an immunoglobulin protein. Constructs encoding secretory fusion proteins are disclosed, e.g., in WO02/36806.
[0222] In some embodiments, the signal peptide is a GM-CSF sequence, e.g., a mammalian GM-CSF sequence such as a human GM-CSF signal peptide sequence.
[0223] In some embodiments, a secretory signal for use in the invention is MCP-3 amino acids 33-109, e.g., linked to an IP-10 secretory peptide.
[0224] In some embodiments, a conserved element polypeptide may SEQ ID NO:24 fused to a signal peptide; or may comprise SEQ ID NO:25 fused to a signal peptide. The signal peptide may be a native HIV Env signal peptide or a heterologous signal peptide. In some embodiments, a conserved element polypeptide may SEQ ID NO:40 fused to a signal peptide; or may comprise SEQ ID NO:41 fused to a signal peptide. The signal peptide may be a native HIV signal peptide or a heterologous signal peptide.
[0225] Similarly, an expression construct encoding a full-length polypeptide, or substantially fill-length polypeptide, may also be modified with a secretory sequence, e.g., a heterologous signal peptide or degradation peptide sequence. Moreover, more than one construct encoding the full-length polypeptide, or substantially full-length polypeptide,s may be administered. For example, a construct in which Gag (or Env) is fused to a signal polypeptide may be used in conjunction with a construct in which Gag (or ENv) is fused to a degradation sequence.
Additional Properties of Expression Constructs
[0226] Within each expression cassette, sequences encoding an antigen for use in the nucleic acid vaccines of the invention will be operably linked to expression regulating sequences. Operably linked sequences include both expression control sequences that are contiguous with the nucleic acid of interest and expression control sequences that act in trans or at a distance to control the gene of interest. Expression control sequences include appropriate transcription initiation, termination, promoter and enhancer sequences; efficient RNA processing signals such as splicing and polyadenylation signals; sequences that stabilize cytoplasmic mRNA; sequences that promote RNA export (e.g., a constitutive transport element (CIE), a RNA transport element (RTE), or combinations thereof; sequences that enhance translation efficiency (e.g., Kozak consensus sequence); sequences that enhance protein stability; and when desired, sequences that enhance protein secretion.
[0227] Any of the conventional vectors used for expression in eukaryotic cells may be used for directly introducing nucleic acids into tissue. Expression vectors containing regulatory elements from eukaryotic viruses are often used in eukaryotic expression vectors. Such regulatory elements include, e.g., human CMV, simian CMV, viral LTRs, and the like. Typical vectors may comprise, e.g., those with a human CMV promoter, bovine growth hormone polyA site and an antibiotic resistance gene for selective growth in bacteria.
[0228] Other expression vector components are well known in the art, including, but not limited to, the following: transcription enhancer elements, transcription termination signals, polyadenylation sequences, splice sites, sequences for optimization of initiation of translation, and translation termination sequences.
[0229] In some embodiments, the nucleic acid component may comprise one or more RNA molecules, such as viral RNA molecules or mRNA molecules that encode the antigen of interest.
[0230] In typical embodiments, the nucleic acid constructs are codon-optimized for expression in a human.
[0231] As noted here, in the present disclosure, a nucleic acid molecule can include cDNA and genomic DNA sequences, RNA, and synthetic nucleic acid sequences. Thus, nucleic acid also encompasses embodiments in which analogs of DNA and RNA are employed.
[0232] An immunogenic composition of the invention can be administered as one or more constructs. For example, where two sets of conserved elements are employed, e.g., HIV Env conserved element polypeptides of SEQ ID NOS:24 and 25, or HIV Gag conserved elment polypeptides of SEQ ID NOS: 40 and 41, nucleic acid construct can encode both sets, or each set may be encoded by a separate expression vector. Thus, the expression constructs administered in accordance with the invention may be administered as multiple expression vectors, or as one or more expression vectors encoding multiple expression units, e.g., a discistronic, or otherwise multicistronic, expression vectors. For example, an expression vector may be employed that encodes both SEQ NO:24 and SEQ ID NO:25 or multiple expression vectors may be employed where SEQ ID NO:24 is encoded by one vector and SEQ ID NO:25 is encoded by another vector. Similarly, an expression vector may be employed that encodes both SEQ ID NO:40 and SEQ ID NO:41 or multiple expression vectors may be employed where SEQ ID NO:40 is encoded by one vector and SEQ ID NO:41 is encoded by another vector.
[0233] In some embodiments, multiple nucleic acid constructs that encode an HIV Gag or Env CE polypeptide may be employed. For example, a nucleic acid construct that encodes an HIV-Env CE polypeptide fused to a signal peptide may be used in combination with a nucleic acid construct that encodes the HIV-Env CE polypeptide fused to a degradation signal; and/or a nucleic acid construct that encodes an HIV-Gag CE polypeptide fused to a signal peptide may be used in combination with a nucleic acid construct that encodes the HIV-Gag CE polypeptide fused to a degradation signal. Thus, multiple constructs that encode a desired HIV CE polypeptide may be used in a vaccine.
Administration of Immunogenic Compositions as Peptides
[0234] In some embodiments, CE polypeptides, e.g., HIV Gag or Env CE polypeptides as of the present discosure, are administered to a subject in the form of a protein. Thus, in some embodiments, a subject is administered multiple, typically two, HIV CE polypeptides. As explained in the context of the administration of a nucleic acid construct, CE polypeptides administered in combination may be administered together or separately. For example, a first CE polypeptide may be administered prior to (e.g., anywhere from 1 minutes to 60 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours. 48 hours, 72 hours, 96 hours, or 1 week, or more) administration of a second CE polypeptide.
[0235] A full-length protein or substantially full-length protein may also he administered in the form of a protein. In one embodiment, a full-length polypeptide or substantially full-length polypeptide is administered following administration of a CE polypeptide, such that the CE polypeptide acts as a prime and the full-length polypeptide, or substantially full-length polypeptide is a boost. In preferred embodiments, the full-length or substantially full-length polypeptide is administered in a boosting step that also comprises administration of the CE polypeptide(s). The boost is typically administered anywhere from two weeks to one, two, three, or four months, or longer, following administration of the initial priming vaccines. A priming vaccination can itself be one or multiple administrations of the CE polypeptide. In some embodiments, a boost of a full-length, or substantially full-length, polypeptide is administered in combination with a further administration of the CE polypeptide (s), such that the CE polypeptide is not only administered as a priming step, but as part of the boosting step that comprises administering full-length, or substantially full-length polyeptide.
[0236] In some embodiments, both nucleic acids CE polypeptides in accordance with the disclosure and protein forms of the CE polypeptides may be administered to a subject at various times in a vaccination regimen. Similarly, nucleic acid constructs encoding a full-length protein, or substantially full-length protein, may be used in vaccine regimens that also employ protein forms of the full-length protein, or substantially full-length protein. In some embodiments, a full-length protein may be administered in the form of a viral particle.
Assessment of Immunogenic Response
[0237] To assess a patient's immune system during and after treatment and to further evaluate the treatment regimen, various parameters can be measured. Measurements to evaluate immunogenic responses include: antibody measurements in the plasma, serum, or other body fluids; analysis of in vitro cell proliferation in response to a specific antigen, indicating the function of CD4+ cells, and analysis of CD8+ responses. Such assays are well known in the art. For example, for measuring CD4+ T cells, many laboratories measure absolute CD4+ T-cell levels in whole blood by a multi-platform, three-stage process. Systems for measuring CD4+ cells are commercially available. For example commercially available FAC sytems are available that automatically measure absolutes CD4+, CD8+, and CD3+ T lymphocytes.
[0238] Other measurements of immune response include assessing CD8+ responses. These techniques are well known. CD8+ T-cell responses can be measured, for example, by using tetramer staining of fresh or cultured PBMC (see, e.g., Altman, et al., Proc. Natl. Acad. Sci. USA 90:10330, 1993; Altman, et al., Science 274:94, 1996), or -interferon release assays such as ELISPOT assays (see, e.g., Lalvani, et al., J. Exp. Med. 186:859, 1997; Dunbar, et al., Curr. Biol. 8:413, 1998; Murali-Krishna, et al. Immunity 8:177, 1998), or by using functional cytotoxicity assays.
Viral Titer
[0239] Viremia is measured by assessing viral titer in a patient. There are a variety of methods of perform this. For example, plasma HIV RNA concentrations can be quantified by either target amplification methods (e.g., quantitative RT polymerase chain reaction [RT-PCR], Amplicor HIV Monitor assay, Roche Molecular Systems; or nucleic acid sequence-based amplification, [NASBA], NucliSens HIV-1 QT assay, Organon Teknika) or signal amplification methods (e.g., branched DNA [bDNA], Quantiplex HIV RNA bDNA assay, Chiron Diagnostics). The bDNA signal amplification method amplifies the signal obtained from a captured HIV RNA target by using sequential oligonucleotide hybridization steps, whereas the RT-PCR and NASBA assays use enzymatic methods to amplify the target HIV RNA into measurable amounts of nucleic acid product. Target HIV RNA sequences are quantitated by comparison with internal or external reference standards, depending upon the assay used.
Administration of Nucleic Acid Constructs
[0240] Nucleic acids for administration to a subject are formulated for pharmaceutical administration. While any suitable carrier known to those of ordinary skill in the art may be employed in the pharmaceutical compositions of this invention, the type of carrier will vary depending on the mode of administration. For parenteral administration, including intranasal, intradermal, subcutaneous or intramuscular injection or electroporation, the carrier preferably comprises water, saline, and optionally an alcohol, a frit, a polymer, a wax, one or more stabilizing amino acids or a buffer. General formulation technologies are known to those of skill in the art (see, for example, Remington: The Science and Practice of Pharmacy (22.sup.nd edition), Allan, ed; 2012, Lippincott Williams & Wilkins; Injectable Dispersed Systems: Formulation, Processing And Performance, Burgess, ed., 2005, CRC Press; and Pharmaceutical Formulation Development of Peptides and Proteins, 2000, Taylor & Francis).
[0241] DNA immunogenic compositions can be administered once or multiple times. DNA vaccination is performed more than once, for example, 2, 3, 4, 5, 6, 7, 8, 10, 15, 20 or more times as needed to induce the desired response (e.g., specific antigenic response or proliferation of immune cells). Multiple administrations can be administered, for example, hi-weekly, weekly, bi-monthly, monthly, or more or less often, as needed, for a time period sufficient to achieve the desired response.
[0242] The nucleic acid constructs in accordance with the invention are administered to a mammalian host. The mammalian host usually is a human or a primate. In some embodiments, the mammalian host can be a domestic animal, for example, canine, feline, lagomorpha, rodentia, rattus, hamster, murine. In other embodiment, the mammalian host is an agricultural animal, for example, bovine, ovine, porcine, equine, etc.
[0243] Immunogenic compositions containing the DNA expression constructs can be formulated in accordance with standard techniques well known to those skilled in the pharmaceutical art. Such compositions can be administered in dosages and by techniques well known to those skilled in the medical arts taking into consideration such factors as the age, sex, weight, and condition of the particular patient, and the route of administration.
[0244] In therapeutic applications, the vaccines are administered to a patient in an amount sufficient to elicit a therapeutic effect, e.g, a CD8.sup.30, CD4.sup.+, and/or antibody response to the HIV-1 antigens encoded by the vaccines that at least partially arrests or slows symptoms, or and/or complications of HIV infection. An amount adequate to accomplish this is defined as therapeutically effective dose. Amounts effective for this use will depend on, e.g., the particular composition of the vaccine regimen administered, the manner of administration, the stage and severity of the disease, the general state of health of the patient, and the judgment of the prescribing physician.
[0245] Nucleic acid vaccines are administered by methods well known in the art as described in Donnelly et al. (Ann. Rev. Immunal. 15:617-648 (1997)); Feigner et al. (U.S. Pat. No. 5,580,859, issued Dec. 3, 1996); Feigner (U.S. Pat. No. 5,703,055, issued Dec. 30, 1997); and Carson et al. (U.S. Pat. No. 5,679,647, issued Oct. 21, 1997), each of which is incorporated herein by reference. One skilled in the art would know that the choice of a pharmaceutically acceptable carrier, including a physiologically acceptable compound, depends, for example, on the route of administration of the expression vector.
[0246] As noted above, immunogenic DNA compositions can be delivered via a variety of routes. Typical delivery routes include parenteral administration, e.g., intradermal, intramuscular or subcutaneous routes. Administration of expression vectors of the invention to muscle and by electroporation can be a particularly effective method of administration, including intradermal and subcutaneous injections and transdermal administration. Transdermal administration, such as by iontophoresis, is also an effective method to deliver expression vectors of the invention to muscle. Epidermal administration of expression vectors of the invention can also be employed. Epidermal administration involves mechanically or chemically irritating the outermost layer of epidermis to stimulate an immune response to the irritant (Carson et al., U.S. Pat. No. 5,679,647).
[0247] Nucleic acids can be administered in solution (e.g., a phosphate-buffered saline solution) by injection, usually by an intravenous, subcutaneous or intramuscular route. In embodiments that employ a naked nucleic acid composition, the dose of a naked nucleic acid composition is from about 1.0 ng to about 10 mg for a typical 70 kilogram patient. Subcutaneous or intramuscular doses for naked nucleic acid (typically DNA) may range from 0.1 ug to 100 ug for a 70 kg patient in generally good health. For example, an HIV DNA vaccine, e.g., naked DNA or polynucleotide in an aqueous carrier, can be injected into tissue, e.g., intramuscularly or intradermally, in amounts of from 10 l per site to about 1 ml per site. The concentration of polynucleotide in the formulation is usually from about 0.1 g/ml to about 4 mg/ml. In some embodiments, the DNA may be administered in ng amounts, for example at a level of 1 to 100 ng.
[0248] In embodiments in which one or more of the components of a vaccine regimen is administered in the form of a protein, the protein is typically administered at a concentration that is determined by known techniques taking into account medical considerations regarding the subject. Dosages for administration of a polypeptide composition included milligram or microgram amounts per kilogram. Illustrative doses are about 0.1 ug/kg to about 500 mg/kg. For example, doses may range from about 1 ug/kg to about 100 ug/kg or from about 0.1 ug/kg to about 50 ug/kg. I some embodiments, the dosage is about 0.5 ug/kg or more, 1 ug/kg or more, 2 ug/kg or more, 5 ug/kg or more, 10 ug/kg or more 25 ug/kg or more or 50 ug/kg or more.
[0249] As understood by one in the art, dosages may vary depending on the route of aministration.
[0250] The protein is formulated using well-known techniques for administration employing various routes, e.g., intravenous, subcutaneous, intramuscular, intranasal, transdermal, or intraperitoneal administration.
[0251] The vaccine may be delivered in a physiologically compatible solution such as sterile PBS. The vaccines may also be lyophilized prior to delivery. As well known to those in the art, the dose may he proportional to weight.
[0252] The compositions included in the regimen descried herein for inducing an immune response can be administered alone, or can be co-administered or sequentially administered with other immunological, antigenic, vaccine, or therapeutic compositions.
[0253] Compositions that may also be administered with the vaccines include other agents to potentiate or broaden the immune response, e.g., IL-15, IL-12, IL-2 or CD40 ligand, which can be administered at specified intervals of time, or continuously administered.
[0254] The vaccines can additionally be complexed with other components such as peptides, polypeptides and carbohydrates for delivery. For example, expression vectors, i.e., nucleic acid vectors that are not contained within a viral particle, can be complexed to particles or beads that can he administered to an individual, for example, using a vaccine gun.
[0255] The immunogenic compositions can also be formulated for administration via the nasal passages. Formulations suitable for nasal administration, wherein the carrier is a solid, include a coarse powder having a particle size, for example, in the range of about 10 to about 500 microns which is administered in the manner in which snuff is taken, i.e., by rapid inhalation through the nasal passage from a container of the powder held close up to the nose. Suitable formulations wherein the carrier is a liquid for administration as, for example, nasal spray, nasal drops, or by aerosol administration by nebulizer, include aqueous or oily solutions of the active ingredient. For further discussions of nasal administration of AIDS-related vaccines, references are made to the following patents, U.S. Pat. Nos. 5,846,978, 5,663,169, 5,578,597, 5,502,060, 5,476,874, 5,413,999, 5,308,854, 5,192,668, and 5,187,074.
[0256] The vaccines can be incorporated, if desired, into liposomes, microspheres or other polymer matrices (see, e.g., Feigner et al., U.S. Pat. No. 5,703,055; Gregoriadis, Liposome Technology, Vols. I to III (2nd ed. 1993). Liposomes, for example, which consist of phospholipids or other lipids, are nontoxic, physiologically acceptable and metabolizable carriers that are relatively simple to make and administer. Liposomes include emulsions, foams, micelles, insoluble monolayers, liquid crystals, phospholipid dispersions, lamellar layers and the like.
EXAMPLES ILLUSTRATING THE INVENTION
Example 1
Illustration of Enhanced Immune Responses Obtained with CE Construct Prime Followed by CE and Full-Length Polypeptides as Boost
[0257] This example evaluated prime-boost combination vaccines to increase breadth of immunity. In addition to the CE prime-full length molecule boost, it was found that using a boost involving co-delivery of CE and full-length molecule resulted in significantly further improved breadth of the responses. This boost further elicited higher levels of cytotoxic T cells focusing the immune responses to the highly conserved epitopes.
[0258] Method: this study was performed using a simian immunodeficiency virus (SIV) derived conserved element pDNA vaccine that was designed from the SIV p27.sup.gag capsid protein by analogy to an HIV CE vaccine. The SIV p27.sup.gag is the proteolytic processing product derived from the full length SIV p57.sup.gag protein. Seven highly conserved elements were identified within the p27.sup.gag capsid protein by (i) analogy to HIV CE sequences and (ii) sequence conservation among available SW sequences (
[0259] Macaques (N=14) received vaccinations with a mixture of SW p27CE1 pDNA and p27CE2 pDNA, referred to SIV p27 pDNA (
[0260] To further expand the potency of booster vaccination, two different regimens were compared using the SIV CE pDNA primed macaques (
[0261] The SIV p27CE pDNA primed animals (N=6) received a booster vaccination with a plasmid expressing the full length SW p57.sup.gag pDNA (
[0262] The other group of CE primed macaques (N=6) received a booster vaccination by co-delivery of the CE DNA and a plasmid expressing the full length SW p57.sup.gag pDNA (
[0263] While both booster regimens led to marked increase in magnitude of the CE responses, reaching similar levels, a fundamental difference in the breadth of the responses was found (
[0264] The induced CE-specific immune responses were further examined for cytotoxicity markers (
[0265] The data obtained with the SIV p27CE DNA vaccine therefore demonstrate that a booster vaccination including the co-delivery of CE and gag pDNA provided a significant increase in breadth of the CE-specific responses compared to a regimen using only the gag pDNA boost. The co-delivery of CE pDNA and pDNA expressing the full length protein as boost is proposed to maximize the induction of T cell responses to subdominant HIV Gag epitopes and this strategy is currently tested.
[0266] Together, these data corroborate the original observation demonstrating that priming with CE as vaccine (DNA, viral vector, protein) is important to allow development of immune responses to subdominant epitopes. Fine-tuning the booster vaccination by including the co-delivery CE and the intact full-length molecule offers an additional advantage to optimize breadth and quality of the immune responses. This regimen is more effective than the CE DNA prime-gag DNA boost even when additional gag DNA boosts were given.
[0267] In humans, immunogenic responses will be evaluated in a trial that includes priming with the HIV p24CE DNA (0, month 2), followed by 2 booster vaccinations using codelivery of p24CE DNA and p55gag DNA (Month 4 and 6). In macaques, there were no significant differences identified between 2 and 3 CE DNA vaccinations, thus, two priming vaccinations are planned to strengthen the priming step. Two booster vaccinations will be given because in the macaque model, 2 co-delivery boosts provided improved results. This trial employs ae dual-promoter p24CE1/2 pDNA (plasmid code 306H,
[0268] A plasmid encoding p55gag is used in the boost along with the p24CE plasmid. The p55gag pDNA (plasmid code 114H,
[0269] Application of this method is not limited to HIV but can modulated to address the induction of immune responses to any subdominant epitopes (cellular and or humoral) to increase breadth, magnitude and quality of the immune responses.
Example 2
Env DNA Vaccination Induces Cross-Clade Specific Cellular Immune Responses in Mice
Result:
Conserved Element DNA Vaccines
[0270] A set of conserved elements (CE) was identified in the HIV Env protein (
[0271] Regions for inclusion/exclusion from the vaccine were selected based on whether immune responses to such regions were associated with virologic control or lack of control. We designed and synthesized two versions of these synthetic proteins (Env-CE1 and Env-CE2), each of which is composed of 12 conserved elements that differ by 0-5 amino acid per conserved element (CE) to maximize the inclusion of commonly detected variants (See Table 1). These CE were collinearly arranged and separated by short amino acid linkers (e.g., 3 amino acids) designed to facilitate processing of the protein and avoidance of neo-antigens. The coding sequences were RNA/codon-optimized according to Pavlakis and Felber's RNA optimization method (U.S. Pat. Nos. 5,972,596; 5,965,726; 6,174,666; 6,791,664, 6,414,132; 6,794,498) and designed to use alternative codons to maximize expression in human cells. Expression-optimized sequences were placed into a eukaryotic DNA plasmid vector.
[0272] In an illustrative embodiment, a combination of the two plasmids was used to vaccinate 4 macaques (
[0273] In contrast, vaccination of macaques (N=9) with complete Env DNA failed to develop CE-specific linear peptide responses in 50% of the macaques or induced poor responses to only 1 or 2 CE (
[0274] Implementation of a prime-boost regimen using the Env-CE DNA prime followed by the intact Env boost (
[0275] These data thus indicate that HIV Env-CE1 and Env-CE2 are effective immunogens in inducing cellular and humuoral responses and fulfill the basic criteria of inducing responses to highly conserved region of Env that are not seen by the immune system as part of the intact Env (altered immunohierachy) and the responses are cross-clade reactive (improved cross-clade breadth).
[0276] As shown in the illustrative data provided herein, the use of full-length Env fails or only poorly induces responses to the conserved regions of the protein. This led to the hypothesis that CE epitopes within the Env protein are not immunogenic due to either suboptimal processing and presentation or immunodominance hierarchy focusing the responses to variable epitopes. To address this experimentally, Env-CE DNA primed macaques received an Env DNA booster vaccine with the expectation of either no boost of CE responses (if no processing and presentation of CE-containing peptides from Env) or a boost of the CE responses (if immunodominance hierarchy can be altered by CE priming). Indeed, robust increase in immunity was found in CE-primed macaques given a boost with DNA expressing intact Env.
[0277] Therefore, priming with Env-CE DNA and boosting with plasmid expressing intact Env may solve a major obstacle in HIV vaccine development, demonstrating alteration of the hierarchy of epitope recognition and development of immune responses to potentially protective subdominant highly conserved epitopes. Boosting with Env DNA vaccine increases magnitude, breadth and polyfunctionality of the cellular responses as well as the breadth of humoral immunity against Env, targeting epitopes within the highly conserved elements as well as outside Env-CE.
Identification of Conserved Element Regions
[0278] The success of a conserved elements vaccine approach (1) depends on the ability to identify important features of viral proteins. Recent studies have shown that mutations at highly conserved sites showed varying degrees of fitness impact, from deleterious to negligible (2-5) to increasing (6).
[0279] Furthermore, mutations at sites that remain conserved through time have been shown to have greater fitness cost than mutations of amino acids that became dominant (and hence calculated to be conserved) later in the pandemic (2). Indeed, HIV strains are continuously being imprinted by the human HLA types encountered in different human populations (7,8). Thus, sequence conservation may change as the virus continues to evolve and adapt to host immunity, and contemporary sequence conservation may not be sufficient for pinpointing sites with crucial functional or structural roles. We therefore use sequence conservation as well as other features to identify the conserved elements to be used in our vaccines. The degree of conservation required for inclusion as an Env CE was at least 90% across the entire HIV-1 M group, and usually at least 98%. However, this requirement could be relaxed if data was available in the literature that associated a CTL or antibody epitope, within the CE, with virologic control (as evidenced by low viral load). If an epitope was associated with lack of virologic control (high viral load), its sequence was excluded from inclusion in a CE. Criteria for assigning virologic control or lack of control van in the literature. For example, Mothe (9) and Matthews (10) used viral load <2,000 HIV RNA molecules per milliliter of blood plasma to indicate control.
[0280] Toggle sites were used to create two versions of most CE. A toggle site represents an amino acid site at which conservation may be low but at which two amino acids combined account for the vast majority of sequences of all HIV-1 M group sequences known, usually 98-100%. HIV-1 M group subtypes B, primarily found in the Americas and Western Europe, and subtype C primarily found in South Africa and India, represent most of the available sequence data, and together they represent >60% of all HIV-1 infections. Toggle sites often represent AA that are highly conserved in either subtype B or C, and the CE1 and CE2 sequences correspond to the AA most associated with subtypes B and C, respectively, if the consensus or second most common variant residues differed. Another means of coordinating toggle sites is to associate covarying amino acids (11, 12).
[0281] Other features that resulted in a relaxation of the 90% requirement was an association with known function or CTL escape resulting in a loss in viral fitness, or to substantially extend the length of a CE. For example, the CD4 binding loop region of the HIV Env protein corresponds to a region that binds to broadly neutralizing antibodies and this region is included as CE10 and CE19. To include this region, seven toggle sites in were employed and one residue was included in CE10 without a toggle that had a conservation level of only 79%. In another example, a very long CE (CE14; 43 AA) was included by allowing five toggle sites and one residue was conserved only at a level of 84% across the HIV-1 M group. However, this site was conserved at 97% and 99% in HIV-1 M group subtypes B and C and no obvious toggle site was evident. Alternate CE were generated in some cases by relaxing the criteria further to extend a first generation CE in an attempt to increase its immunogenicity.
[0282] Next, we tested the ability of structure-based computational models to assign sites of mutations that would destabilize the protein structure as a means of identifying vulnerable targets for inclusion in CE vaccines. This approach was first applied to the HIV capsid protein for which more comprehensive three-dimensional structural data is available. Predicted destabilizing mutations were rarely found in a database of 5811 HIV-1 capsid protein coding sequences, with none being present at a frequency greater than 2%. However, 90% of variants with high instability scores from a set of 184 capsid variants whose replication fitness or infectivity has been studied in vitro had aberrant capsid structures and reduced viral infectivity. Based on these instability scores, we identified 45 sites in the capsid protein prone to destabilizing mutations. Applying this method to capsid protein sequences, 9 additional sites were included in a second generation of CE. More than half of these sites are targets of one or more known inhibitors of capsid function (Table 3). The capsid regions enriched with these sites also overlap with peptides shown to induce cellular immune responses associated with lower viral loads in infected individuals.
[0283] A joint scoring metric was also developed that takes into account both sequence conservation and protein structure stability. This performed better at identifying deleterious mutations than sequence conservation or structure stability information alone (Table 2). The computational sequence-structure stability approach thus provides an additional method of identifying conserved elements suitable for use in an immunogenic composition employing conserved elements as described herein for HIV polypeptides. Twenty-one sites in Env were also identified as prone to destabilizing mutations, 11 of which are included in HIV CE.
[0284] A joint scoring metric was also developed that takes into account both sequence conservation and protein structure stability. This performed better at identifying deleterious mutations than sequence conservation or structure stability information alone (Table 2). The computational sequence-structure stability approach provides an additional method of identifying conserved elements suitable for use in an immunogenic composition employing conserved elements as described herein for HIV polypeptides.
Detailed Methods for Structural Stability Prediction.
[0285] Starting 3-dimensional structures. The capsid hexamer, PDBID 3H4E (13), and the dimer form of the carboxy-terminal domain of the capsid, PDB ID 1A43 (14), were used as template structures for mutations in the amino-terminal domain (NTD; residue 1 to 147) and the carboxy-terminal domain (CID residue 148 to 219, including the linker region), respectively. While the known capsid hexamer structure also includes CTD, it does not contain the CTD dimerization interface, shown to be crucial for mature capsid structure and function (15-17). Hence, the CTD dimer (14) was also used. The last 13 residues were missing from the C-terminus of the template structures and, hence, excluded from analysis.
[0286] A high-resolution crystal structure of a trimeric pre-fusion Env with the antibodies removed www website rcsb.org/pdb/explore/explore.do?structureId=4TVP was used as template. As no high-resolution structure of the HIV-I Env protein with all of the variable loop sequences identified has yet been elucidated, these predictions may not cover all mutations that affect protein function.
[0287] In silico mutagenesis. All 19 possible amino acid changes were introduced in silico at each position in the HIV-1 capsid and Env proteins, one at a time. Reference structures in which the starting amino acid was re-introduced into the structure were also generated and used as a control set.
[0288] Two in silico mutation modeling approaches were applied: Fixed-backbone models explore the best-fit side-chain conformation while the main chain atoms of the mutated residue are kept unchanged from the original position in the template structure. The side-chain atoms of the mutated residue were replaced with those of the new amino acid. The best-fit side chain conformation was selected using the SCWRL program version 4.0 (18). The model was then run through 200 steps of energy minimization to remove atomic clashes or internal constraints generated by side-chain replacement using the CHARMM force field, as implemented in the program NAMD version 2.8 (19). Flexible-backbone models allow the main chain atoms to move along with the side chains and the best-fit combination is selected. These were generated in the FOLDX program suite (20) using the BUILDMODEL function with default parameters. This method allows the neighboring side-chains to be moved in order to explore alternative backbone conformations.
[0289] Proteins stability scores. Two types of protein-scoring functions were used to assess mutant models: The atomic distance-dependent statistical based scoring function referred to as Discrete Optimized Protein Energy (DOPE) (21) and the empirical based force field energy function called FOLD-X energy function (FOLDEF) (22). DOPE is part of the protein-modeling package MODELLER (http://salilab.org/modeller/) (23). FOLDEF is part of the FOLDX program suite (http://foldx.crg.es/) (20). Both programs were run using default parameters.
[0290] Sequence dataset and amino acid database frequencies. Full-length HIV-1 subtype B Gag and Env coding sequences were downloaded from the HIV database (HIVDB, http://www.hiv/lanl.gov/). Any sequences with hypermutations (24) early stop codons, frame-shift mutations or ambiguous amino acids were excluded. A multiple sequence alignment was prepared using MUSCLE (25) and then manually edited using Mesquite (26). The database frequency of each amino acid at each site in the final alignment was then calculated using a perl script (http://indra.mullins.microbiol.washington.edu/perlscript/docs/CountAAFreq.html).
[0291] To identify candidate regions for CTL vaccine immunogens design, we searched the Env and capsid sequences in sliding windows of 15 amino acids, one amino acid at a time, and counted the number of sites prone to destabilizing mutations within each window. The window of size 15 was selected to cover the length of known CD4 and CD8 epitopes (27). If less than 70% of the possible AA substitutions were predicted to result in a stable structure, then the site was considered to be structurally vulnerable. As possible, given our other criteria, structurally vulnerable sites were included in CE.
[0292] Composite sequence-structure stability score. A composite score was derived from the mutation database frequency and FOLDEF score of the mutant flexible backbone model. First, all mutations were ranked by database frequency in ascending order. Mutations with the lowest database frequency, i.e., 0%, were given the lowest frequency rank. Next, all mutations were ranked by FOLDEF score in descending order, i.e., mutant models with the highest stability score were given the lowest stability rank. For each mutation, the two ranks were added to get a composite score.
[0293] The combined sequence-structure approach described here has the potential to serve as a target-screening tool for HIV drug and vaccine development. One limitation of this work is that only single amino acid changes were studied, whereas compensatory mutations can arise during viral infection that can restore protein stability and function (Chang, 2011; Gong, 2013; Liu, 2014). Also, all sequence, structure and experimental data used in our analyses were obtained using HIV-1 subtype B viruses. Studies of the effect of more complicated mutational patterns on protein stability in multiple genetic background will provide further insight for identifying desirable targets for HIV vaccines and therapies. Lastly, amino acid conservation can also be evaluated by weighting specific amino acid substitutions by the similarity in physico-chemical properties to the initial amino acid.
REFERENCES CITED IN EXAMPLES SECTION by NUMBER
[0294] 1 Rolland, M., Nickle, D. C., and Mullins, J. I., Hiv-1 Group M Conserved Elements Vaccine, PLoS Pathogens 3 (11), e157 (2007) [0295] 2 Rolland. M., Manocheewa, S., Swain, J. V., Lanxon-Cookson, E. C., Kim. M., Westfall, D. H., Larsen, B. B., Gilbert, P. B., and Mullins, J I., Hiv-1 Conserved-Element Vaccines: Relationship between Sequence Conservation and Replicative Capacity, J Virol 87 (10), 5461-7 (2013) PMC3648173 [0296] 3 Manocheewa, S., Swain, J. V., Lanxon-Cookson, E., Rolland, M., and Mullins, J. I., Fitness Costs of Mutations at the Hiv-1 Capsid Hexamerization Interface, PLoS One 8 (6), e66065 (2013) PMC3681919 [0297] 4 Rihn, S. J., Wilson, S. J., Loman, N. J., Alim, M., Bakker, S. E., Bhella, D., Gifford, R. J., Rixon, F. J. and Bieniasz, P. D., Extreme Genetic Fragility of the Hiv-1 Capsid, PLoS Pathog 9 (6), e1003461 (2013) [0298] 5 Tieu, H.-V., Rolland, M., Hammer, S. M., and Sobieszczyk, M. E., Translational Research Insights from Completed Hiv Vaccine Efficacy Trials, J Acquir Immune Defic Syndr 63, S150-S4 (2013) [0299] 6 Troyer, R. M,, Mcnevin, J., Liu, Y., Zhang, S. C., Krizan, R. W., Abraha, A., Tebit, D. M., Zhao, H., Avila, S., Lobritz, M. A., Mcelrath, M. J., Le Gall, S., Mullins, J. I., and Arts, E. J., Variable Fitness Impact of Hiv-1 Escape Mutations to Cytotoxic T Lymphocyte (Ctl) Response, PLoS Pathog 5 (4), c1000365 (2009) PMC2659432 [0300] 7 Kawashima, Y., Pfafferott, K., Frater, J., Matthews, P., Payne, R., Addo, M., Gatanaga, H., Fujiwara, M., Hachiya, A., Koizumi, H., Kuse, N., Oka, S., Duda, A., Prendergast, A., Crawford, H., Leslie, A., Brumme, Z., Brumme, C., Allen, T., Brander, C., Kaslow, R., Tang, J., Hunter, E., Allen, S., Mulenga, J., Branch, S., Roach, T., John, M., Mallal, S., Ogwu, A., Shapiro, R., Prado, J. G., Fidler, S., Weber, J., Pybus, O. G., Klenerman, P., Ndung'u, T., Phillips, R., Heckerman, D., Harrigan, P. R., Walker, R. D., Takiguchi, M., and Goulder, P., Adaptation of Hiv-1 to Human Leukocyte Antigen Class I, Nature 458 (7238), 641-5 (2009) PMC3148020 [0301] 8 Rousseau, C. M., Lockhart, D. W., Listgarten, J., Maley, S. N., Kadie, C., Learn, G. H., Nickle, D. C., Heckerman, D. E., Deng, W., Brander, C., Ndun'u, T., Coovadia, H., Goulder, P. J., Korber, B. T., Walker, B. D., and Mullins, J. I., Rare Hla Drive Additional Hiv Evolution Compared to More Frequent Alleles, AIDS Res Hum Retroviruses 25 (3), 297-303 (2009) PMC2693345 [0302] 9 Mothe, B., Llano, A., Ibarrondo, J., Zamarreno, J., Schiaulini, M., Miranda, C., Ruiz-Riol, M., Berger, C. T., Herrero, M. J., Palou, E., Plana, M., Rolland, M., Khatri, A., Heckerman, D., Pereyra, F., Walker, B. D., Weiner, D., Paredes, R., Clotet, B., Felber, B. K., Pavlakis, G. N., Mullins, J. I., and Brander, C., Ctl Responses of High Functional Avidity and Broad Variant Cross-Reactivity Are Associated with Hiv Control, PLoS ONE 7 (1), e29717 (2012) PMC3251596 [0303] 10 Matthews, P. C., Listgarten, J., Carlson, J. M., Payne, R., Huang, K. H., Frater, J., Goedhals, D., Steyn, D., Van Vuuren, C., Paioni, P., Jooste, P., Ogwu, A., Shapiro, R., Mncube, Z., Ndung'u, T., Walker, B. D., Heckerman, D., and Goulder, P.J., Co-Operative Additive Effects between Hla Alleles in Control of Hiv-1, PLoS One 7 (10), e47799 (2012) PMC3477121 [0304] 11 Carlson, J. M., Brumme, Z. L., Rousseau, C. M., Brumme, C. J., Matthews, P., Kadie, C., Mullins, J. I., Walker, B. D., Hartigan, P. R., Goulder, P. J., and Heckerman, D., Phylogenetic Dependency Networks: Inferring Patterns of Ctl Escape and Codon Covariation in Hiv-1 Gag, PLoS Comput Biol 4 (11), e1000225 (2008) PMC2579584 [0305] 12 Rolland, M., Carlson, J. M., Manocheewa, S., Swain, J. V., Lanxon-Cookson, E., Deng, W., Rousseau, C. M., Raugi, D. N., Learn, G. H., Maust, B. S., Coovadia, H., Ndung'u, T., Goulder, P. J., Walker, B. D., Brander, C., Heckerman, D. E., and Mullins, J. I., Amino-Acid Co-Variation in Hiv-1 Gag Subtype C: Hla-Mediated Selection Pressure and Compensatory Dynamics, PLoS One 5 (9), e12463 (2010) PMC2931691 [0306] 13 Pornillos, O., Ganser-Pornillos, B. K., Kelly, B. N., Hua, Y., Whitby, E. G., Stout, C. D., Sundquist, W. I., Hill, C. P., and Yeager, M., X-Ray Structures of the Hexameric Building Block of the Hiv Capsid, Cell 137 (7), 1282-92 (2009) PMC2840706 [0307] 14 Worthylake, D. K., Wang, H., Yoo, S., Sundquist, W. I., and Hill, C. P., Structures of the Hiv-1 Capsid Protein Dimerization Domain at 2.6 a Resolution, Acta Crystallogr D Biol Crystallogr 55 (Pt 1), 85-92 (1999) [0308] 15 Von Schwedler, U. K., Stray, K. M., Garrus, J. E., and Sundquist, W. I., Functional Surfaces of the Human Immunodeficiency Virus Type 1 Capsid Protein, J Virol 77 (9), 5439-50 (2003) [0309] 16 Ganser-Pornillos, B. K., Von Schwedler, U. K., Stray, K. M., Aiken, C., and Sundquist, W. I., Assembly Properties of the Human Immunodeficiency Virus Type 1 Ca Protein, J Virol 78 (5), 2545-52 (2004) PMC369201 [0310] 17 Zhao, G., Perilla, J. R., Yufenyuy, E. L., Meng, X., Chen, B., Ning, J., Ahn, J., Gronenbom, A. M., Schulten, K., Aiken, C., and Zhang, P., Mature Hiv-1 Capsid Structure by Cryo-Electron Microscopy and All-Atom Molecular Dynamics, Nature 497 (7451), 643-6 (2013) PMC3729984 [0311] 18 Krivov, Shapovalov, M. V., and Dunbrack, R. L., Jr., Improved Prediction of Protein Side-Chain Conformations with Scwr14, Proteins 77 (4), 778-95 (2009) PMC2885146 [0312] 19 Phillips, J. C., Braun, R., Wang, W., Gumbart, J., Tajkhorshid, E., Villa, E., Chipot, C., Skeet, R. D., Kale, L., and Schulten, K., Scalable Molecular Dynamics with Namd, Journal of computational chemistry 26 (16), 1781-802 (2005) PMC2486339 [0313] 20 Schymkowitz, J., Borg, J., Stricher, F., Nys, R., Rousseau, F., and Serrano, L., The Foldx Web Server: An Online Force Field, Nucleic Acids Res 33 (Web Server issue), W382-8 (2005) PMC1160148 [0314] 21 Shen, M. Y. and Sali, A., Statistical Potential for Assessment and Prediction of Protein Structures, Protein Sci 15 (11), 2507-24 (2006) PMC2242414 [0315] 22 Guerois, R., Nielsen, J. F., and Serrano, L., Predicting Changes in the Stability of Proteins and Protein Complexes: A Study of More Than 1000 Mutations, J Mol Biol 320 (2), 369-87(2002) [0316] 23 Eswar, N., Webb, B., Marti-Renom, M. A., Madhusudhan, M. S., Eramian, D., Shen, M. Y., Pieper, U., and Sali, A., Comparative Protein Structure Modeling Using Modeller, Current protocols in bioinformatics/editoral board, Andreas D. Baxevanis . . . [et al.] Chapter 5, Unit 5 6 (2006) [0317] 24 Rose, P. P. and Korber, B. T., Detecting Hypermutations in Viral Sequences with an Emphasis on G.fwdarw.a Hypermutation, Bioinfomiatics 16 (4), 400-1 (2000) [0318] 25 Edgar, R. C., Muscle: A Multiple Sequence Alignment Method with Reduced Time and Space Complexity, BMC Bioinfomiatics 5, 113 (2004) [0319] 26 Maddison, W. P. and Maddison, D. R., Mesquite: A Modular System for Evolutionary Analysis (2011). [0320] 27 Llano, A., Williams, A., Overa, A., Silva-Arrieta, S., and Brander, C. eds., Best-Characterized Hiv-1 Ctl Epitopes: The 2013 Update, 2013 ed. (Theoretical Biology and Biophysics Group, Los Alamos National Laboratory, Los Alamos, N. Mex. LA-UR 13-27758, Los Alamos, 2013).
[0321] All publications, accession numbers, patents, and patent applications cited in this specification are herein incorporated by reference as if each was specifically and individually indicated to be incorporated by reference.
TABLE-US-00006 TABLE1 IllustrativeHIVEnvConservedElementSequences Theaminoacidresiduesthatdifferbetweenthe twoalternativeconservedelementsequencesineach setareunderlined. EnvCE6 WVTVYYGVPVW(SEQIDNO:1) EnvCE1-1 HNVWATHACVPTDP(SEQIDNO:2) EnvCE1-2 HNIWATHACVPTDP(SEQIDNO:3) EnvCE7-1 ISLWDQSLKPCVKLTPLCVTL(SEQIDNO:4) EnvCE7-2 ISLWDESLKPCVKLTPLCVTL(SEQIDNO:5) EnvCE8-1 FEPIPIHYCTPAGFA(SEQIDNO:6) EnvCE8-2 FDPIPIHYCAPAGYA(SEQIDNO:7) EnvCE9-1 VQCTHGIRPVVSTQLLLNGSLAE(SEQIDNO:8) EnvCE9-2 VQCTHGIKPVVSTQLLLNGSLAE(SEQIDNO:9) EnvCE10-1 SGGDPEIVMHSFNCGGEFFYC(SEQIDNO:10) EnvCE10-2 AGGDLEITTHSFNCRGEFFYC(SEQIDNO:11) EnvCE11-1 DNWRSELYKYKVV(SEQIDNO:12) EnvCE11-2 NNWRSELYKYKVV(SEQIDNO:13) EnvCE12-1 ARRRVVQREKRA(SEQIDNO:14) EnvCE12-2 AKRRVVEREKRA(SEQIDNO:15) EnvCE13-1 GFLGTAGSTMGAAS(SEQIDNO:16) EnvCE13-2 GFLGAAGSTMGAAS(SEQIDNO:17) EnvCE14-1 LTVQARLLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQAR(SEQIDNO:18) EnvCE14-2 LTVQARQLLSGIVQQQSNLLKAIEAQQHMLQLTVWGIKQLQTR(SEQIDNO:19) EnvCE15-1 WLWYIKIFIMIVGGLVGLRI(SEQIDNO:20) EnvCE15-2 WLWYIRIFIMIVGGLIGLRI(SEQIDNO:21) EnvCE16-1 RVRKGYSPLSLQT(SEQIDNO:22) EnvCE16-2 RVRQGYSPLSFQT(SEQIDNO:23) AlternativeEnvCE: EnvCE17-1 PIPIHYCAPAGFAILKC(SEQIDNO:70) EnvCE17-2 PIPIHYCTPAGYAILKC(SEQIDNO:71) EnvCE18-1 NVSTVQCTHGIRPVVSTQLLLNGSLAE(SEQIDNO:72) envCE18-2 NVSSVQCTHGIKPVVSTQLLLNGSLAE(SEQIDNO:73) EnvCE19-1 GGDPEIVMHTFNCGGEFFYC(SEQIDNO:74) envCE19-2 GGDLEITTHSFNCRGEFFYC(SEQIDNO:75) EnvCE20-1 CRIKQIINMWQ(SEQIDNO:76) EnvCE20-2 CKIRQIVNRWQ(SEQIDNO:77) EnvCE21-1 GGDMRDNWRSELYKYKVV(SEQIDNO:78) EnvCE21-2 GGNMKDNWRSELYKYKVV(SEQIDNO:79) envCE22-1 LTVQARLLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARVLA(SEQIDNO:80) envCE22-2 LTVQARQLLSGIVQQQSNLLKAIEAQQHMLQLTVWGIKQLQTRVLA(SEQIDNO:81) EnvCE23-1 DQQLLGIWGCSGKLIC(SEQIDNO:82) EnvCE23-2 DQQLLGLWGCSGKLIC(SEQIDNO:83) EnvCE24-1 WLWYIKIFIMIVGGLVGLRI(SEQIDNO:84) EnvCE24-2 WLWYIRIFIMIVGGLIGLRI(SEQIDNO:85) SEQIDNO:24.Envconservedelement1immunogenicpolypeptide sequencecomprising12conservedelement:CE6,CE1-1,CE7-1, CE8-1,CE9-1,CE10-1,CE11-1,CE12-1,CE13-1,CE14-1,CE15-1, andCE16-1.Thelinkeraminoacidsbetweentheindividual conservedelementsareunderlined. WVTVYYGVPVWAAVHNVWATHACVPTDPAAEISLWDQSLKPCVKLTPLCVTLGAKFEPIPIH YCTPAGFAGAKVQCTHGIRPVVSTQLLLNGSLAEAADSGGDPEIVMHSFMCGGEFFYCGAKD NWRSELYKYKVVAAKARRRVVQREKRAGAVGFLGTAGSTMGAASVAVLTVQARLLLSGIVQQ QNNLLRAIEAQQHLLQLTVWGIKQLQARAADWLWYIKIFIMIVGGLVGLRIAAFRVRKGYSP LSLQT SEQIDNO:25.Envconservedelement2immunogenicpolypeptide sequencecomprising12conservedelement:CE6,CE1-2,CE7-2, CE8-2,CE9-2,CE10-2,CE11-2,CE12-2,CE13-2,CE14-2,CE15-2, andCE16-2.Thelinkeraminoacidsbetweentheindividual conservedelementsareunderlined. WVTVYYGVPVWAAVHNIWATHACVPTDFAAEISLWDESLKPCVKLTPLCVTLGAKFDPIPIH YCAPAGYAGAKVQCTHGIKPVVSTQLLLNGSLAEAADAGGDLEITTHSFNCRGEFFYCGAKN NWRSELYKYKVVAAKAKRRVVEREKRAGAVGFLGAAGSTMGAASVAVLTVQARQLLSGIVQQ QSNLLKAIEAQQHMLQLTVWGIKQLQTRAADWLWYIRIFIMIVGGLIGLRIAAFRVRQGYSP LSFQT SEQIDNO:69 FIG.25Env-CE1_V1V2-containingCEconstructaminoacidsequence MRVTEIRKSYQHWWRWGIMLLGILMICNAEEKLWVTVYYGVPVWKEATTTLFCAS DRKAYDTEVHNVWATHACVPTDPNPQEVELKNVTENFNMWKNNMVEQMHEDIISL WDQSLKPCVKLTPLCVTLNCTDLRNATNGNDTNTTSSSRGMVGGGEMKNCSFNIT TNIRGKVQKEYALFYKLDIAPIDNNSNNRYRLISCGAKFEPIPIHYCTPAGFAGA KVQCTHGIRPVVSTQLLLNGSLAEAADSGGDPEIVMHSFNCGGEFFYCGAKDNWR SELYKYKVVAAKARRRVVQREKRAGAVGFLGTAGSTMGAASVAVLTVQARLLLSG IVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARAADWLWYIKIFIMIVGGLVGLRI AAFRVRKGYSPLSLQT AlternativeEnvCEarrangements(EnvCEorder): EnvCE6,EnvCE1-1,EnvCE7-1,EnvCE17-1,EnvCE18-1,EnvCE19-1, EnvCE20-1,EnvCE21-1,EnvCE12-1,EnvCE13-1,EnvCE22-1,EnvCE23-1, EnvCE24-1,EnvCE16-1 and EnvCE6,EnvCE1-2,EnvCE7-2,EnvCE17-2,EnvCE18-2,EnvCE19-2, EnvCE20-2,EnvCE21-2,EnvCE12-2,EnvCE13-2,EnvCE22-2, EnvCE23-2,EnvCE24-2,EnvCE16-2
TABLE-US-00007 TABLE2 IllustrativeHIVGagconservedelementsequences: p24Gagconservedelementsforp24CE1vaccine (alsoreferredtoasp24CE1): SEQIDNO:26conservedelement1(CE1) ISPRTLNAWVKV SEQIDNO:27conservedelement2(CE2) VIPMFSALSEGATPQDLN SEQIDNO:28conservedelement3(CE3) VGGHQAAMQMLKDTINEEAAEWDR SEQIDNO:29conservedelement4(CE4) PRGSDIAGTTSTLQEQIGW SEQIDNO:30conservedelement5(CE5) KRWIILGLNKIVRMYSPTSI SEQIDNO:31conservedelement6(CE6) YVDRFYKTLRAEQA SEQIDNO:32conservedelement7(CE7) LEEMMTACQGVGGPGHK p24Gagconservedelementsforp24CE2vaccine (alsoreferredtoasp24CE2): SEQIDNO:33conservedelement1(CE1) LSPRTLNAWVKV SEQIDNO:34conservedelement2(CE2) VIPMFTALSEGATPQDLN SEQIDNO:35conservedelement3(CE3) VGGHQAAMQMLKETINEEAAEWDR SEQIDNO:36conservedelement4(CE4) PRGSDIAGTTSTLQEQIAW SEQIDNO:37conservedelement5(CE5) KRWIILGLNKIVRMYSPVSI SEQIDNO:38conservedelement6(CE6) YVDRFFKTLRAEQA SEQIDNO:39conservedelement7(CE7) LEEMMTACQGVGGPSHK SEQIDNO:40aminoacidsequenceofp24GagCE1polypeptide: VIPMFSALSEGATPQDLNAAVGGHQAAMQMLKDTINEEAAEWDRAAAEPRGSDIAG TTSTLQEQIGWAAAKRWIILGLNKIVRMYSPTSIAAKYVDRFYKTLRAEQAAGLEE MMTACQGVGGPGHKAAISPRTLNAWVKV SEQIDNO:41aminoacidsequenceofp24GagCE2polypeptide: VIPMFTALSEGATPQDLNAAVGGHQAAMQMLKETINEEAAEWDRAAAEPRGSDIAG TTSTLQEQTAWAAAKRWITLGLNKIVRMYSPVSIAAKYVDRFFKTLRAEQAAGLEE MMTACQGVGGPSHKAALSPRTLNAWVKV SEQIDNO:42polypeptidesequenceofp24CE1includinga GM-CSFsignalpeptide MWLQSLLLLGTVACSISVIPMFSALSEGATPQDLNAAVGGHQAAMQMLKDTINEEA AEWDRAAAEPRGSDIAGTTSTLQEQIGWAAAKRWIILGLNKIVRMYSPTSIAAKYV DRFYKTLRAEQAAGLEEMMTACQGVGGPGHKAAISPRTLNAWVKV SEQIDNO:43polypeptidesequenceofp24CE2includinga GM-CSFsignalpeptide MWLQSLLLLGTVACSISVIPMFTALSEGATPQDLNAAVGGHQAAMQMLKETINEEA AEWDRAAAEPRGSDIAGTTSTLQEQIAWAAAKRWIILGLNKIVRMYSPVSIAAKYV DRFFKTLRAEQAAGLEEMMTACQGVGGPSHKAALSPRTLNAWVKV SEQIDNO:44LAMP-p24CE1(p24CE1underlined) MAPRSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDT KSGPKNMTLDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSV QLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTL HDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNG TCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVL LFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEH VRVTKAFSVNIFKVWVQAFKVEGGQFGSVEECLLDENSLEDIVIPMFSALSEGATPQ DLNAAVGGHQAAMQMLKDTINEEAAEWDRAAAEPRGSDIAGTTSTLQEQIGWAAA KRWIILGLNKIVRMYSPTSIAAKYVDRFYKTLRAEQAAGLEEMMTACQGVGGPGHK AAISPRTLNAWVKVGSEFTLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI SEQIDNO:45LAMP-p24CE2fusion(p24CE2underlined) MAPRSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDT KSGPKNMTLDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSV QLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTL HDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNG TCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVL LFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEH VRVTKAFSVNIFKVWVQAFKVEGGQFGSVEECLLDENSLEDIVIPMFTALSEGATPQ DLNAAVGGHQAAMQMLKETINEEAAEWDRAAAEPRGSDIAGTTSTLGQEQIAWAAA KRWIILGLNKIVRMYSPVSIAAKYVDRFFKTLRAEQAAGLEEMMTACQGVGGPSHK AALSPRTLNAWVKVGSEFTLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI SEQIDNO:46SP-p24CE2(p24CE1underlined) MWLQSLLLLGTVACSISVIPMFTALSEGATPQDLNAAVGGHQAAMQMLKETINEEA AEWDRAAAEPRGSDIAGTTSTLQEQIAWAAAKRWIILGLNKIVRMYSPVSIAAKYVD RFFKTLRAEQAAGLEEMMTACQGVGGPSHKAALSPRTLNAWVKV SEQIDNO:47MCP3-p24CE1(p24CE1underlined) MWKPMPSPSNMKASAALLCLLLTAAAFSPQGLAQPVGINTSTTCCYRFINKKIPKQR LESYRRTTSSHCPREAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL VIPMFSALSEGATPQDLNAAVGGHQAAMQMLKDTINEEAAEWDRAAAEPRGSDIAG TTSTLQEQIGWAAAKRWIILGLNKIVRMYSPTSIAAKYVDRFYKTLRAEQAAGLEEM MTACQGVGGPGHKAAISPRTLNAWVKV SEQIDNO:48MCP3-p24CE2(p24CE2isunderlined) MWKPMPSPSNMKASAALLCLLLTAAAFSPQGLAQPVGINTSTTCCYRFINKKIPKQR LESYRRTTSSHCPREAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL VIPMFTALSEGATPQDLNAAVGGHQAAMQMLKETINEEAAEWDRAAAEPRGSDIAG TTSTLQEQIAWAAAKRWIILGLNKIVRMYSPVSIAAKYVDRFFKTLRAEQAAGLEEM MTACQGVGGPSHKAALSPRTLNAWVKV SEQIDNO:49SP-p24CE1c(p24CE1cunderlined)alternative CEpolypeptide.IncludesGM-CSFsignalpeptide,CE1andCE2 replacedbyCE8andCE9,respectively(relativetop24CE Core1);lacksCE7;arrangedintheconfigurationof conservedelements:CE8-9-3-4-5-6 MWLQSLLLLGTVACSISQGQMVHQAISPRTLNAWVKVLAKEEKAFSPEVIPMFSALS EGATPQDLNAAKVGGHQAAMQMLKETINEEAAEWDRAAAEPRGSDIAGTTSTLQE QIGWAAAKRWIILGLNKIVRMYSPTSIAAKYVDRFYKTLRAEQADYKDDDDKL SEQIDNO:50Gagconservedelement8(CE8) QGQMVHQAISPRTLNAWVKV SEQIDNO:51Gagconservedelement9(CE9) EEKAFSPEVIPMFSALSEGATPQDLN SEQIDNO:52SP-p24CE2c-alternativeCEpolypeptpidep24CE2c underlined MWLQSLLLLGTVACSISQGQMVHQALSPRTLNAWVKVLAKEEKGFNPEVIPMFTAL SEGATPQDLNAAKVGGHQAAMQMLKDTINEEAAEWDRAAAEPRGSDIAGTTSTLQ EQIAWAAAKRWIILGLNKIVRMYSPVSIAAKYVDRFFKTLRAEQA SEQIDNO:53SP-p24CE2dalternativeCEpolypeptideconstruct; inorderCE9-3-4-5-6-8 MWLQSLLLLGTVACSISEEKGFNPEVIPMFTALSEGATPQDLNAAKVGGHQAAMQM LKDTINEEAAEWDRAAAEPRGSDIAGTTSTLQEQIAWAAAKRWIILGLNKIVRMYSP VSIAAKYVDRFFKTLRAEQAALQGQMVHQALSPRTLNAWVKV SEQIDNO:54SP-24CE1d-alternativeCEpolypeptideconstruction; inorderCE9-3-4-5-6-8 MWLQSLLLLGTVACSISEEKAFSPEVIPMFSALSEGATPQDLNAAKVGGHQAAMQM LKETINEEAAEWDRAAAEPRGSDIAGTTSTLQEQIGWAAAKRWIILGLNKIVRMYSP TSIAAKYVDRFYKTLRAEQAALQGQMVHQAISPRTLNAWVKV p24CE1dhas6CE(isidenticaltop24CE1cexceptfortheCE arrangementwithintheprotein) GM-CSFsignalpeptide CE1andC2replacedbyCE8andCE9respectively,lacksCE7and hastheCEarrangedintheconfigurationCE9-3-4-5-6-8 SEQIDNO:55Gagconservedelement8(CE8-variantforCE2constructs) QGQMVHQALSPRTLNAWVKV SEQIDNO:56Gagconservedelement9(CE9) EEKGENPEVIPMFTALSEGATPQDLN DifferencesbetweenCEforp24CEpolypeptidesandvariantp24CE polypeptidesisoneaminoacidperCEexceptCE9,whichdiffersby 3aminoacids AlternativeGagp24conservedelements. p24CE8-1QPISPRTLNAWVKV(SEQIDNO:57) p24CE8-2QALSPRTLNAWVKV(SEQIDNO:58) p24CE9-1EEKAFSPEVIPMFSALSEGATPQDLNTMLN(SEQIDNO:59) p24CE9-2EEKGFNPEVIPMFTALSEGATPQDLNMMLN(SEQIDNO:60) p24CE10-1PRGSDIAGTTSTLQEQIGWMT(SEQIDNO:61) p24CE10-2PRGSDIAGTTSTLQEQIAWMT(SEQIDNO:62) p24CE11-1SILDIRQGPKEPFRDYVDRF(SEQIDNO:63) p24CE11-2SILDIKQGPKEPFRDYVDRF(SEQIDNO:64) p24CE12-1QNSNPDCKTILKALG(SEQIDNO:65) p24CE12-2QNANPDCKTILKALG(SEQIDNO:66) p24CE13-1LEEMMTACQGVGGPGHKARILAEAM(SEQIDNO:67) p24CE13-2LEEMMTACQGVGGPSHKARVLAEAM(SEQIDNO:68) Alternativep24CEarrangements: P24CE8-1,p24CE9-1,p24CE3-1,p24CE10-1,p24CE5-1,p24CE11-1, p24CE6-1,p24CE12-1,p24CE13-1 P24CE8-2,p24CE9-2,p24CE3-2,p24CE10-2,p24CE5-2,p24CE11-2, p24CE6-2,p24CE12-2,p24CE13-2
TABLE-US-00008 TABLE 3 Accuracy of using mutation frequency or change in structural stability to predict viral infectivity in binary classification manner Predictor Sensitivity.sup.d Specificity.sup.e Precision.sup.f Accuracy.sup.g Mutation frequency.sup.a 59.5% 70.0% 67.10% 64.10% Stability of 72.34% 77.78% 77.30% 75.00% reference models.sup.b Composite Score.sup.c 80.00% 79.57% 78.16% 79.78% .sup.aMutations with a database frequency of 0.2% or less are predicted to result in non-infectious virus .sup.bMutants with structural stability higher than the reference models are predicted to result in non-infectious virus .sup.cMutants with a composite score (sum of ranks of frequency and stability scores) higher than 175 are predicted to result in non-infectious virus .sup.dSensitivity = (True positive)/(True positive + False negative) .sup.eSpecificity = (True negative)/(True negative + False positive) .sup.fPrecision = (True positive)/(True positive + False positive) .sup.gAccuracy = (True positive + True negative)/(True positive + True negative + False positive + False negative)
TABLE-US-00009 TABLE 4 Amino acid sites within HIV-1 CA prone to destabilizing mutations Solvent Site Consensus Structural element and location in accessibility Binding site of CA (HXB2) AA Frequency capsid hexamer and/or CTD dimer surface area (A.sup.2) inhibitors 2 ILE 0.98 -hairpin 10.22 None 8 GLY 0.99 -hairpin 40.98 None 20 LEU 0.99 Helix 1; capsid hexamerization 2.1 None (NTD-NTD) interface 23 TRP 0.99 Helix1 2.81 CAP-1, BD3, BM4 Inhibitor3 32 PHE 0.99 turn in loop region between 5.97 CAP-1; BD3, helix 1 and 2 BM4; Inhibitor3 Benzodiazepine series 33 36 VAL 0.97 Helix 2 0.65 I-XW-053; BD3 Inhibitor3 37 ILE 0.97 Helix 2 17.74 Inhibitor3 40 PHE 0.99 Helix 2 0 Inhibitor3 43 LEU 0.98 Helix 2; capsid hexamerization 13.74 None (NTD-NTD) interface 49 PRO 0.99 Helix 3 0 None 52 LEU 0.99 Helix 3 0.02 None 55 MET 0.99 Helix 3 0.69 None 56 LEU 0.99 Helix 3 12.75 Inhibitor3 {ref} 65 ALA 0.99 Helix 4 0 CAP-1; Inhibitor3; Benzodiazepine series 33 66 MET 0.99 Helix 4 13.09 Inhibitor3; PF- 3450074 69 LEU 0.99 Helix 4 2.91 Inhibitor3 73 ILE 0.99 Helix 4 13.8 PF-3450074; 80 TRP 0.99 Helix 4 40.65 Inhibitor 4 99 PRO 0.99 Loop between helix 4 and 5 8.6 None 101 GLY 0.99 Helix 5 0.1 None 104 ILE 0.99 Helix 5 0 None 106 GLY 0.99 turn in loop region between 18.65 None helix 5 and 6 109 SER 0.99 turn in loop region between 13.19 None helix 5 and 6 111 LEU 0.99 Helix 6 53.08 None 117 TRP 0.99 Helix 6 0.24 Inhibitor4; 126 VAL 0.99 Helix 7 0 None 133 TRP 0.99 Helix 7 10.88 None 134 ILE 0.99 Helix 7 0 Inhibitor3 138 LEU 0.98 Helix 7 0.66 Inhibitor3 141 ILE 0.99 Helix 7 0.22 CAP-1; Inhibitor3 142 VAL 0.99 Helix 7 0.84 Inhibitor3 144 MET 0.99 Helix 7 20.6 None 150 ILE 0.99 Linker region between NTD 23.25 CAC1; CP4 peptide and CTD; CTD dimerization interface 153 ILE 0.99 Linker region between NTD 11.75 None and CTD; CTD dimerization interface 161 PHE 0.99 Helix 8; MHR 6.88 None 165 VAL 0.99 Helix 8; MHR; capsid 0 I-XW-053; CAI- hexamerization (NTD-CTD) compound series; interface H8; NYAD peptides 168 PHE 0.99 Helix 8; MHR 0.12 I-XW-053; NYAD peptides 169 TYR 0.99 Helix 8; MHR; capsid 30.73 I-XW-053; CAI hexamerization (NTD-CTD) peptide; CAI- interface compound series; NYAD peptides 172 LEU 0.99 Helix 8; MHR; CTD 5.4 I-XW-053; CAC1, dimerization interface H8; NYAD peptides 189 LEU 0.99 Helix 9; CTD dimerization 24.94 CAC1 interface 198 CYS 0.99 Helix 10 12.6 CAC1 202 LEU 0.99 Helix 10 7.67 CAC1 205 LEU 0.98 Helix 10 77.49 None 206 GLY 0.99 turn in loop region between 28.12 None helix 10 and 11 211 LEU 0.99 Helix 11; capsid hexamerization 4.46 CAI-compound (NTD-CTD) interface series; CAC1; NYAD peptides; CP4 peptide