ANTI-GALECTIN-9 ANTIBODY AND USES THEREOF

20230054718 · 2023-02-23

Assignee

Inventors

Cpc classification

International classification

Abstract

The invention provides humanized monoclonal antibodies against Gal9, and method of using the antibodies to treat cancer, including combination therapy with antagonists of the PD-1/PD-L1 immune checkpoint.

Claims

1. An isolated monoclonal antibody, or an antigen-binding fragment thereof, wherein, said monoclonal antibody or antigen-binding fragment thereof is specific for Galectin-9, and wherein said monoclonal antibody comprises: (1a) a heavy chain variable region (HCVR), comprising a HCVR CDR1 sequence of SEQ ID NO: 2, a HCVR CDR2 sequence of SEQ ID NO: 4, and a HCVR CDR3 sequence of SEQ ID NO: 6; and, (1b) a light chain variable region (LCVR), comprising a LCVR CDR1 sequence of SEQ ID NO: 10, a LCVR CDR2 sequence of SEQ ID NO: 12, and a LCVR CDR3 sequence of SEQ ID NO: 14; or (2a) a heavy chain variable region (HCVR), comprising a HCVR CDR1 sequence of SEQ ID NO: 18, a HCVR CDR2 sequence of SEQ ID NO: 20, and a HCVR CDR3 sequence of SEQ ID NO: 22; and, (2b) a light chain variable region (LCVR), comprising a LCVR CDR1 sequence of SEQ ID NO: 26, a LCVR CDR2 sequence of SEQ ID NO: 28, and a LCVR CDR3 sequence of SEQ ID NO: 30; or (3a) a heavy chain variable region (HCVR), comprising a HCVR CDR1 sequence of SEQ ID NO: 34, a HCVR CDR2 sequence of SEQ ID NO: 36, and a HCVR CDR3 sequence of SEQ ID NO: 38; and, (3b) a light chain variable region (LCVR), comprising a LCVR CDR1 sequence of SEQ ID NO: 42, a LCVR CDR2 sequence of SEQ ID NO: 44, and a LCVR CDR3 sequence of SEQ ID NO: 46; or (4a) a heavy chain variable region (HCVR), comprising a HCVR CDR1 sequence of SEQ ID NO: 50, a HCVR CDR2 sequence of SEQ ID NO: 52, and a HCVR CDR3 sequence of SEQ ID NO: 54; and, (4b) a light chain variable region (LCVR), comprising a LCVR CDR1 sequence of SEQ ID NO: 58, a LCVR CDR2 sequence of SEQ ID NO: 60, and a LCVR CDR3 sequence of SEQ ID NO: 62; or (5a) a heavy chain variable region (HCVR), comprising a HCVR CDR1 sequence of SEQ ID NO: 66, a HCVR CDR2 sequence of SEQ ID NO: 68, and a HCVR CDR3 sequence of SEQ ID NO: 70; and, (5b) a light chain variable region (LCVR), comprising a LCVR CDR1 sequence of SEQ ID NO: 74, a LCVR CDR2 sequence of SEQ ID NO: 76, and a LCVR CDR3 sequence of SEQ ID NO: 78; or (6a) a heavy chain variable region (HCVR), comprising a HCVR CDR1 sequence of SEQ ID NO: 82, a HCVR CDR2 sequence of SEQ ID NO: 84, and a HCVR CDR3 sequence of SEQ ID NO: 86; and, (6b) a light chain variable region (LCVR), comprising a LCVR CDR1 sequence of SEQ ID NO: 90, a LCVR CDR2 sequence of SEQ ID NO: 92, and a LCVR CDR3 sequence of SEQ ID NO: 94; or (7a) a heavy chain variable region (HCVR), comprising a HCVR CDR1 sequence of SEQ ID NO: 98, a HCVR CDR2 sequence of SEQ ID NO: 100, and a HCVR CDR3 sequence of SEQ ID NO: 102; and, (7b) a light chain variable region (LCVR), comprising a LCVR CDR1 sequence of SEQ ID NO: 106, a LCVR CDR2 sequence of SEQ ID NO: 108, and a LCVR CDR3 sequence of SEQ ID NO: 110; or (8a) a heavy chain variable region (HCVR), comprising a HCVR CDR1 sequence of SEQ ID NO: 114, a HCVR CDR2 sequence of SEQ ID NO: 116, and a HCVR CDR3 sequence of SEQ ID NO: 118; and, (8b) a light chain variable region (LCVR), comprising a LCVR CDR1 sequence of SEQ ID NO: 122, a LCVR CDR2 sequence of SEQ ID NO: 124, and a LCVR CDR3 sequence of SEQ ID NO: 128.

2. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, wherein: (1c) the antibody or antigen-binding fragment thereof of (1a) and (1b) further comprises a HFR3 sequence of SEQ ID NO: 5, and optionally further comprises a HFR1 sequence of SEQ ID NO: 1; or (2c) the antibody or antigen-binding fragment thereof of (2a) and (2b) further comprises a HFR3 sequence of SEQ ID NO: 21, and optionally further comprises a HFR1 sequence of SEQ ID NO: 17; or (3c) the antibody or antigen-binding fragment thereof of (3a) and (3b) further comprises a HFR3 sequence of SEQ ID NO: 37, and optionally further comprises a HFR1 sequence of SEQ ID NO: 33; or (4c) the antibody or antigen-binding fragment thereof of (4a) and (4b) further comprises a HFR3 sequence of SEQ ID NO: 53, and optionally further comprises a HFR1 sequence of SEQ ID NO: 49; or (5c) the antibody or antigen-binding fragment thereof of (5a) and (5b) further comprises a HFR3 sequence of SEQ ID NO: 69, and optionally further comprises a HFR1 sequence of SEQ ID NO: 65; or (6c) the antibody or antigen-binding fragment thereof of (6a) and (6b) further comprises a HFR3 sequence of SEQ ID NO: 85, and optionally further comprises a HFR1 sequence of SEQ ID NO: 81; or (7c) the antibody or antigen-binding fragment thereof of (7a) and (7b) further comprises a HFR3 sequence of SEQ ID NO: 101, and optionally further comprises a HFR1 sequence of SEQ ID NO: 97; or (8c) the antibody or antigen-binding fragment thereof of (8a) and (8b) further comprises a HFR3 sequence of SEQ ID NO: 117, and optionally further comprises a HFR1 sequence of SEQ ID NO: 113.

3. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, wherein: (1A) the HCVR sequence is SEQ ID NO: 8; and/or, (1B) the LCVR sequence is SEQ ID NO: 16, or, (2A) the HCVR sequence is SEQ ID NO: 24; and/or, (2B) the LCVR sequence is SEQ ID NO: 32, or, (3A) the HCVR sequence is SEQ ID NO: 40; and/or, (3B) the LCVR sequence is SEQ ID NO: 48, or, (4A) the HCVR sequence is SEQ ID NO: 56; and/or, (4B) the LCVR sequence is SEQ ID NO: 64, or, (5A) the HCVR sequence is SEQ ID NO: 72; and/or, (5B) the LCVR sequence is SEQ ID NO: 80, or, (6A) the HCVR sequence is SEQ ID NO: 88; and/or, (6B) the LCVR sequence is SEQ ID NO: 96, or (7A) the HCVR sequence is SEQ ID NO: 104; and/or, (7B) the LCVR sequence is SEQ ID NO: 112, or (8A) the HCVR sequence is SEQ ID NO: 120; and/or, (8B) the LCVR sequence is SEQ ID NO: 128.

4. The isolated monoclonal antibody or antigen-binding fragment thereof according to claim 1, which is a humanized antibody, and comprises: (1) the HCVR sequence of SEQ ID NO: 8 and the LCVR sequence of SEQ ID NO: 16; or, (2) the HCVR sequence of SEQ ID NO: 72 and the LCVR sequence of SEQ ID NO: 80.

5. The isolated monoclonal antibody or antigen-binding fragment thereof according to claim 1, wherein said antigen-binding fragment thereof is an Fab, Fab′, F(ab′)2, Fd, single chain Fv or scFv, disulfide linked Fv, V-NAR domain, IgNar, intrabody, IgGΔCH2, minibody, F(ab′)3, tetrabody, triabody, diabody, single-domain antibody, DVD-Ig, Fcab, mAb2, (scFv)2, or scFv-Fc.

6. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, wherein said monoclonal antibody or antigen-binding fragment thereof cross-reacts with mouse Gal9.

7. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, wherein said monoclonal antibody or antigen-binding fragment thereof binds to human Gal9 with an EC50 of about 0.1-0.2 nM, and/or binds to mouse Gal9 with an EC50 of about 0.5-1.0 nM.

8. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, wherein said monoclonal antibody or antigen-binding fragment thereof binds human Gal9 with a Kd of less than about 25 nM, 20 nM, 15 nM, 10 nM, 5 nM, 2 nM, or 1 nM.

9. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, which binds to Gal9 and inhibits Gal9 binding to a Gal9 receptor (e.g., TIM3 or CD44).

10. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, which neutralizes Gal-9-induced Th1 apoptosis of T cells (such as CD4+ T cells).

11. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, which suppresses Gal9-induced Treg expansion.

12. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, which synergistically inhibits tumor growth in vivo and/or prolongs survival in a mouse with a xenograph tumor with an antagonist of an immune checkpoint.

13. The isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, wherein the antagonist of the immune checkpoint is an antibody or antigen-binding fragment thereof specific for PD-1 or PD-L1.

14. A method of treating cancer in a patient in need thereof, the method comprising administering to the patient an effective amount of the isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, and an antagonist of an immune checkpoint.

15. The method of claim 14, wherein the immune checkpoint is PD-1/PD-L1 immune checkpoint, and optionally wherein the antagonist of the immune checkpoint is an antibody or antigen-binding fragment thereof specific for PD-1 or PD-L1; a peptide inhibitor of PD-1/PD-L1; a small molecule inhibitor of PD-L1; a macrocyclic peptide; or any combination thereof.

16. The method of claim 1, wherein the cancer is a hematological cancer (such as AML and DLBCL), or a solid tumor (such as breast cancer, head and neck cancer, lung cancer, melanoma (including uveal melanoma), colon cancer, renal carcinoma, ovarian cancer, liver cancer, and prostate cancer).

17. The method of claim 1, further comprising administering to the patient a chemotherapeutic agent, an anti-angiogenesis agent, a growth inhibitory agent, an immune-oncology agent, and/or an anti-neoplastic composition.

18. A polynucleotide encoding the heavy chain or the light chain or the antigen-binding portion thereof of the isolated monoclonal antibody of claim 1.

19. The polynucleotide of claim 18, which is codon optimized for expression in a human cell.

20. A vector comprising the polynucleotide of claim 18, wherein the vector is an expression vector selected from (a mammalian expression vector, a yeast expression vector, an insect expression vector, or a bacterial expression vector).

21. A method of rescuing or promoting effector T cells proliferation and/or enhancing effector T cell activity in a patient diagnosed with cancer, in risk of developing cancer or having cancer relapse, or a method of identifying and treating a patient having cancer, the method comprising: administering to the patient an effective amount of the isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, upon identifying the patient as having a level of Galectin-9 in a sample from the patient higher than a reference level of Galectin-9 in a healthy or a control individual.

22. The method of claim 21, further comprising identifying the patient as having the level of Galectin-9 in the sample higher than the reference level, by comparing the level of Galectin-9 in the sample to the reference level.

23. The method of claim 21, further comprising administering to the patient an antagonist of an immune checkpoint, and optionally wherein the immune checkpoint is PD-1/PD-L1 immune checkpoint.

24. The method of claim 23, wherein the antagonist of the immune checkpoint is an antibody or antigen-binding fragment thereof specific for PD-1 or PD-L1; a (non-antibody) peptide inhibitor of PD-1/PD-L1; a small molecule inhibitor of PD-L1; a macrocyclic peptide; or any combination thereof.

25. The method of claim 21, wherein the cancer is a hematological cancer (such as AML and DLBCL), or a solid tumor (such as breast cancer, head and neck cancer, lung cancer, melanoma (including uveal melanoma), colon cancer, renal carcinoma, ovarian cancer, liver cancer, and prostate cancer).

26. The method of claim 25, wherein the patient is an FAB M0, M1, M4 or M5 AML patient, or wherein the patient is not an FAB M2 or M3 AML patient.

27. The method of claim 21, wherein the sample is a blood sample, a plasma sample, or a serum sample.

28. A method of rescuing or promoting effector T cells proliferation and/or enhancing effector T cell activity in a patient diagnosed with AML, in risk of developing AML or having AML relapse, or a method of identifying and treating a patient having AML, the method comprising: administering to the patient an effective amount of the isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, upon identifying the patient as having a level of Galectin-9-encoding mRNA in a bone-marrow (BM)-derived mononuclear cell (MNC) sample from the patient statistically significantly higher or lower than a reference level in BM-derived MNC or CD34+ cells in a healthy or a control individual.

29. The method of claim 28, wherein (1) the level of Galectin-9-encoding mRNA in the BM-derived MNC sample from the patient is significantly higher than the reference level when the patient is an FAB M0, M1, M2, M4, or M5 AML patient, or (2) the level of Galectin-9-encoding mRNA in the BM-derived MNC sample from the patient is significantly lower than the reference level when the patient is an FAB M3 AML patient.

30. An antibody, or an antigen-binding portion thereof, directed against or specific for Galectin-9, for use in the treatment of cancer, wherein said antibody or antigen-binding portion thereof rescues effector T cell proliferation, and/or enhances effector T cell activity, and optionally wherein the effector T cell is a Th1 cell.

31. A method of rescuing or promoting effector T cell proliferation, and/or enhancing effector T cell activity, comprising contacting said effector T cell with the isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, and optionally wherein the effector T cell is a Th1 cell.

32. A method of inducing or promoting immune memory in a subject, comprising administering to the subject an effective amount of a composition comprising the isolated monoclonal antibody or antigen-binding fragment thereof of claim 1, wherein the immune memory is effective in inhibiting or reducing tumor progression or recurrence, or cancer cell proliferation in the subject.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0065] FIG. 1 shows a sequence alignment of various anti-human Galectin-9 humanized antibodies.

[0066] FIG. 2 shows a sequence alignment of various anti-human Galectin-9 humanized antibodies.

[0067] FIG. 3 shows binding affinity (measured as EC.sub.50 in nM) of the various anti-human Galectin-9 humanized antibodies towards recombinant human Gal-9. An isotype matched antibody against a different antigen is used as a negative control. In one case, the original human-mouse chimeric antobody is also included for comparison.

[0068] FIG. 4 shows binding affinity (measured as EC.sub.50 in nM) of the various anti-human Galectin-9 humanized antibodies towards recombinant mouse Gal-9. An isotype matched antibody against a different antigen is used as a negative control. In one case, the original human-mouse chimeric antobody is also included for comparison.

[0069] FIG. 5 shows that the various anti-human Galectin-9 humanized antibodies of the invention can block binding to TIM3 and CDC44.

[0070] FIG. 6 shows the ability of the various anti-human Galectin-9 humanized antibodies of the invention to neutralize Gal-9-induced Th1 cell apoptosis.

[0071] FIG. 7 shows the ability of the various anti-human Galectin-9 humanized antibodies of the invention to neutralize Gal-9-induced Tregs expansion.

[0072] FIG. 8 shows the ability of the various anti-human Galectin-9 humanized antibodies of the invention to promote long term survival when used in combination with anti-PD1 antibodies. The data demonstrates that combination therapy with anti-PD1 antibodies led to significantly better synergistic therapeutic efficacy as measured by inhibition of tumor volume increase.

[0073] FIG. 9 shows the ability of the various anti-human Galectin-9 humanized antibodies of the invention to promote long term survival when used in combination with anti-PD1 antibodies. The data demonstrates that combination therapy with anti-PD1 antibodies led to significantly better/synergistic therapeutic efficacy as measured by survival over time.

[0074] FIG. 10 shows the levels of Galectin-9 in serum or plasma from AML pateients and healthy individuals. The data demonstrates that Galectin-9 levels in plasma from AML pateints at diagnosis or relapse/refractory (R/R) stages were significantly higher than in plasma from healthy patients and AML patients at complete remission post chemotherapy treatment.

[0075] FIG. 11 shows levels of Galectin-9 in plasma or serum from AML patients stratified according to the French-American-British (FAB) classification. The data shows Galectin-9 protein levels in plasma of FAB M2 or FAB M3 AML patients at diagnosis were significantly lower than those observed in plasma from FAB M0, M1, M4 or M5 AML patients. Galectin-9 protein levels in plasma of FAB M3 AML patients at diagnosis were within the normal, physiological range.

[0076] FIG. 12 shows levels of Galectin-9-encoding mRNA (LGALS9) in bone-marrow (BM)-dervided mononuclear cells (MNC) from AML patients stratified according to the French-American-British (FAB) classification, or from healthy individuals. The data demonstrates that Galectin-9-encoding mRNA levels in BM-derived MNC from AML patients at diagnosis (all FAB considered) were higher than those observed in BM-derived MNC or CD34.sup.+ cells from healthy individuals. Galectin-9-encoding mRNA levels in BM-derived MNC from FAB M3 AML patients at diagnosis were significantly lower than those observed in BM-derived. MNC from FAB M0, M1, M4 or M5 AML patients or from 13M-derived MNC or CD34.sup.+ cells from healthy individuals.

[0077] FIG. 13 shows anti-tumor activity of an antibody of the invention as a monotherapy. This experiment demonstrates that the anti-Gal9 monoclonal antibodies of the invention are effective in inhibiting tumor growth in vivo in a xenograph mouse model. In particular, about half million cancer cells were inoculated into experimental mice and the tumor mass was allowed to grow to a pre-determined size. Mice were then randomized and injected intraperitoneally (i.p.) with one of two antibodies: (1.) IgG isotype control at a dose of 10 mg/kg, (2) anti-Gal9 antibody HFB9-2 at a dose of 10 mg/kg. The first dose of the antibodies far the various groups were administered on Day 1, and subsequent doses were administered every 3 days, for eight doses in total for any groups with anti-HFB9-2 antibody and the control antibody. Data are presented as mean±s.e.m., (n=10 mice per group). It is apparent that the subject anti-Gal9 antibody exhibited inhibitory effect on tumor growth in vivo.

[0078] FIG. 14 further shows anti-tumor activity of an antibody of the invention as a monotherapy in terms of survival: all mice in the control group died, and 40% of the mice (4 out of 10) in the HFB9-2 treatment group survived tumor-free at the end of week 6.

[0079] FIG. 15 shows immune memory of the anti-tumor activity of an antibody of the invention. After the first tumor inoculation/challenge, naïve animals developed tumors with 2 out of the 4 animals reaching tumor volume of 3000 mm.sup.3 humane endpoint in 31 days. Four animals with complete tumor regression, previously treated and cured by HFB9-2, an antibody of the invention, completely rejected a second Wehi-164 tumor challenge inoculated 63 days after the first tumor challenge. These data suggest long-term immune memories induced by HFB9-2 treatment.

DETAILED DESCRIPTION OF THE INVENTION

1. Overview

[0080] Although monoclonal antibodies targeting immune checkpoints have demonstrated clinical success in a range of tumor types, sustained responses are only observed in a fraction of patients due to primary or secondary resistance to treatment.

[0081] Applicant believes Galectin 9 (Gal-9) is a key factor present in the tumor microenvironment that renders tumors resistant to current immunotherapies. Among other evidence, high Gal-9 expression has been reported in different types of cancers, including hematological malignancies such as AML and ALL, and multiple solid tumors.

[0082] The invention described herein provides antibodies targeting Gal-9 that overcome resistance and improve clinical response in at least a subset of cancer patients. The monoclonal antibodies of the invention specifically binds to human Gal-9 with sub-nanomolar affinity, recognizes recombinant Gal-9 and Gal-9 produced by human tumor cells, and is cross-reactive with mouse and monkey Gal-9 orthologs. They also block the interaction of Gal-9 with its receptors TIM3 and CD44 in a dose dependent manner. These two receptors have been described to mediate Gal-9-immunosuppressive signals in effector and regulatory T cells. Treatment of human PBMCs from healthy donors with the antibodies of the invention prevents Gal-9-induced Th1 cell apoptosis and suppresses the expansion of regulatory T cells.

[0083] Certain humanized version of the antibodies of the invention exhibit further favorable characteristics in terms of stability and pharmacokinetic (PK) profile, and are thus uniquely suitable for further development as a therapeutic antibody. Specifically, such humanized antibodies showed stability for at least 14 days at 40° C., as well as for several hours at low pH, and following several freeze-thaw cycles. Meanwhile, high plasma exposures following a single dose administration of 10 mg/kg to C5710.16 mice were observed for the humanized antibody.

[0084] The antibodies of the invention can be used to treat a number of cancers, such as AML. Gal-9 has been reported to play a dual role in AML, as both a self-renewal factor for leukemic stem cells, and a suppressor of anti-cancer immunity. Thus, antagonizing Gal-9 function by using the Gal-9 neutralizing antibodies of the invention represents an attractive therapeutic approach for treating AML.

[0085] Collectively, the data presented herein demonstrates that neutralization of Gal-9 with the antibody of the invention blocks key immunosuppressive mechanisms known to limit the efficacy of current immunotherapies.

[0086] Detailed aspects of the invention are described further and separately in the various sections below. However, it should be understood that any one embodiment of the invention, including embodiments described only in the examples or drawings, and embodiments described only under one section below, can be combined with any other embodiment(s) of the invention.

2. Definitions

[0087] The term “antibody,” in the broadest sense, encompasses various antibody structures, including but not limited, to monoclonal antibodies, polyclonal antibodies, and multispecific antibodies (e.g., bispecific antibodies). The term “antibody” may also broadly refers to a molecule comprising complementarily determining region (CDR) 1, CDR2, and CDR3 of a heavy chain and CDR1, CDR2, and CDR3 of a light chain, wherein the molecule is capable of binding to an antigen. The term “antibody” also includes, but is not limited to, chimeric antibodies, humanized antibodies, human antibodies, and antibodies of various species such as mouse, human, cynomolgus monkey, etc.

[0088] In a narrower sense, however, “antibody” refers to the various monoclonal antibodies, including chimeric monoclonal antibodies, humanized monoconal antibodies, and human monoclonal antibodies, particularly humanized monoclonal antibodies of the invention.

[0089] In some embodiments, an antibody comprises a heavy chain variable region (HCVR) and a light chain variable region (LCVR). In some embodiments, an antibody comprises at least one heavy chain (HC) comprising a heavy chain variable region and at least a portion of a heavy chain constant region, and at least one light chain (LC) comprising a light chain variable region and at least a portion of a light chain constant region. In some embodiments, an antibody comprises two heavy chains, wherein each heavy chain comprises a heavy chain variable region and at least a portion of a heavy chain constant region, and two light chains, wherein each light chain comprises a light chain variable region and at least a portion of a light chain constant region.

[0090] As used herein, a single-chain Fv (scFv), or any other antibody that comprises, for example, a single polypeptide chain comprising all six CDRs (three heavy chain CDRs and three light chain CDRs) is considered to have a heavy chain and a light chain. In some such embodiments, the heavy chain is the region of the antibody that comprises the three heavy chain CDRs and the light chain in the region of the antibody that comprises the three light chain CDRs.

[0091] The term “heavy chain variable region (HCVR)” as used herein refers to, at a minimum, a region comprising heavy chain CDR1 (CDR-H1), framework 2 (HFR2), CDR2 (CDR-H2), FR3 (HFR3), and CDR3 (CDR-H3). In some embodiments, a heavy chain variable region also comprises at least a portion (e.g., the whole) of an FR1 (HFR1), which is N-terminal to CDR-H1, and/or at least a portion (e.g., the whole) of an FR4 (HFR4), which is C-terminal to CDR-H3.

[0092] The term “heavy chain constant region” as used herein refers to a region comprising at least three heavy chain constant domains, CH1, C112, and C113. Non-limiting exemplary heavy chain constant regions include γ, δ, and α. Non-limiting exemplary heavy chain constant regions also include ε and μ. Each heavy constant region corresponds to an antibody isotype. For example, an antibody comprising a γ constant region is an IgG antibody, an antibody comprising a δ constant region is an IgD antibody, an antibody comprising an α constant region is an IgA antibody, an antibody comprising an ε constant region is an IgE antibody, and an antibody comprising an μ constant region is an IgM antibody.

[0093] Certain isotypes can be further subdivided into subclasses. For example, IgG antibodies include, but are not limited to, IgG1 (comprising a γ1 constant region), IgG2 (comprising a γ2 constant region), IgG3 (comprising a γ3 constant region), and IgG4 (comprising a γ4 constant region) antibodies; IgA antibodies include, but are not limited to, IgA1 (comprising an α1 constant region) and IgA2 (comprising an α2 constant region) antibodies; and IgM antibodies include, but are not limited to, IgM1 (comprising an μ1 constant region) and IgM2 (comprising an μ2 constant region).

[0094] The term “heavy chain” as used herein refers to a polypeptide comprising at least a heavy chain variable region, with or without a leader sequence. In some embodiments, a heavy chain comprises at least a portion of a heavy chain constant region. The term “full-length heavy chain” as used herein refers to a polypeptide comprising a heavy chain variable region and a heavy chain constant region, with or without a leader sequence, and with or without a C-terminal lysine.

[0095] The term “light chain variable region (LCVR)” as used herein refers to a region comprising light chain CDR1 (CDR-L1), framework (FR) 2 (LFR2), CDR2 (CDR-L2), FR3 (LFR3), and CDR3 (CDR-13). In some embodiments, a light chain variable region also comprises at least a portion (e.g., the whole) of an FR1 (LFR1) and/or at least a portion (e.g., the whole) of an FR4 (LFR4).

[0096] The term “light chain constant region” as used herein refers to a region comprising a light chain constant domain, C.sub.L. Non-limiting exemplary light chain constant regions include λ and κ.

[0097] The term “light chain” as used herein refers to a polypeptide comprising at least a light chain variable region, with or without a leader sequence. In some embodiments, a light chain comprises at least a portion of a light chain constant region. The term “full-length light chain” as used herein refers to a polypeptide comprising a light Chain variable region and a light chain constant region, with or without a leader sequence.

[0098] The term “antibody fragment” or “antigen binding portion” (of antibody) includes, but is not limited to, fragments that are capable of binding antigen, such as Fv, single-chain Fv (scFv), Fab, Fab′, and (Fab′).sub.2. In certain embodiments, an antibody fragment includes Fab, Fab′, F(ab′).sub.2, F.sub.d, single chain Fv or scFv, disulfide linked F.sub.v, V-NAR domain, IgNar, intrabody, IgGΔCH.sub.2, minibody, F(ab′).sub.3, tetrabody, triabody, diabody, single-domain antibody, DVD-Ig, Fcab, mAb.sub.2, (scFv).sub.2, or scFv-Fc.

[0099] The term “Fab” refers to an antibody fragment with a molecular mass of approximately 50,000 daltons, and has an activity of binding to the antigen. It comprises approximately half of the N-terminal side of the heavy chain and the whole of the light chain connected by a disulphide bridge. The Fab can be obtained in particular by treatment of immunoglobulin by a protease, papain.

[0100] The term “F(ab′).sub.2” designates a fragment of approximately 100,000 daltons and an activity of binding to the antigen. This fragment is slightly larger than two Fab fragments connected via a disulphide bridge in the hinge region. These fragments are obtained by treating an immunoglobulin with a protease, pepsin. The Fab fragment can be obtained from the (ab)2 fragment by cleaving of the disulphide bridge of the hinge region.

[0101] A single Fv chain “scFv” corresponds to a VH:VL polypeptide synthesised using the genes coding for the VL and VH domains and a sequence coding for a peptide intended to bind these domains. An scFv according to the invention includes the CDRs maintained in an appropriate conformation, for example using genetic recombination techniques.

[0102] The dimers of “scFv” correspond to two scFv molecules connected together by a peptide bond. This Fv chain is frequently the result of the expression of a fusion gene including the genes coding for VH and VL connected by a linker sequence coding a peptide. The human scFv fragment may include CDR regions that are maintained in an appropriate conformation, preferably by means of the use of genetic recombination techniques.

[0103] The “dsFv” fragment is a VH-VL heterodimer stabilised by a disulphide bridge; it may be divalent (dsFV.sub.2), Fragments of divalent Sc(Fv).sub.2 or multivalent antibodies may form spontaneously by the association of monovalent scFvs or be produced by connecting scFvs fragments by peptide binding sequences.

[0104] The Fc fragment is the support for the biological properties of the antibody, in particular its ability to be recognised by immunity effectors or to activate the complement, it consists of constant fragments of the heavy chains beyond the hinge region.

[0105] The term “diabodies” signifies small antibody fragments having two antigen fixing sites. These fragments comprise, in the same VH-VL polypeptide chain, a variable heavy chain domain VH connected to a variable light chain domain VL. Using a binding sequence that is too short to allow the matching of two domains of the same chain, the matching with two complementary domains of another chain necessarily occurs and thus two antigen fixing sites are created.

[0106] An “antibody that binds to the same epitope” as a reference antibody can be determined by an antibody competition assay. It refers to an antibody that blocks binding of the reference antibody to its antigen in a competition assay by 50% or more, and conversely, the reference antibody blocks binding of the antibody to its antigen in a competition assay by 50% or more. The term “compete” when used in the context of an antibody that compete for the same epitope means competition between antibodies is determined by an assay in which an antibody being tested prevents or inhibits specific binding of a reference antibody to a common antigen.

[0107] Numerous types of competitive binding assays can be used, for example: solid phase direct or indirect radioimmunoassay (RIA), solid phase direct or indirect enzyme immunoassay (EIA), sandwich competition assay (see. e.g., Stahli et al., 0.1983. Methods in Enzymology 9:242-253); solid phase direct biotin-avidin EIA (see, e.g., Kirkland et al., 1986, J. Immunol. 137:3614-3619); solid phase direct labeled assay; solid phase direct labeled sandwich assay (see, e.g., Harlow and Lane, 1988, Antibodies, A Laboratory Manual, Cold Spring Harbor Press); solid phase direct label RIA using I.sup.125 label (see, e.g., Morel et al., 1988, Molec, Immunol. 25:7-15); solid phase direct biotin-avidin EIA (see, e.g., Cheung, et al., 1990, Virology 176:546-552); and direct labeled RIA (Moldenhauer et al., 1990, Scand. J. Immunol.).

[0108] Typically, such an assay involves the use of purified antigen bound to a solid surface or cells bearing either of these, an unlabeled test antigen binding protein and a labeled reference antibody. Competitive inhibition is measured by determining the amount of label bound to the solid surface or cells in the presence of the test antibody. Usually the test antibody is present in excess. Antibodies identified by competition assay (competing antibodies) include antibodies binding to the same epitope as the reference antibodies and antibodies binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference antibody for steric hindrance to occur. In some embodiments, when a competing antibody is present in excess, it will inhibit specific binding of a reference antibody to a common antigen by at least 40%, 45%, 50%, 55%, 60%, 65%, 70% or 75%. In some instance, binding is inhibited by at least 80%, 85%, 90%, 95%, or 97% or more.

[0109] The term “antigen” refers to a molecule or a portion of a molecule capable of being bound by a selective binding agent, such as an antibody or immunologically functional fragment thereof, and additionally capable of being used in a mammal to produce antibodies capable of binding to that antigen. An antigen may possess one or more epitopes that are capable of interacting with antibodies.

[0110] The term “epitope” is the portion of an antigen molecule that is bound by a selective binding agent, such as an antibody or a fragment thereof. The term includes any determinant capable of specifically binding to an antibody. An epitope can be contiguous or non-contiguous (e.g., in a polypeptide, amino acid residues that are not contiguous to one another in the poly-peptide sequence but that within in context of the molecule are bound by the antigen binding protein). In some embodiments, epitopes may be mimetic in that they comprise a three dimensional structure that is similar to an epitope used to generate the antibody, yet comprise none or only some of the amino acid residues found in that epitope used to generate the antibody. Epitope determinants may include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl or sulfonyl groups, and may have specific three dimensional structural characteristics, and/or specific charge characteristics.

[0111] In some embodiments, an “epitope” is defined by the method used to determine it. For example, in some embodiments, an antibody binds to the same epitope as a reference antibody, if they bind to the same region of the antigen, as determined by hydrogen-deuterium exchange (HDX).

[0112] For example, the epitope sequence of the parent antibodies HFB9-1 and HFB9-2 is disclosed as SEQ ID NO: 9 in US 2017-0283499 A1 (incorporated herein by reference). This sequence corresponds to the P4 peptide and covers the end of the binding peptide and the start of the C-terminal part of Galectin-9, It exists in the three isoforms of Galectin-9 (e.g., amino acids 166 to 178 of the S isoform, amino acids 178 to 190 of the M isoform, amino acids 210 to 222 of the L isoform). The humanized antibodies of the invention can bind at least one, preferably all the isoforms of Galectin-9.

[0113] In certain embodiments, an antibody binds to the same epitope as a reference antibody if they bind to the same region of the antigen, as determined by X-ray crystallography.

[0114] A “chimeric antibody” as used herein refers to an antibody comprising at least one variable region from a first species (such as mouse, rat, cynomolgus monkey, etc.) and at least one constant region from a second species (such as human, cynomolgus monkey, chicken, etc.). In some embodiments, a chimeric antibody comprises at least one mouse variable region and at least one human constant region. In some embodiments, all of the variable regions of a chimeric antibody are from a first species and all of the constant regions of the chimeric antibody are from a second species.

[0115] A “humanized antibody” as used herein refers to an antibody in which at least one amino acid in a framework region of a non-human variable region (such as mouse, rat, cynomolgus monkey, chicken, etc.) has been replaced with the corresponding amino acid from a human variable region. In some embodiments, a humanized antibody comprises at least one human constant region or fragment thereof. In some embodiments, a humanized antibody fragment is an Fab, an say, a (Fab′).sub.2, etc.

[0116] A “CDR-grafted antibody” as used herein refers to a humanized antibody in which one or more complementarity determining regions (CDRs) of a first (non-human) species have been grafted onto the framework regions (FRs) of a second (human) species.

[0117] A “human antibody” as used herein refers to antibodies produced in humans, antibodies produced in non-human animals that comprise human immunoglobulin genes, such as XENOMOUSE, and antibodies selected using in vitro methods, such as phage display, wherein the antibody repertoire is based on a human immunoglobulin sequences.

[0118] A “host cell” refers to a cell that may be or has been a recipient of a vector or isolated polynucleotide. Host cells may be prokaryotic cells or eukaryotic cells. Exemplary eukaryotic cells include mammalian cells, such as primate or non-primate animal cells; fungal cells, such as yeast; plant cells; and insect cells. Non-limiting exemplary mammalian cells include, but are not limited to, NSO cells, PER.C6® cells (Crucell), and 293 and CHO cells, and their derivatives, such as 293-6E and D64.4 cells, respectively.

[0119] The term “isolated” as used herein refers to a molecule that has been separated from at least some of the components with which it is typically found in nature or has been separated from at least some of the components with which it is typically produced. For example, a polypeptide is referred to as “isolated” when it is separated from at least some of the components of the cell in which it was produced. Where a polypeptide is secreted by a cell after expression, physically separating the supernatant containing the polypeptide from the cell that produced it is considered to be “isolating” the polypeptide. Similarly, a polynucleotide is referred to as “isolated” when it is not part of the larger polynucleotide (such as, for example, genomic DNA or mitochondrial DNA, in the case of a DNA polynucleotide) in which it is typically found in nature, or is separated from at least some of the components of the cell in which it was produced, e.g., in the case of an RNA polynucleotide. Thus, a DNA polynucleotide that is contained in a vector inside a host cell may be referred to as “isolated” so long as that polynucleotide is not found in that vector in, nature.

[0120] The terms “subject” and “patient” are used interchangeably herein to refer to a mammal such as human. In some embodiments, methods of treating other non-human mammals, including, but not limited to, rodents, simians, felines, canines, equines, bovines, porcines, ovines, caprines, mammalian laboratory animals, mammalian farm animals, mammalian sport animals, and mammalian pets, are also provided. In some instances, a “subject” or “patient” refers to a (human) subject or patient in need of treatment for a disease or disorder.

[0121] The term “sample” or “patient sample” as used herein, refers to material that is obtained or derived from a subject of interest that contains a cellular and/or other molecular entity that is to be characterized and/or identified, for example based on physical, biochemical, chemical and/or physiological characteristics. For example, the phrase “disease sample” and variations thereof refers to any sample obtained from a subject of interest that would be expected or is known to contain the cellular and/or molecular entity that is to be characterized.

[0122] By “tissue or cell sample” is meant a collection of similar cells obtained from a tissue of a subject or patient. The source of the tissue or cell sample may be solid tissue as from a fresh, frozen and/or preserved organ or tissue sample or biopsy or aspirate; blood or any blood constituents; bodily fluids such as sputum, cerebral spinal fluid, amniotic fluid, peritoneal fluid, or interstitial fluid; cells from any time in gestation or development of the subject. The tissue sample may also be primary or cultured cells or cell lines. Optionally, the tissue or cell sample is obtained from a disease tissue/organ. The tissue sample may contain compounds which are not naturally intermixed with the tissue in nature such as preservatives, anticoagulants, buffers, fixatives, nutrients, antibiotics, or the like.

[0123] A “reference sample,” “reference cell,” or “reference tissue,” as used herein, refers to a sample, cell or tissue obtained from a source known, or believed, not to be afflicted with the disease or condition for which a method or composition of the invention is being used to identify. In one embodiment, a reference sample, reference cell or reference tissue is obtained from a healthy part of the body of the same subject or patient in whom a disease or condition is being identified using a composition or method of the invention. In one embodiment, a reference sample, reference cell or reference tissue is obtained from a healthy part of the body of at least one individual who is not the subject or patient in whom a disease or condition is being identified using a composition or method of the invention. In some embodiments, a reference sample, reference cell or reference tissue was previously obtained from a patient prior to developing a disease or condition or at an earlier stage of the disease or condition.

[0124] A “disorder” or “disease” is any condition that would benefit from treatment with one or more Gal-9 antagonists of the invention. This includes chronic and acute disorders or diseases including those pathological conditions that predispose the mammal to the disorder in question. Non-limiting examples of disorders to be treated herein include cancers.

[0125] An “illness associated with the suppressor activity of regulatory T lymphocytes” means any illness (not autoimmune) in which the suppressor activity of regulatory T lymphocytes plays a role, in particular by promoting the development or persistence of the illness. In particular, it has been demonstrated that the suppressor activity of regulatory T lymphocytes promotes the development of tumors. The invention therefore aims more particularly at cancers in which the suppressor activity of T lymphocytes plays a role.

[0126] The term “cancer” is used herein to refer to a group of cells that exhibit abnormally high levels of proliferation and growth. A cancer may be benign (also referred to as a benign tumor), pre-malignant, or malignant. Cancer cells may be solid cancer cells (i.e., forming solid tumors) or leukemic cancer cells. The term “cancer growth” is used herein to refer to proliferation or growth by a cell or cells that comprise a cancer that leads to a corresponding increase in the size or extent of the cancer.

[0127] Examples of cancer include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular nonlimiting examples of such cancers include squamous cell cancer, small-cell lung cancer, pituitary cancer, esophageal cancer, astrocytoma, soft tissue sarcoma, non-small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, renal cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, brain cancer, endometrial cancer, testis cancer, cholangiocarcinoma, gallbladder carcinoma, gastric cancer, melanoma, and various types of head and neck cancer.

[0128] The French-American-British (FAB) classification of acute myeloid leukemia (ALM) catergorizes ALM into different stages of the disease. FAB subtypes are shown in Table 1.

TABLE-US-00001 TABLE 1 FAB Classification FAB Subtype Description M0 Undifferentiated acute myeloblastic leukemia M1 Acute myeloblastic leukemia with minimal maturation M2 Acute myeloblastic leukemia with maturation M3 Acute promyelocytic leukemia (APL) M4 Acute myelomoncytic leukemia M5 Acute monocytic leukemia M6 Acute erythroblastic leukemia M7 Acure megakaryoblastic leukemia

[0129] In certain embodiments, cancer as used herein includes a hematological cancer (such as AML, and DLBCL), or a solid tumor (such as breast cancer, head and neck cancer, lung cancer, melanoma (including uveal melanoma), colon cancer, renal carcinoma, ovarian cancer, liver cancer, and prostate cancer).

[0130] A “chemotherapeutic agent” is a chemical compound that can be useful in the treatment of cancer. Examples of chemotherapeutic agents include, but are not limited to, alkylating agents such as thiotepa and CYTOXAN® cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analogue topotecan); bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues); cryptophycins (particularly eryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogues, KW-2189 and CB1-TM1); eleutherobin; pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranimnustine; antibiotics such as the enediyne antibiotics (e.g., calicheamicin, especially calicheamicin gammall and calicheamicin omegall (see, e.g., Agnew, Chem Intl. Ed. Engl, 33: 183-186 (1994)); dynemicin, including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antiobiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, ADRIAMYCIN® doxorubicin (including morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5 FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elfomithine; elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; phenamet; pirarubicin; losoxantrone; podophyllinic acid; 2-ethylhydrazide; procarbazine; PSK® polysaccharide complex (JHS Natural Products, Eugene, Oreg.); razoxane; rhizoxin; sizofiran; spirogermanium; tenuazonic acid; triaziquone; 2,2′,2″-trichlorotriethylamine; trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine); urethan; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside (“Ara-C”); cyclophosphamide; thiotepa; taxoids, e.g., TAXOL® paclitaxel (Bristol-Myers Squibb Oncology, Princeton, N.J.), ABRAXANE® Cremophor-free, albumin-engineered nanoparticle formulation of paclitaxel (American Pharmaceutical Partners, Schaumberg, Ill.), and TAXOTERE® doxetaxel (Rhone-Poulenc Rorer, Antony, France); chloranbucil; GEMZAR® gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin, oxaliplatin and carboplatin; vinblastine; platinum; etoposide (VP-16); ifosfamide; mitoxantrone; vincristine; NAVELBINE vinorelbine; novantrone; teniposide; edatrexate; daunomycin; aminopterin; xeloda; ibandronate; irinotecan (Camptosar, CPT-11) (including the treatment regimen of irinotecan with 5-FU and leucovorin); topoisomerase inhibitor RFS 2000; difluoromethylornithine (DMFO); retinoids such as retinoic acid; capecitabine; combretastatin; leucovorin (LV); oxaliplatin, including the oxaliplatin treatment regimen (FOLFOX); inhibitors of PKC-alpha, Raf, H-Ras, EGFR (e.g., erlotinib (TARCEVA®)) and VEGF-A that reduce cell proliferation and pharmaceutically acceptable salts, acids or derivatives of any of the above.

[0131] Further non-limiting exemplary chemotherapeutic agents include anti-hormonal agents that act to regulate or inhibit hormone action on cancers such as anti-estrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including NOLVADEX® tamoxifen), raloxifene, droloxifene, 4-hydroxy tamoxifen, trioxifene, keoxifene, LY117018, onapristone, and FARESTON® toremifene; aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)-imidazoles, aminoglutethimide, MEGASE® megestrol acetate, AROMASIN® exemestane, formestanie, fadrozole, RIVISOR® vorozole, FEMARA® letrozole, and ARIMIDEX® anastrozole; and anti-androgens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; as well as troxacitabine (a 1,3-dioxolane nucleoside cytosine analog); antisense oligonucleotides, particularly those which inhibit expression of genes in signaling pathways implicated in abherant cell proliferation, such as, for example, PKC-alpha, Ralf and H-Ras; ribozymes such as a VEGF expression inhibitor (e.g., ANGIOZYME® ribozyme) and a HER2 expression inhibitor; vaccines such as gene therapy vaccines, for example, ALLOVECTIN® vaccine, LEUVECTIN® vaccine, and VAXID® vaccine; PROLEUKIN® rIL-2; LURTOTECAN® topoisomerase 1 inhibitor; AIIARELIX® rmRH; and pharmaceutically acceptable salts, acids or derivatives of any of the above.

[0132] An “anti-angiogenesis agent” or “angiogenesis inhibitor” refers to a small molecular weight substance, a polynucleotide (including, e.g., an inhibitory RNA (RNAi or siRNA)), a polypeptide, an isolated protein, a recombinant protein, an antibody, or conjugates or fusion proteins thereof, that inhibits angiogenesis, vasculogenesis, or undesirable vascular permeability, either directly or indirectly. It should be understood that the anti-angiogenesis agent includes those agents that bind and block the angiogenic activity of the angiogenic factor or its receptor. For example, an anti-angiogenesis agent is an antibody or other antagonist to an angiogenic agent, e.g., antibodies to VEGF-A (e.g., bevacizumab (AVASTIN®)) or to the VEGF-A receptor (e.g., KUR receptor or Fit-1 receptor), anti-PDGFR inhibitors such as GLEEVEC® (Imatinib Mesylate), small molecules that block VEGF receptor signaling (e.g., PTK787/ZK2284, SU6668, SUTENT®/SU1 1248 (sunitinib malate), AMG706, or those described in, e.g., international patent application WO 2004/113304). Anti-angiogensis agents also include native angiogenesis inhibitors, e.g., angiostatin, endostatin, etc. See, e.g., Klagsbrun and D'Amore (1991) Annu. Rev. Physiol. 53:217-39; Streit and Detmar (2003) Oncogene 22:3172-3179 (e.g., Table 3 listing anti-angiogenic therapy in malignant melanoma); Ferrara & Alitalo (1999) Nature Medicine 5(12): 1359-1364; Tonini et al. (2003) Oncogene 22:6549-6556 (e.g., Table 2 listing known anti-angiogenic factors); and, Saw (2003) Int. J. Clin. Oncol. 8:200-206 (e.g., Table 1 listing anti-angiogenic agents used in clinical trials).

[0133] A “growth inhibitory agent” as used herein refers to a compound or composition that inhibits growth of a cell (such as a cell expressing VEGF) either in vitro or in vivo. Thus, the growth inhibitory agent may be one that significantly reduces the percentage of cells (such as a cell expressing VEGF) in S phase. Examples of growth inhibitory agents include, but are not limited to, agents that block cell cycle progression (at a place other than S phase), such as agents that induce G1 arrest and M-phase arrest. Classical M-phase blockers include the vincas (vincristine and vinblastine), taxanes, and topoisomerase II inhibitors such as doxorubicin, epirubicin, daunorubicin, etoposide, and bleomycin. Those agents that arrest G1 also spill over into S-phase arrest, for example, DNA alkylating agents such as tamoxifen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C. Further information can be found in Mendelsohn and Israel, eds., The Molecular Basis of Cancer, Chapter 1, entitled “Cell cycle regulation, oncogenes, and antineoplastic drugs” by Murakami et al. (W.B. Saunders, Philadelphia, 1995), e.g., p. 13. The taxanes (paclitaxel and docetaxel) are anticancer drugs both derived from the yew tree. Docetaxel (TAXOTERE®, Rhone-Poulenc Rorer), derived from the European yew, is a semisynthetic analogue of paclitaxel (TAXOL®, Bristol-Myers Squibb). Paclitaxel and docetaxel promote the assembly of microtubules from tubulin dimers and stabilize microtubules by preventing depolymerization, which results in the inhibition of mitosis in cells.

[0134] The term “anti-neoplastic composition” refers to a composition useful in treating cancer comprising at least one active therapeutic agent. Examples of therapeutic agents include, but are not limited to, e.g., chemotherapeutic agents, growth inhibitory agents, cytotoxic agents, agents used in radiation therapy, anti-angiogenesis agents, cancer immunotherapeutic agents (also referred to as immuno-oncology agents), apoptotic agents, anti-tubulin agents, and other-agents to treat cancer, such as anti-HER-2 antibodies, anti-CD20 antibodies, an epidermal growth factor receptor (EGFR) antagonist (e.g., a tyrosine kinase inhibitor), HFR1/EGFR inhibitor (e.g., erlotinib (TARCEVA®), platelet derived growth factor inhibitors (e.g., GLEEVEC® (Imatinib Mesylate)), a COX-2 inhibitor (e.g., celecoxib), interferons, CTLA4 inhibitors (e.g., anti-CTLA antibody ipilimumab (YERVOY®)), PD-1 inhibitors (e.g., anti-PD1 antibodies, BMS-936558), PDL1 inhibitors (e.g., anti-PDL1 antibodies, MPDL3280A), PDL2 inhibitors (e.g., anti-PDL2 antibodies). VISTA inhibitors (e.g., anti-VISTA antibodies), cytokines, antagonists (e.g., neutralizing antibodies) that bind to one or more of the following targets ErbB2, ErbB3, ErbB4, PDGFR-beta, BlyS, APRIL, BCMA, PD-1, PDL1, PDL2, CTLA4, VISTA, or VEGF receptor(s), TRAIL/Apo2, and other bioactive and organic chemical agents, etc. Combinations thereof are also included in the invention.

[0135] “Treatment” refers to therapeutic treatment, for example, wherein the object is to slow down (lessen) the targeted pathologic condition or disorder as well as, for example, wherein the object is to inhibit recurrence of the condition or disorder. “Treatment” covers any administration or application of a therapeutic for a disease (also referred to herein as a “disorder” or a “condition”) in a mammal, including a human, and includes inhibiting the disease or progression of the disease, inhibiting or slowing the disease or its progression, arresting its development, partially or fully relieving the disease, partially or fully relieving one or more symptoms of a disease, or restoring or repairing a lost, missing, or defective function; or stimulating an inefficient process. The term “treatment” also includes reducing the severity of any phenotypic characteristic and/or reducing the incidence, degree, or likelihood of that characteristic. Those in need of treatment include those already with the disorder as well as those at risk of recurrence of the disorder or those in whom a recurrence of the disorder is to be prevented or slowed down.

[0136] The term “effective amount” or “therapeutically effective amount” refers to an amount of a drug effective to treat a disease or disorder in a subject. In some embodiments, an effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result. A therapeutically effective amount of Gal9 antagonist of the invention may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the antagonist to elicit a desired response in the individual A therapeutically effective amount encompasses an amount in which any toxic or detrimental effects of Gal9 antagonist are outweighed by the therapeutically beneficial effects.

[0137] A “prophylactically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically, but not necessarily, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount would be less than the therapeutically effective amount.

[0138] A “pharmaceutically acceptable carrier” refers to a non-toxic solid, semisolid, or liquid filler, diluent, encapsulating material, formulation auxiliary, or carrier conventional in the art for use with a therapeutic agent that together comprise a “pharmaceutical composition” for administration to a subject. A pharmaceutically acceptable carrier is non-toxic to recipients at the dosages and concentrations employed and is compatible with other ingredients of the formulation. The pharmaceutically acceptable carrier is appropriate for the formulation employed. For example, if the therapeutic agent is to be administered orally, the carrier may be a gel capsule. If the therapeutic agent is to be administered subcutaneously, the carrier ideally is not irritable to the skin and does not cause injection site reaction.

[0139] An “article of manufacture” is any manufacture (e.g., a package or container) or kit comprising at least one reagent, e.g., a medicament for treatment of a disease or disorder, or a probe for specifically detecting a biomarker described herein. In some embodiments, the manufacture or kit is promoted, distributed, or sold as a unit for performing the methods described herein.

3. Methods of Treating Cancer

[0140] The invention described herein provides Gal9 antagonists (such as anti-Gal9 antibody) for use in methods of treating humans and other non-human mammals.

[0141] In a pathological situation, Tregs may cause an inappropriate immune suppression, which could, for example, promotes tumor growth. Tregs have been associated with reducing the anti-tumoral immune responses, in particular by inappropriately inhibiting the activity of the effector T lymphocytes, thus promoting the development of numerous cancer types.

[0142] During activation, Galectin-9 is directly expressed by the Tregs, while it is only very weakly expressed, or not at all, by the effector T lymphocytes. Thus, targeting Galectin-9 by, for example, using a Gal-9-specific antibody, could specifically inhibit the suppressor activity of the regulatory T lymphocytes without risking causing depletion of effector T lymphocytes. The antibodies according to the invention, directed against Galectin-9 and inhibiting the suppressor activity of regulatory T lymphocytes, can therefore be used in the treatment of disease or conditions associated with the suppressor activity of regulatory T lymphocytes, in particular the treatment of cancers.

[0143] In some embodiments, methods for treating or preventing a cancer are provided, comprising administering an effective amount of Gal9 antagonist to a subject in need of such treatment.

[0144] In some embodiments, methods of treating cancer are provided, wherein the methods comprise administering Gal9 antagonist to a subject with cancer.

[0145] In some embodiments, use of Gal9 antagonist for treating cancer is provided.

[0146] The cancers treatable by the method/use of the invention include those in which the regulatory T lymphocytes exert their suppressor activity, such as those cancers in which relatively large amount of the regulatory T lymphocytes are present in the tumoral tissue or in the circulation. Expansion of the regulatory T lymphocytes (which can be measured by frequency of Tregs) is generally correlated with an increase of Tregs activation. The frequency of the regulatory T lymphocytes can be assessed by any method known in the art, for example by a flow cytometry (FACS) analysis of the intra-tumoral lymphocytes or circulating lymphocytes, or by an immuno-histological staining of the tumoral tissue.

[0147] Non-limiting exemplary cancers that may be treated with Gal9 antagonists are provided herein, including carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular non-limiting examples of such cancers include melanoma, cervical cancer, squamous cell cancer, small-cell lung cancer, pituitary cancer, esophageal cancer, astrocytoma, soft tissue sarcoma, non-small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, renal cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, brain cancer, endometrial cancer, testis cancer, cholangiocarcinoma, gallbladder carcinoma, gastric cancer, melanoma, and various types of head and neck cancer.

[0148] In certain embodiment, the method/use of the invention can be used to treat cancers in which there are known high levels of regulatory T lymphocytes, and/or which cancers/tumors are clearly associated with poor prognosis, including: chronic myeloid leukaemia (CML), colon cancer, melanoma, cancer of the uterus, breast cancer, pancreatic cancer, gastric cancers, ovarian cancer, primary lymphoma of the central nervous system, multiple myelomas, prostate cancer, Hodgkin's lymphoma, or hepatocellular carcinoma.

[0149] In certain embodiment, the method/use of the invention can be used to treat cancers that produce large quantities of exosomes carrying Galectin-9 fulfilling an immune suppressor role. Non-limitative examples of such cancers include: viro-induced cancers, for example nasopharyngeal carcinomas associated with the EBV (Epstein-Barr virus) or hepatocellular carcinomas (CHCs) related to the HCV (hepatitis C virus) or HBV (hepatitis B virus).

[0150] In some embodiments, the cancer is a hematological cancer (such as AML and DLBCL), or a solid tumor (such as breast cancer, head and neck cancer, lung cancer, melanoma (including uveal melanoma), colon cancer, renal carcinoma, ovarian cancer, liver cancer, and prostate cancer).

[0151] In certain embodiment, the method/use of the invention can be used to treat recurrence of fibrosis resulting from hepatitis C, since it has also been demonstrated that increasing the frequency of the regulatory T lymphocytes is a factor predicting recurrence of such fibrosis.

[0152] In some embodiments, the Gal9 antagonist is an anti-Gal9 antibody, or simply “Gal9 antibody.”

[0153] In some embodiments, the Gal9 antagonist for treating cancer may be a non-antibody protein, such as a soluble version of the Gal9 protein or a portion thereof (e.g., the ECD) that inhibits the interaction between Gal9 and its ligand, optionally further comprising a fusion partner and in the form of a fusion molecule. Various exemplary Gal9 antagonists are described in more detail in the sections that follow.

[0154] In some embodiments, the Gal9 antagonist of the invention can be used alone, or alternatively used in combination with any other suitable compound known to be able to treat the disease or indication.

[0155] Thus according to a particular embodiment of the invention, an antibody directed against Galectin-9 and inhibiting the suppressor activity of regulatory T lymphocytes as previously defined is used in combination with a second therapeutic agent for treating a disease associated with the suppressor activity of regulatory T lymphocytes, for example an anticancer agent.

[0156] That is, when the use is the treatment of a cancer, the antibody can be used in combination with known therapies against cancer such as for example surgery, radiotherapy, chemotherapy or combinations thereof. For example, the antibody can be used in combination with an adoptive immunotherapy, consisting one or more injections of effector lymphocytes against tumoral antigens, in particular EBV antigens. According to some aspects, other anticancer agents used in combination with the antibody directed against Galectin-9 according to the invention for cancer therapy comprise anti-angiogenics. According to certain aspects, the antibody can be co-administered with a cytokine, for example a cytokine that stimulates an anti-tumoral immune response.

[0157] In such combination therapy, the antibody of the invention can be used before, after, or concurrently with the second therapeutic agent. See further section below concerning combination therapy.

4. Routes of Administration and Carriers

[0158] In various embodiments, Gal9 antagonists (e.g., Gal9 Ab) may be administered subcutaneously or intravenously. For simplicity, “Gal9 antagonist” here, in the narrow sense, refers to Gall antibody of the invention, e.g. the humanized Gal9 antibody of the invention.

[0159] In some embodiments, Gal9 antagonist may be administered in vivo by various mutes, including, but not limited to, oral, intra-arterial, parenteral, intranasal, intramuscular, intracardiac, intraventricular, intratracheal, buccal, rectal, intraperitoneal, by inhalation, intradermal, topical, transdermal, and intrathecal, or otherwise, e.g., by implantation.

[0160] In some embodiments, Gal9 antagonist is an anti-Gal9 antibody or antigen-binding fragment thereof, and is administered intravenously (i.v.) or subcutaneously (s.c.).

[0161] The subject compositions may be formulated into preparations in solid, semi-solid, liquid, or gaseous forms; including, but not limited to, tablets, capsules, powders, granules, ointments, solutions, suppositories, enemas, injections, inhalants, and aerosols.

[0162] In various embodiments, compositions comprising Gal9 antagonist are provided in formulations with a wide variety of pharmaceutically acceptable carriers (see, e.g., Gennaro, Remington: The Science and Practice of Pharmacy with Facts and Comparisons: Drugfacts Plus, 20th ed. (2003); Ansel et al., Pharmaceutical Dosage Forms and Drug Delivery Systems, 7th ed., Lippencott Williams and Wilkins (2004); Kibbe et al., Handbook of Pharmaceutical Excipients, 3rd ed., Pharmaceutical Press (2000)). Various pharmaceutically acceptable carriers, which include vehicles, adjuvants, and diluents, are available. Moreover, various pharmaceutically acceptable auxiliary substances, such as pH adjusting and buffering agents, tonicity adjusting agents, stabilizers, wetting agents and the like, are also available. Nonlimiting exemplary carriers include saline, buffered saline, dextrose, water, glycerol, ethanol, and combinations thereof.

[0163] In various embodiments, compositions comprising Gal9 antagonist may be formulated for injection, including subcutaneous administration, by dissolving, suspending, or emulsifying them in an aqueous or nonaqueous solvent, such as vegetable or other oils, synthetic aliphatic acid glycerides, esters of higher aliphatic acids, or propylene glycol; and if desired, with conventional additives such as solubilizers, isotonic agents, suspending agents, emulsifying agents, stabilizers and preservatives.

[0164] In various embodiments, the compositions may be formulated for inhalation, for example, using pressurized acceptable propellants such as dichlorodifiuoromethane, propane, nitrogen, and the like.

[0165] The compositions may also be formulated, in various embodiments, into sustained release microcapsules, such as with biodegradable or non-biodegradable polymers. A non-limiting exemplary biodegradable formulation includes poly lactic acid-glycolic acid (PLGA) polymer. A non-limiting exemplary non-biodegradable formulation includes a polyglycerin fatty acid ester. Certain methods of making such formulations are described, for example, in EP 1125584 A1.

[0166] Pharmaceutical dosage packs comprising one or more containers, each containing one or more doses of Gal9 antagonist, are also provided. In some embodiments, a unit dosage is provided wherein the unit dosage contains a predetermined amount of a composition comprising Gal9 antagonist, with or without one or more additional agents. In some embodiments, such a unit dosage is supplied in single-use prefilled syringe for injection. In various embodiments, the composition contained in the unit dosage may comprise saline, sucrose, or the like; a buffer, such as phosphate, or the like; and/or be formulated within a stable and effective pH range. Alternatively, in some embodiments, the composition may be provided as a lyophilized powder that may be reconstituted upon addition of an appropriate liquid, for example, sterile water. In some embodiments, the composition comprises one or more substances that inhibit protein aggregation, including, but not limited to, sucrose and arginine. In some embodiments, a composition of the invention comprises heparin and/or a proteoglycan.

[0167] Pharmaceutical compositions are administered in an amount effective for treatment or prophylaxis of the specific indication. The therapeutically effective amount is typically dependent on the weight of the subject being treated, his or her physical or health condition, the extensiveness of the condition to be treated, or the age of the subject being treated.

[0168] In some embodiments, Gal9 antagonist may be administered in an amount in the range of about 50 μg/kg body weight to about 50 mg/kg body weight per dose. In some embodiments, Gal9 antagonist may be administered in an amount in the range of about 100 μg/kg body weight to about 50 mg/kg body weight per dose. In some embodiments, Gal9 antagonist may be administered in an amount in the range of about 100 pp/kg body weight to about 20 mg/kg body weight per dose. In some embodiments, Gal9 antagonist may be administered in an amount in the range of about 0.5 mg/kg body weight to about 20 mg/kg body weight per dose.

[0169] In some embodiments, Gal9 antagonist may be administered in an amount in the range of about 10 mg to about 1,000 mg per dose. In some embodiments, Gal9 antagonist may be administered in an amount in the range of about 20 mg to about 500 mg per dose. In some embodiments, Gal9 antagonist may be administered in an amount in the range of about 20 mg to about 300 mg per dose. In some embodiments, Gal9 antagonist may be administered in an amount in the range of about 20 mg to about 200 mg per dose.

[0170] The Gal9 antagonist compositions may be administered as needed to subjects. In some embodiments, an effective dose of Gal9 antagonist is administered to a subject one or more times. In various embodiments, an effective dose of Gal9 antagonist is administered to the subject once a month, less than once a month, such as, for example, every two months, every three months, or every six months. In other embodiments, an effective dose of Gal9 antagonist is administered more than once a month, such as, for example, every two weeks, every week, twice per week, three times per week, daily, or multiple times per day. An effective dose of Gal9 antagonist is administered to the subject at least once. In some embodiments, the effective dose of Gal9 antagonist may be administered multiple times, including for periods of at least a month, at least six months, or at least a year. In some embodiments, Gal9 antagonist is administered to a subject as-needed to alleviate one or more symptoms of a condition.

5. Combination Therapy

[0171] Gal9 antagonists of the invention, including any antibodies and functional fragments thereof, may be administered to a subject in need thereof in combination with other biologically active substances or other treatment procedures for the treatment of diseases. For example, Gal9 antagonists may be administered alone or with other modes of treatment. They may be provided before, substantially contemporaneous with, or after other modes of treatment, such as radiation therapy.

[0172] For treatment of cancer, the Gal9 antagonist may be administered in conjunction with one or more of anti-cancer agents, such as the immune checkpoint inhibitor, chemotherapeutic agent, growth inhibitory agent, anti-angiogenesis agent or anti-neoplastic composition.

[0173] In certain embodiments, Gal9 antagonist specifically binds to Gal9 (a “Gal9-binding antagonist”), e.g., Gal9 antagonist antibody or antigen-binding fragment thereof, is administered with a second antagonist such as an immune checkpoint inhibitor (e.g., an inhibitor of the PD-1 or PD-L1 pathway), to a subject having a disease in which the stimulation of the immune system would be beneficial, e.g., cancer or infectious diseases. The two antagonists may be administered simultaneously or consecutively, e.g., as described below for the combination of Gal9 antagonist with an immuno-oncology agent. One or more additional therapeutics, e.g., checkpoint modulators may be added to a treatment with Gal9 binding antagonist for treating cancer or infectious diseases.

[0174] In certain embodiments, Gal9 antagonist is administered with another treatment, either simultaneously, or consecutively, to a subject, e.g., a subject having cancer. For example, Gal9 antagonist may be administered with one of more of: radiotherapy, surgery, or chemotherapy, e.g., targeted chemotherapy or immunotherapy.

[0175] Immunotherapy, e.g., cancer immuntherapy includes cancer vaccines and immuno-oncology agents. Gal9 antagonist may be, e.g., a protein, an antibody, antibody fragment or a small molecule, that binds to Gal9. Gal9 antagonist may be an antibody or antigen binding fragment thereof that specifically binds to Gal9.

[0176] In certain embodiments, a method of treatment of a subject having cancer comprises administering to the subject having the cancer Gal9 antagonist, e.g., Gal9 antibody, and one or more immuno-oncology agents, such as immune checkpoint inhibitor.

[0177] Immunotherapy, e.g., therapy with an immuno-oncology agent, is effective to enhance, stimulate, and/or upregulate immune responses in a subject. In one aspect, the administration of Gal9 antagonist with an immuno-oncology agent (such as a PD-1 inhibitor) has a synergic effect in the treatment of cancer, e.g., in inhibiting tumor growth.

[0178] In one aspect, Gal9 antagonist is sequentially administered prior to administration of the immuno-oncology agent. In one aspect, Gal9 antagonist is administered concurrently with the immunology-oncology agent (such as PD-1 inhibitor). In yet one aspect, Gal9 antagonist is sequentially administered after administration of the immuno-oncology agent (such as PD-1 inhibitor). The administration of the two agents may start at times that are, e.g., 30 minutes, 60 minutes, 90 minutes, 120 minutes, 3 hours, 6 hours, 12 hours, 24 hours, 36 hours, 48 hours, 3 days, 5 days, 7 days, or one or more weeks apart, or administration of the second agent may start, e.g., 30 minutes, 60 minutes, 90 minutes, 120 minutes, 3 hours, 6 hours, 12 hours, 24 hours, 36 hours, 48 hours, 3 days, 5 days, 7 days, or one or more weeks after the first agent has been administered.

[0179] In certain aspects, Gal9 antagonist and an immuno-oncology agent (e.g., PD-1 inhibitor) are administered simultaneously, e.g., are infused simultaneously, e.g., over a period of 30 or 60 minutes, to a patient. Gal9 antagonist may be co-formulated with an immuno-oncology agent (such as PD-1 inhibitor).

[0180] Immuno-oncology agents include, for example, a small molecule drug, antibody or fragment thereof, or other biologic or small molecule. Examples of biologic immuno-oncology agents include, but are not limited to, antibodies, antibody fragments, vaccines and cytokines. In one aspect, the antibody is a monoclonal antibody. In certain aspects, the monoclonal antibody is humanize/or human antibody.

[0181] In one aspect, the immuno-oncology agent is (i) an agonist of a stimulatory (including a co-stimulatory) molecule (e.g., receptor or ligand) or (ii) an antagonist of an inhibitory (including a co-inhibitory) molecule (e.g., receptor or ligand) on immune cells, e.g., T cells, both of which result in amplifying antigen-specific T cell responses. In certain aspects, an immuno-oncology agent is (i) an agonist of a stimulatory (including a co-stimulatory) molecule (e.g., receptor or ligand) or (ii) an antagonist of an inhibitory (including a co-inhibitory) molecule (e.g., receptor or ligand) on cells involved in innate immunity, e.g., NK cells, and wherein the immuno-oncology agent enhances innate immunity. Such immuno-oncology agents are often referred to as immune checkpoint regulators, e.g., immune checkpoint inhibitor or immune checkpoint stimulator.

[0182] In certain embodiments, the immuno-oncology agent may be an agent that targets (or binds specifically to) a member of the B7 family of membrane-bound ligands, which includes B7-1, B7-2, B7-H1 (PD-L1), B7-DC (PD-L2), B7-H2 (ICOS-L), B7-H3, B7-H4, B7-H5, and B7-H6, or a co-stimulatory or co-inhibitory receptor binding specifically to a B7 family member.

[0183] An immuno-oncology agent may be an agent that targets a member of the TNF family of membrane bound ligands or a co-stimulatory or co-inhibitory receptor binding specifically thereto, e.g., a TNF receptor family member. Exemplary TNF and TNFR family members that may be targeted by immuno-oncology agents include CD40 and CD40L, OX-40, OX-40L, GITR, GITRL, CD70, CD27L, CD30, CD30L, 4-1BBL, CD137 (4-1BB), TRAIL/Apo2-L, TRAILR1/DR4, TRAILR2/DR5, TRAILR3, TRAILR4, OPG, RANK, RANKL, TWEAKR/Fn14, TWEAK, BAFFR, EDAR, XEDAR, TACT, APRIL, BCMA, LTfiR, LIGHT, DcR3, HVEM, VEGI/TL1A, TRAMP/DR3, EDAR, EDA1, XEDAR, EDA2, TNFR1, Lymphotoxin α/TNPβ, TNFR2, TNFa, LTfiR, Lymphotoxin a 1β2, FAS, FASL, RELT, DR6, TROY and NGFR. An immuno-oncology agent that may be used in combination with Gal9 antagonist agent for treating cancer may be an agent, e.g., an antibody, targeting a B7 family member, a B7 receptor family member, a TNF family member or a TNFR family member, such as those described above.

[0184] In one aspect, Gal9 antagonist is administered with one or more of (i) an antagonist of a protein that inhibits T cell activation (e.g., immune checkpoint inhibitor) such as CTLA-4, PD-1, PD-L1, PD-L2, LAG-3, TIM3, CEACAM-1, BTLA, CD69, Galectin-1, TIGIT, CD113, GPR56, VISTA, B7-H3, B7-H4, 2B4, CD48, GARP, PDIH, LAIR1, TIM-1, TIM-4, and PSGL-1 and (ii) an agonist of a protein that stimulates T cell activation such as B7-1, B7-2, CD28, 4-1BB (CD137), 4-1 BBL, ICOS, ICOS-L, OX40, OX40L, G1TR, G1TRL, CD70, CD27, CD40, CD40L, DR3 and CD28H.

[0185] In one aspect, an immuno-oncology agent is an agent that inhibits (i.e., an antagonist of) a cytokine that inhibits T cell activation (e.g., IL-6, IL-10, TGF-β, VEGF, and other immunosuppressive cytokines) or is an agonist of a cytokine, such as IL-2, IL-7, IL-12, IL-15, IL-21 and IFNα (e.g., the cytokine itself) that stimulates T cell activation, and stimulates an immune response.

[0186] Other agents that can be combined with Gal9 antagonist for stimulating the immune system, e.g., for the treatment of cancer and infectious diseases, include antagonists of inhibitory receptors on NK cells or agonists of activating receptors on NK cells. For example, Anti-Gal9 antagonist can be combined with an antagonist of KIR.

[0187] Yet other agents for combination therapies include agents that inhibit or deplete macrophages or monocytes, including but not limited to CSF-IR antagonists such as CSF-IR antagonist antibodies including RG7155 (WO11/70024, WOI 1/107553, WO11/131407, WO13/87699, WO13/119716, WO13/132044) or FPA008 (WOI 1/140249; WO13169264; WO 14/036357).

[0188] Immuno-oncology agents also include agents that inhibit TGF-13 signaling.

[0189] Additional agents that may be combined with Gal9 antagonist include agents that enhance tumor antigen presentation, e.g., dendritic cell vaccines, GM-CSF secreting cellular vaccines, CpG oligonucleotides, and imiquimod, or therapies that enhance the immunogenicity of tumor cells (e.g., anthracyclines).

[0190] Yet other therapies that may be combined with Gal9 antagonist include therapies that deplete or block Treg cells, e.g., an agent that specifically binds to CD25.

[0191] Another therapy that may be combined with Gal9 antagonist is a therapy that inhibits a metabolic enzyme such as indoleamine dioxigenase (IDO), dioxigenase, arginase, or nitric oxide synthetase.

[0192] Another class of agents that may be used includes agents that inhibit the formation of adenosine or inhibit the adenosine A2A receptor.

[0193] Other therapies that may be combined with Gal9 antagonist for treating cancer include therapies that reverse/prevent T cell anergy or exhaustion and therapies that trigger an innate immune activation and/or inflammation at a tumor site.

[0194] Gal9 antagonist may be combined with more than one immuno-oncology agent (such as immune checkpoint inhibitor), and may be, e.g., combined with a combinatorial approach that targets multiple elements of the immune pathway, such as one or more of the following: a therapy that enhances tumor antigen presentation (e.g., dendritic cell vaccine, GM-CSF secreting cellular vaccines, CpG oligonucleotides, imiquimod); a therapy that inhibits negative immune regulation e.g., by inhibiting CTLA-4 and/or PD1/PD-L1/PD-L2 pathway and/or depleting or blocking Treg or other immune suppressing cells; a therapy that stimulates positive immune regulation, e.g., with agonists that stimulate the CD-137, OX-40 and/or GITR pathway and/or stimulate T cell effector function; a therapy that increases systemically the frequency of anti tumor T cells; a therapy that depletes or inhibits Tregs, such as Tregs in the tumor, e.g., using an antagonist of CD25 (e.g., daclizumab) or by ex vivo anti-CD25 bead depletion; a therapy that impacts the function of suppressor myeloid cells in the tumor, a therapy that enhances immunogenicity of tumor cells (e.g., anthracyclines); adoptive T cell or NK cell transfer including genetically modified cells, e.g., cells modified by chimeric antigen receptors (CAR-T therapy); a therapy that inhibits a metabolic enzyme such as indoleamine dioxigenase (IDO), dioxigenase, arginase or nitric oxide synthetase; a therapy that reverses/prevents T cell anergy or exhaustion; a therapy that triggers an innate immune activation and/or inflammation at a tumor site; administration of immune stimulatory cytokines or blocking of immuno repressive cytokines.

[0195] For example, Gal9 antagonist can be used with one or more agonistic agents that ligate positive costimulatory receptors; one or more antagonists (blocking agents) that attenuate signaling through inhibitory receptors, such as antagonists that overcome distinct immune suppressive pathways within the tumor microenvironment (e.g., block PD-L1/PD-1/PD-L2 interactions); one or more agents that increase systemically the frequency of anti-tumor immune cells, such as T cells, deplete or inhibit Tregs (e.g., by inhibiting CD25); one or more agents that inhibit metabolic enzymes such as IDO; one or more agents that reverse/prevent T cell anergy or exhaustion; and one or more agents that trigger innate immune activation and/or inflammation at tumor sites.

[0196] In one embodiment, a subject having a disease that may benefit from stimulation of the immune system, e.g., cancer or an infectious disease, is treated by administration to the subject of Gal9 antagonist and an immuno-oncology agent, wherein the immuno-oncology agent is a CTLA-4 antagonist, such as an antagonistic CTLA-4 antibody. Suitable CTLA-4 antibodies include, for example, YERVOY (ipilimumab) or tremelimumab.

[0197] In one embodiment, a subject having a disease that may benefit from stimulation of the immune system, e.g., cancer or an infectious disease, is treated by administration to the subject of Gal9 antagonist and an immuno-oncology agent, wherein the immuno-oncology agent is a PD-1 antagonist, such as an antagonistic PD-1 antibody. Suitable PD-1 antibodies include, for example, OPDIVO (nivolumab), KEYTRUDA (pembrolizumab), or MEDI-0680 (AMP-514; WO2012/145493). The immuno-oncology agent may also include pidilizumab (CT-011). Another approach to target the PD-1 receptor is the recombinant protein composed of the extracellular domain of PD-L2 (B7-DC) fused to the Fc portion of IgG, called AMP-224.

[0198] In one embodiment, a subject having a disease that may benefit from stimulation of the immune system, e.g., cancer or an infectious disease, is treated by administration to the subject of Gal9 antagonist and an immuno-oncology agent, wherein the immuno-oncology agent is a PD-L1 antagonist, such as an antagonistic PD-L1 antibody. Suitable PD-L1 antibodies include, for example, MPDL3280A (RG7446; WO2010/077634), durvalumab (MEDI4736), BMS-936559 (WO2007/005874), MSB0010718C (WO2013/79174) or rHigM12B7.

[0199] In one embodiment, a subject having a disease that may benefit from stimulation of the immune system, e.g., cancer or an infectious disease, is treated by administration to the subject of Gal9 antagonist and an immuno-oncology agent, wherein the immuno-oncology agent is a LAG-3 antagonist, such as an antagonistic LAG-3 antibody. Suitable LAG3 antibodies include, for example, BMS-986016 (WO1O/19570, WO 14/08218), or IMP-731 or IMP-321 (WO08/132601, WO09/44273).

[0200] In one embodiment, a subject having a disease that may benefit from stimulation of the immune system, e.g., cancer or an infectious disease, is treated by administration to the subject of Gal9 antagonist and an immuno-oncology agent, wherein the immuno-oncology agent is a CD137 (4-1BB) agonist, such as an agonistic CD137 antibody. Suitable CD137 antibodies include, for example, urelumab or PF-05082566 (WO12/32433).

[0201] In one embodiment, a subject having a disease that may benefit from stimulation of the immune system, e.g., cancer or an infectious disease, is treated by administration to the subject of Gal9 antagonist and an immuno-oncology agent, wherein the immuno-oncology agent is a GITR agonist, such as an agonistic GITR antibody. Suitable GITR antibodies include, for example, TRX-518 (1006/105021, WO09/009116), MK-4166 (WO 11/028683) or a GITR antibody disclosed in WO2015/031667.

[0202] In one embodiment, a subject having a disease that may benefit from stimulation of the immune system, e.g., cancer or an infectious disease, is treated by administration to the subject of Gal9 antagonist and an immuno-oncology agent, wherein the immuno-oncology agent is an OX40 agonist, such as an agonistic OX40 antibody. Suitable OX40 antibodies include, for example, MEDI-6383, MEDI-6469 or MOXR0916 (RG7888; WO06/029879).

[0203] In one embodiment, a subject having a disease that may benefit from stimulation of the immune system, e.g., cancer or an infectious disease, is treated by administration to the subject of Gal9 antagonist and an immuno-oncology agent, wherein the immuno-oncology agent is a CD40 agonist, such as an agonistic CD40 antibody. In certain embodiments, the immuno-oncology agent is a CD40 antagonist, such as an antagonistic CD40 antibody. Suitable CD40 antibodies include, for example, lucatumumab (HCD122), dacetuzumab (SGN-40), CP-870,893 or Chi Lob 7/4.

[0204] In one embodiment, a subject having a disease that may benefit from stimulation of the immune system, e.g., cancer or an infectious disease, is treated by administration to the subject of Gal9 antagonist and an immuno-oncology agent, wherein the immuno-oncology agent is a CD27 agonist, such as an agonistic CD27 antibody. Suitable CD27 antibodies include, for example, varlilumab (CDX-1127).

[0205] In one embodiment, a subject having a disease that may benefit from stimulation of the immune system, e.g., cancer or an infectious disease, is treated by administration to the subject of Gal9 antagonist and an immuno-oncology agent, wherein the immuno-oncology agent is MGA271 (to B7H3) (WO11/109400).

[0206] In one embodiment, a subject having a disease that may benefit from stimulation of the immune system, e.g., cancer or an infectious disease, is treated by administration to the subject of Gal9 antagonist and an immuno-oncology agent, wherein the immuno-oncology agent is a KIR antagonist, such as lirilumab.

[0207] In one embodiment, a subject having a disease that may benefit from stimulation of the immune system, e.g., cancer or an infectious disease, is treated by administration to the subject of Gal9 antagonist and an immuno-oncology agent, wherein the immuno-oncology agent is an IDO antagonist. Suitable IDO antagonists include, for example, INCB-024360 (WO2006/122150, WO07/75598, WO08/36653, WO08/36642), indoximod, NLG-919 (WO09/73620, WO09/1156652, WOI 1/56652, WO 12/142237) or F001287.

[0208] In one embodiment, a subject having a disease that may benefit from stimulation of the immune system, e.g., cancer or an infectious disease, is treated by administration to the subject of Gal9 antagonist and an immuno-oncology agent, wherein the immuno-oncology agent is a Toll-like receptor agonist, e.g., a TLR2/4 agonist (e.g., Bacillus Calmette-Guerin); a TLR7 agonist (e.g., Hiltonol or Imiquimod); a TLR7/8 agonist (e.g., Resiquimod); or a TLR9 agonist (e.g., CpG7909).

[0209] In one embodiment, a subject having a disease that may benefit from stimulation of the immune system, e.g., cancer or an infectious disease, is treated by administration to the subject of Gal9 antagonist and an immuno-oncology agent, wherein, the immuno-oncology agent is a TGF-β inhibitor, e.g., GC 1008, LY2157299, TE W 7197 or IMC-TR 1.

6. Exemplary Gal9 Antagonists

[0210] In some embodiments, an Gal9 antagonist is a Gal9 antibody. In some embodiments, an Gal9 antagonist for treating cancer may be a non-antibody protein, such as a soluble Gal9 or a portion thereof (e.g., the ECD) that inhibits the interaction between Gal9 and its ligand, optionally further comprising a fusion partner and in the form of a fusion molecule. The antagonist, in other embodiments, may also be a small molecule or small peptide.

Gal9 Antibodies

[0211] In some embodiments, antibodies that block binding of Gal9 and its ligand are provided. In some embodiments, antibodies that inhibit Gal9-mediated signaling are provided. In some such embodiments, the antibody is Gal9 antibody. In some embodiments, the Gal9 antibody inhibits binding of Gal9 to its ligand. In some embodiments, Gal9 antibody inhibits Gal9-mediated signaling.

[0212] In some embodiments, Gal9 antibody of the invention has a dissociation constant (K.sub.d) of ≤1 μM, ≤100 nM, ≤10 nM, ≤1 nM, ≤0.1 nM, ≤0.01 nM, or ≤0.001 nM (e.g. 10.sup.−8 M or less, e.g. from 10 M.sup.−8 to 10.sup.−13 M, e.g., from 10.sup.−9 M to 10.sup.−13 M) for Gal9, e.g., for human Gal9. In certain embodiments, Gal9 antibody has a dissociation constant (K.sub.d) of ≤1 μM, ≤100 nM, ≤10 nM, ≤1 nM, ≤0.1 nM, ≤0.01 nM, or ≤0.001 nM (e.g. 10.sup.−8 M or less, e.g. from 10.sup.−8 M to 10.sup.−13 M, e.g., from 10.sup.−9 M to 10.sup.−13 M) for Gal9, e.g., for human Gal9.

[0213] In some embodiments, a Gal9 antibody having any the characteristics provided herein inhibits at least 25%, 50%, 75%, 80%, 90% or 100% of the signaling of Gal9.

[0214] In some embodiments, an antibody binds to Gal9 from multiple species. For example, in some embodiments, an antibody binds to human Gal9, and also binds to Gal9 from at least one non-human mammal selected from mouse, rat, dog, guinea pig, and cynomolgus monkey.

[0215] In some embodiments, multispecific antibodies are provided. In some embodiments, bispecific antibodies are provided. Non-limiting exemplary bispecific antibodies include antibodies comprising a first arm comprising a heavy chain/light chain combination that binds a first antigen and a second arm comprising a heavy chain/light chain combination that binds a second antigen. A further non-limiting exemplary multispecific antibody is a dual variable domain antibody. In some embodiments, a bispecific antibody comprises a first arm that inhibits binding of Gal9 and a second arm that stimulates T cells, e.g., by binding CD3. In some embodiments, the first arm binds Gal9.

[0216] In certain embodiments, the monoclonal antibodies of the invention or antigen-binding fragments thereof, including humanized monoclonal antibodies or antigen-binding fragments thereof, include one or more point mutations of in amino acid sequences that are designed to improve developability of the antibody. For example, Raybould et al. (Five computational developability guidelines for therapeutic antibody profiling, PNAS 116(10): 4025-4030, 2019) described Therapeutic Antibody Profiler (TAP), a computational tool that builds downloadable homology models of variable domain sequences, tests them against five developability guidelines, and reports potential sequence liabilities and canonical forms. The authors further provide TAP as freely available at opig.slats.ox.ac.uk/webapps/sabdab-sabpred/TAP.php.

[0217] There are many barriers to therapeutic mAb development, besides achieving the desired affinity to the antigen. These include intrinsic immunogenicity, chemical and conformational instability, self-association, high viscosity, polyspecificity, and poor expression. For example, high levels of hydrophobicity, particularly in the highly variable complementarity-determining regions (CDRs), have repeatedly been implicated in aggregation, viscosity, and polyspecificity. Asymmetry in the net charge of the heavy- and light-chain variable domains is also correlated with self-association and viscosity at high concentrations. Patches of positive and negative charge in the CDRs are linked to high rates of clearance and poor expression levels. Product heterogeneity (e.g., through oxidation, isomerization, or glycosylation) often results from specific sequence motifs liable to post- or co-translational modification. Computational tools are available to facilitate the identification of sequence liabilities. Warszawski el al. (Optimizing antibody affinity and stability by the automated design of the variable light-heavy chain interfaces. PLoS Comput Biol 15(8): e1007207. https://doi.org/10.1371/journal.pcbi.1007207) also described methods of optimizing antibody affinity and stability by an automated design of the variable light-heave chain interfaces. Additional methods are available to identify potential developability issues of a candidate antibody, and in preferred embodiments of this invention, one or more point mutations can be introduced, via conventional methods, to the candidate antibody to address such issues to lead to an optimized therapeutic antibody of the invention.

[0218] The sequences of certain representative antibodies, including the light chain (LC) and heavy chain (HC) variable regions, the CDR regions, and the framework regions (FR), are listed below.

TABLE-US-00002 HFB9-1hz1-hG1AA VH-CDR1: (SEQ ID NO: 2) GYTFTDYTIH VH-CDR2: (SEQ ID NO: 4) WFYPGSHSIKYAQKFQGR VH-CDR3: (SEQ ID NO: 6) HGGYDGFDY HCVR: (SEQ ID NO: 8) QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYTIHWVRQAPGQGLEWMGWF YPGSHSIKYAQKFQGRVTMTADTSISTAYMELSRLRSDDTAVYFCTRHGGY DGFDYWGQGTLVTVSS VL-CDR1: (SEQ ID NO: 10) KSSQSLFYSTNQKNYLA VL-CDR2: (SEQ ID NO: 12) WASTRES VL-CDR3: (SEQ ID NO: 14) QQYYYFPYT LCVR: (SEQ ID NO: 16) DIVMTQSPDSLAVSLGERATINCKSSQSLFYSTNQKNYLAWYQQKPGQPPK LLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYYFPY TFGQGTKLEIK

[0219] For all the antibody heavy chain sequences, the framework region sequences HFR1-HFR4 are defined by the VH-CDR sequences. For example, HFR1 is the sequence of HCVR that is N-terminal to VH-CDR1. HFR2 is the sequence of HCVR that is between VH-CDR1 and VH-CDR2. HFR3 is the sequence of HCVR that is between VH-CDR2 and VH-CDR3. HFR4 is the most C-terminal sequence of HCVR.

[0220] Likewise, for all the antibody light chain sequences, the framework region sequences LFR1-LFR4 are defined by the VL-CDR sequences. For example, LFR1 is the sequence of LCVR that is N-terminal to VL-CDR1. LFR2 is the sequence of LCVR that is between VL-CDR1 and VL-CDR2. LFR3 is the sequence of LCVR that is between VL-CDR2 and VL-CDR3. LFR4 is the most C-terminal sequence of LCVR.

[0221] The HFR1-HFR4 sequences of HFB9-1hz1-hG1AA is SEQ ID NOs: 1, 3, 5, and 7. The LFR1-LFR4 sequences of HFB9-1hz1-hG1AA is SEQ ID NOs: 9, 11, 13, and 15.

TABLE-US-00003 HFB9-1hz2-hG1AA VH-CDR1: (SEQ ID NO: 18) GYTFTDYTIH VH-CDR2: (SEQ ID NO: 20) WFYPGSHSIKYAQKFQGR VH-CDR3: (SEQ ID NO: 22) HGGYDGFDY (SEQ ID NO: 24) QVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYTIH WVRQAPGQGLEWMGWFYPGSHSIKYAQKFQGRVTT TADKSTSTAYMELSSLRSEDTAVYFCTRHGGYDGF DYWGQGTLVTVSS VL-CDR1: (SEQ ID NO: 26) KSSQSLFYSTNQKNYLA VL-CDR2: (SEQ ID NO: 28) WASTRES VL-CDR3: (SEQ ID NO: 30) QQYYYFPYT (SEQ ID NO: 32) DIVMTQSPDSLAVSLGERATINCKSSQSLFYSTNQ KNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSG SGSGTDFTLTISSLQAEDVAVYYCQQYYYFPYTFG QGTKLEIK

[0222] The HFR1-HFR4 sequences of HFB9-1hz2-hG1AA is SEQ ID NOs: 17, 19, 21, and 23. The LFR1-LFR4 sequences of HFB9-1hz2-hG1AA is SEQ ID NOs: 25, 27, 29, and 31.

TABLE-US-00004 HFB-hz-hG1AA VH-CDR1: (SEQ ID NO: 34) GYTFTDYTIH VH-CDR2: (SEQ ID NO: 36) WFYPGSHSIKYAQKFQGR VH-CDR3: (SEQ ID NO: 38) HGGYDGFDY (SEQ ID NO: 40) QVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYTIH WVRQAPGQGLEWMGWFYPGSHSIKYAQKFQGRVTI TADKSTSTAYMELSSLRSEDTAVYYCTRHGGYDGF DYWGQGTLVTVSS VL-CDR1: (SEQ ID NO: 42) KSSQSLFYSTNQKNYLA VL-CDR2: (SEQ ID NO: 44) WASTRES VL-CDR3: (SEQ ID NO: 46) QQYYYFPYT (SEQ ID NO: 48) DIVMTQSPDSLAVSLGERATINCKSSQSLFYSTNQ KNYLAWYQQKPGQPPKLLIYWASTRESGPDRFSGS GSGTDFTLTISSLQAEIVAVYYCQQYYYFPYTFGQ GTKLEIK

[0223] The HFR1-HFR4 sequences of HFB9-1hz3-hG1AA is SEQ ID NOs: 33, 35, 37, and 39. The LFR1-LFR4 sequences of HFB9-1hz3-hG1AA is SEQ ID NOs: 41, 43, 45, and 47.

TABLE-US-00005 HFB9-1hz4-hG1AA VH-CDR1: (SEQ ID NO: 50) GYTFTDYTIH VH-CDR2: (SEQ ID NO: 52) WFYPGSHSIKYAQKFQGR VH-CDR3: (SEQ ID NO: 54) HGGYDGFDY (SEQ ID NO: 56) QVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYTIH WVRQAPGQGLEWMGWFYPGSHSIKYAQKFQGRVTI TADKSTSTAYMELSSLRSEDTAVYYCARHGGYDGF DYWGQGTLVTVSS VL-CDR1: (SEQ ID NO: 58) KSSQSLFYSTNQKNYLA VL-CDR2: (SEQ ID NO: 60) WASTRES VL-CDR3: (SEQ ID NO: 62) QQYYYFPYT (SEQ ID NO: 64) DIVMTQSPDSLAVSLGERATINCKSSQSLFYSTNQ KNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSG SGSGTDFTLTISSLQAEDVAVYYCQQYYYFPYTFG QGTKLEIK

[0224] The HFR1-HFR4 sequences of HFB9-1hz4-hG1AA is SEQ ID NOs: 49, 51, 53, and 55. The LFR1-LFR4 sequences of HFB9-1hz4-hG1AA is SEQ ID NOs: 57, 59, 61, and 63.

TABLE-US-00006 HFB9-2hz11-hG1AA VH-CDR1: (SEQ ID NO: 66) GYTFTEYTIH VH-CDR2: (SEQ ID NO: 68) WPYPGSGSTEYAQKFOG VH-CDR3: (SEQ ID NO: 70) HGGYDGFDY (SEQ ID NO: 72) QVQLVQSGAEVKKPGASVKVSCKASGYTFTEYTIH WVRQAPGQGLEWMGWFYPGSGSTEYAQRFQGRVTM TADTSISTAYMELSRLRSDDTAVYFCERHGGYDGF DYWGQGTTVTVSS VL-CDR1: (SEQ ID NO: 74) KSSQSLLYSNNQKNYLA VL-CDR2: (SEQ ID NO: 76) WASTRGS VL-CDR3: (SEQ ID NO: 78) QQYYSYPFT (SEQ ID NO: 80) DIVMTQSPDSLAVSLGERATINCKSSQSLLYSNNQ KNYLAWYQQKPGQPIKLLIYWASTRGSGVPDRFSG SGSGTDFTLTISSLQAEDVAVYYCQQYYSYPFTFG GGTKVEIK

[0225] The HFR1-HFR4 sequences of HFB9-2hz11-hG1AA is SEQ ID NOs: 65, 67, 69, and 71. The LFR1-LFR4 sequences of HFB9-2hz11-hG1AA is SEQ ID NOs: 73, 75, 77, and 79.

TABLE-US-00007 HFB9-2hz12-hG1AA VH-CDR1: (SEQ ID NO: 82) GYTFTEYTIH VH-CDR2: (SEQ ID NO: 84) WFYPGSGSAEYAQKFOG VH-CDR3: (SEQ ID NO: 86) HGGYDGFDY (SEQ ID NO: 88) QVQLVQSGAEVKKPGSSVKVSCKASGYTFTEYTIH WVRQAPGQGLEWMGWFYPGSGSAEYAQKFQGRVTI TADESTSTAYMELSSLRSEDTAVYYCERHGGYDGF DYWGQGTTVTVSS VL-CDR1: (SEQ ID NO: 90) KSSQSLLYSNNQKNYLA VL-CDR2: (SEQ ID NO: 92) WASTRGS VL-CDR3: (SEQ ID NO: 94) QQYYSYPFT (SEQ ID NO: 96) DIVMTQSPDSLAVSLGERATINCKSSQSLLYSNNQ KNYLAWYQQKPGQPPKLLIYWASTRGSGVPDRFSG SGSGTDFTLTISSLQAEDVAVYYCQQYYSYPFTFG GGTKVEIK

[0226] The HFR1-HFR4 sequences of HFB9-2hz12-hG1AA is SEQ ID NOs: 81, 83, 85, and 87. The LFR1-LFR4 sequences of HFB9-2hz12-hG1AA is SEQ ID NOs: 89, 91, 93, and 95.

TABLE-US-00008 HFB9-2hz13-hG1AA VH-CDR1: (SEQ ID NO: 98) GYTFTEYTIH VH-CDR2: (SEQ ID NO: 100) WFYPGSGSTEYAQKFQG VH-CDR3: (SEQ ID NO: 102) HGGYDGFDY (SEQ ID NO: 104) QVQLVQSGAEVKKPGASVKVSCKASGYTFTEYTIH WVRQAPGQGLEWMGWFYPGSGSTEYAQKFQGRVTM TADTSTSTVYMELSSLRSEDTAVYYCERHGGYDGF DYWGQGTTVTVSS VL-CDR1: (SEQ ID NO: 106) KSSQSLLYSNNQKNYLA VL-CDR2: (SEQ ID NO: 108) WASTRGS VL-CDR3: (SEQ ID NO: 110) QQYYSYPFT (SEQ ID NO: 112) DIVMTQSPDSLAVSLGERATINCKSSQSLLYSNNQ KNYLAWYQQKPGQPPKLLIYWASTRGSGPDRPSGS GSGTDFTLTISSLQAEDVAVYYCQQYYSYPFTFGG GTKVEIK

[0227] The HFR1-HFR4 sequences of HFB9-2hz13-hG1AA is SEQ ID NOs: 97, 99, 101, and 103. The LFR1-LFR4 sequences of HFB9-2hz13-hG1AA is SEQ ID NOs: 105, 107, 109, and 111.

TABLE-US-00009 HFB9-2hz14-hG1AA VH-CDR1: (SEQ ID NO: 114) GYTFTEYTIH VH-CDR2: (SEQ ID NO: 116) WFYPGSGSTEYSPSFQG VH-CDR3: (SEQ ID NO: 118) HGGYDGFDY (SEQ ID NO: 120) EVQLVQSGAEVKKPGESLKISCKGSGYTFTEYTIH WVRQMPGKGLEWMGWFYPGSGSTEYSPSFQGQVTI SADKSISTAYLQWSSLKASDTAMYYCERHGGYDGF DYWGQGTTVTVSS VL-CDR1: (SEQ ID NG: 122) KSSQSLLYSNNQKNYLA VL-CDR2: (SEQ ID NO: 124) WASTRGS VL-CDR3: (SEQ ID NO: 126) QQYYSYPFT (SEQ ID NO: 128) DIVMTQSPDSLAVSLGERATINCKSSQSLLYSNNQ KNYLAWYQQKPGQPPKLLIYWASTRGSGVPDRFSG SGSGTDFTLTISSLQAEDVAVYYCQQYYSYPFTFG GGTKVEIK

[0228] The HFR1-HFR4 sequences of HFB9-2hz14-hG1AA is SEQ ID NOs: 113, 115, 117, and 119. The LFR1-LFR4 sequences of HFB9-2hz14-hG1AA is SEQ ID NOs: 121, 123, 125, and 127.

7. Humanized Antibodies

[0229] In some embodiments, the Gal9 antibody is a humanized antibody. Humanized antibodies are useful as therapeutic molecules because humanized antibodies reduce or eliminate the human immune response to non-human antibodies (such as the human anti-mouse antibody (HAMA) response), which can result in an immune response to an antibody therapeutic, and decreased effectiveness of the therapeutic.

[0230] An antibody may be humanized by any standard method. Non-limiting exemplary methods of humanization include methods described, e.g., in U.S. Pat. Nos. 5,530,101; 5,585,089; 5,693,761; 5,693,762; 6,180,370; Jones et al., Nature 321:522-525 (1986); Riechmann et al, Nature 332: 323-27 (1988); Verhoeyen et al, Science 239: 1534-36 (1988); and U.S. Publication No. US 2009/0136500. All incorporated by reference.

[0231] A humanized antibody is an antibody in which at least one amino acid in a framework region of a non-human variable region has been replaced with the amino acid from the corresponding location in a human framework region. In some embodiments, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least 10, at least 11, at least 12, at least 15, or at least 20 amino acids in the framework regions of a non-human variable region are replaced with an amino acid from one or more corresponding locations in one or more human framework regions.

[0232] In some embodiments, some of the corresponding human amino acids used for substitution are from the framework regions of different human immunoglobulin genes. That is, in some such embodiments, one or more of the non-human amino acids may be replaced with corresponding amino acids from a human framework region of a first human antibody or encoded by a first human immunoglobulin gene, one or more of the non-human amino acids may be replaced with corresponding amino acids from a human framework region of a second human antibody or encoded by a second human immunoglobulin gene, one or more of the non-human amino acids may be replaced with corresponding amino acids from a human framework region of a third human antibody or encoded by a third human immunoglobulin gene, etc. Further, in some embodiments, all of the corresponding human amino acids being used for substitution in a single framework region, for example, FR2, need not be from the same human framework. In some embodiments, however, all of the corresponding human amino acids being used for substitution are from the same human antibody or encoded by the same human immunoglobulin gene.

[0233] In some embodiments, an antibody is humanized by replacing one or more entire framework regions with corresponding human framework regions. In some embodiments, a human framework region is selected that has the highest level of homology to the non-human framework region being replaced. In some embodiments, such a humanized antibody is a CDR-grafted antibody.

[0234] In some embodiments, following CDR-grafting, one or more framework amino acids are changed back to the corresponding amino acid in a mouse framework region. Such “back mutations” are made, in some embodiments, to retain one or more mouse framework amino acids that appear to contribute to the structure of one or more of the CDRs and/or that may be involved in antigen contacts and/or appear to be involved in the overall structural integrity of the antibody. In some embodiments, ten or fewer, nine or fewer, eight or fewer, seven or fewer, six or fewer, five or fewer, four or fewer, three or fewer, two or fewer, one, or zero back mutations are made to the framework regions of an antibody following CDR grafting.

[0235] In some embodiments, a humanized antibody also comprises a human heavy chain constant region and/or a human light chain constant region.

8. Human Antibodies

[0236] In some embodiments, the Gal9 antibody is a human antibody. Human antibodies can be made by any suitable method. Non-limiting exemplary methods include making human antibodies in transgenic mice that comprise human immunoglobulin loci. See, e.g., Jakobovits et al., Proc. Natl. Acad. Sci. USA 90: 2551-55 (1993); Jakobovits et al. Nature 362: 255-8 (1993); onberg et a, Nature 368: 856-9 (1994); and U.S. Pat. Nos. 5,545,807; 6,713,610; 6,673,986; 6,162,963; 5,545,807; 6,300,129; 6,255,458; 5,877,397; 5,874,299; and 5,545,806.

[0237] Non-limiting exemplary methods also include making human antibodies using phage display libraries. See, e.g., Hoogenboom et al., J. Mol. Biol. 227: 381-8 (1992); Marks et al, J. Mol. Biol. 222: 581-97 (1991); and PCT Publication No. WO 99/10494.

[0238] Human Antibody Constant Regions

[0239] In some embodiments, a humanized, chimeric, or human antibody described herein comprises one or more human constant regions. In some embodiments, the human heavy chain constant region is of an isotype selected from IgA, IgG, and IgD. In some embodiments, the human light chain constant region is of an isotype selected from K and λ. In some embodiments, an antibody described herein comprises a human IgG constant region, for example, human IgG1, IgG2, IgG3, or IgG4. In some embodiments, an antibody or Fr fusion partner comprises a C237S mutation, for example, in an IgG1 constant region. In some embodiments, an antibody described herein comprises a human IgG2 heavy chain constant region. In some such embodiments, the IgG2 constant region comprises a P331S mutation, as described in U.S. Pat. No. 6,900,292. In some embodiments, an antibody described herein comprises a human IgG4 heavy chain constant region. In some such embodiments, an antibody described herein comprises an S241P mutation in the human IgG4 constant region. See, e.g., Angal et al. Mol. Immunol. 30(1):105-108 (1993). In some embodiments, an antibody described herein comprises a human IgG4 constant region and a human K light chain.

[0240] The choice of heavy chain constant region can determine whether or not an antibody will have effector function in viva. Such effector function, in some embodiments, includes antibody-dependent cell-mediated cytotoxicity (ADCC) and/or complement-dependent cytotoxicity (CDC), and can result in killing of the cell to which the antibody is bound. Typically, antibodies comprising human IgG1 or IgG3 heavy chains have effector function.

[0241] In some embodiments, effector function is not desirable. For example, in some embodiments, effector function may not be desirable in treatments of inflammatory conditions and/or autoimmune disorders. In some such embodiments, a human IgG4 or IgG2 heavy chain constant region is selected or engineered. In some embodiments, an IgG4 constant region comprises an S241P mutation.

[0242] Any of the antibodies described herein may be purified by any suitable method. Such methods include, but are not limited to, the use of affinity matrices or hydrophobic interaction chromatography. Suitable affinity ligands include the antigen and/or epitope to which the antibody binds, and ligands that bind antibody constant regions. For example, a Protein A, Protein G, Protein A/G, or an antibody affinity column may be used to bind the constant region and to purify an antibody.

[0243] In some embodiments, hydrophobic interactive chromatography (HIC), for example, a butyl or phenyl column, is also used for purifying some polypeptides. Many methods of purifying polypeptides are known in the art.

[0244] Alternatively, in some embodiments, an antibody described herein is produced in a cell-free system. Nonlimiting exemplary cell-free systems are described, e.g., in Sharman et al., Methods Mol. Biol. 498: 229-44 (2009); Spirin, Trends Biotechnol. 22: 538-45 (2004); Endo et al, Biotechnol. Adv. 21: 695-713 (2003).

9. Nucleic Acid Molecules Encoding Gal9 Antagonists

[0245] The invention also provides nucleic acid molecules comprising polynucleotides that encode one or more chains of an antibody described herein, such as Gal9 antibody. In some embodiments, a nucleic acid molecule comprises a polynucleotide that encodes a heavy chain or a light chain of an antibody described herein. In some embodiments, a nucleic acid molecule comprises both a polynucleotide that encodes a heavy chain and a polynucleotide that encodes a light chain, of an antibody described herein. In some embodiments, a first nucleic acid molecule comprises a first polynucleotide that encodes a heavy chain and a second nucleic acid molecule comprises a second polynucleotide that encodes a light chain.

[0246] In some such embodiments, the heavy chain and the light chain are expressed from one nucleic acid molecule, or from two separate nucleic acid molecules, as two separate polypeptides. In some embodiments, such as when an antibody is an scFv, a single polynucleotide encodes a single polypeptide comprising both a heavy chain and a light chain linked together.

[0247] In some embodiments, a polynucleotide encoding a heavy chain or light chain of an antibody described herein comprises a nucleotide sequence that encodes a leader sequence, which, when translated, is located at the N-terminus of the heavy chain or light chain. As discussed above, the leader sequence may be the native heavy or light chain leader sequence, or may be another heterologous leader sequence.

[0248] Nucleic acid molecules may be constructed using recombinant DNA techniques conventional in the art. In some embodiments, a nucleic acid molecule is an expression vector that is suitable for expression in a selected host cell, such as a mammalian cell.

10. Vectors

[0249] Vectors comprising polynucleotides that encode heavy chains and/or light chains of the antibodies described herein are provided. Such vectors include, but are not limited to, DNA vectors, phage vectors, viral vectors, retroviral vectors, etc. In some embodiments, a vector comprises a first polynucleotide sequence encoding a heavy chain and a second polynucleotide sequence encoding a light chain. In some embodiments, the heavy chain and light chain are expressed from the vector as two separate polypeptides. In some embodiments, the heavy chain and light chain are expressed as part of a single polypeptide, such as, for example, when the antibody is an scFv.

[0250] In some embodiments, a first vector comprises a polynucleotide that encodes a heavy chain and a second vector comprises a polynucleotide that encodes a light chain. In some embodiments, the first vector and second vector are transfected into host cells in similar amounts (such as similar molar amounts or similar mass amounts). In some embodiments, a mole- or mass-ratio of between 5:1 and 1:5 of the first vector and the second vector is transfected into host cells. In some embodiments, a mass ratio of between 1:1 and 1:5 for the vector encoding the heavy chain and the vector encoding the light chain is used. In some embodiments, a mass ratio of 1:2 for the vector encoding the heavy chain and the vector encoding the light chain is used.

[0251] In some embodiments, a vector is selected that is optimized for expression of polypeptides in CHO or CHO-derived cells, or in NSO cells. Exemplary such vectors are described, e.g., in Running Deer et al., Biotechnol. Prog. 20:880-889 (2004). In some embodiments, a vector is chosen for in vivo expression of Gal9 antagonist in animals, including humans. In some such embodiments, expression of the polypeptide or polypeptides is under the control of a promoter or promoters that function in a tissue-specific manner. For example, liver-specific promoters are described, e.g., in PCT Publication No. WO 2006/076288.

11. Host Cells

[0252] In various embodiments, heavy chains and/or light chains of the antibodies described herein may be expressed in prokaryotic cells, such as bacterial cells; or in eukaryotic cells, such as fungal cells (such as yeast), plant cells, insect cells, and mammalian cells. Such expression may be carried out, for example, according to procedures known in the alt Exemplary eukaryotic cells that may be used to express polypeptides include, but are not limited to, COS cells, including COS 7 cells; 293 cells, including 293-6E cells; CHO cells, including CHO-S and DG44 cells; PER.C6® cells (Crucell); and NSO cells. In some embodiments, heavy chains and/or light chains of the antibodies described herein may be expressed in yeast. See, e.g., U.S. Publication No. US 2006/0270045 A1. In some embodiments, a particular eukaryotic host cell is selected based on its ability to make desired post-translational modifications to the heavy chains and/or light chains of Gal9 antibody. For example, in some embodiments, CHO cells produce polypeptides that have a higher level of sialylation than the same polypeptide produced in 293 cells.

[0253] Introduction of one or more nucleic acids into a desired host cell may be accomplished by any method, including but not limited to, calcium phosphate transfection, DEAE-dextran mediated transfection, cationic lipid-mediated transfection, electroporation, transduction, infection, etc., Nonlimiting exemplary methods are described, e.g., in Sambrook et al., Molecular Cloning, A Laboratory Manual, 3rd ed. Cold Spring Harbor Laboratory Press (2001). Nucleic acids may be transiently or stably transfected in the desired host cells, according to any suitable method.

[0254] In some embodiments, one or more polypeptides may be produced in vivo in an animal that has been engineered or transfected with one or more nucleic acid molecules encoding the polypeptides, according to any suitable method.

EXAMPLES

Example 1 Humanized Anti-Gal-9 Antibodies Have High Binding Affinity for Human and Mouse Galectin-9

[0255] This example demonstrates that the various anti-human Gal-9 humanized antibodies of the invention have high binding affinity towards both human and mouse Gal-9.

[0256] Antibody binding affinity was measured using the commercially available Octet system from ForteBio (Creative Biolabs). According to the Creative Biolabs description, the Octet platform is based on bio-layer interferometry (BLI) technology that utilizes a whole set of system including instruments, biosensors, reagents and assay kits to support the evaluation of biomolecular interactions in 96- or 384-well microplates. Octet system uses Dip-and-Read assay mode to avoid the need of microfluidics, and enables the real-time, label-free analysis of affinity as well as kinetics. There are three biosensor-based assay orientations that can be used to explore antibody interaction: tandem blocking, premix blocking and classical sandwich. Compared to Biacore, Octet's dip-and-read assay allows longer analyte-binding steps and favors the rebinding of analyte to the ligand-coated sensors. Meanwhile, faster association time consumes less sample, which saves your precious proteins.

[0257] Also according to the Creative Biolabs description, the principle of BLI technology is based on the optical interference pattern of white light reflected from two surfaces—a layer of immobilized protein and an internal reference layer. The binding between a ligand immobilized on the biosensor tip surface and an analyte in solution produces an increase in optical thickness at the biosensor tip, which results in a shift in the interference pattern measured in nanometers. The wavelength shift (Δλ) is a direct measure of the change in optical thickness of the biological layer. When this shift is measured over a period of time, and its magnitude plotted as a function of time, a classic association/dissociation curve is obtained. This interaction is measured in real-time, providing the ability to monitor binding specificity, association rate and dissociation rate, and concentration with outstanding precision and accuracy.

[0258] Using this system, antibody affinity towards recombinant human and mouse Gal-9 were measured for selected humanized antibodies of the invention, and the results are summarized in the table below. The data shows that the tested humanized antibodies have mid- to low-nM range high affinity towards both the human and mouse Gal-9 protein/antigen.

TABLE-US-00010 Antibody Gal-9 K.sub.D (M) K.sub.D Error Ka (1/Ms) Ka Error K.sub.dis (1/s) K.sub.dis Error Full R.sup.2 HFB9-2hz11- hGal9M 4.84E−09 2.21E−10 7.28E+04 2.75E+03 3.52E−04 9.13E−06 0.9509 hG1AA ref mGal9M 3.66E−09 3.72E−11 1.66E+05 1.41E+03 6.06E−04 3.40E−06 0.9886 batch HFB9-2hz11- hGal9M 1.96E−09 1.22E−10 9.14E+04 3.04E+03 1.79E−04 9.45E−06 0.949 hG1AA mGal9M 1.15E−09 1.03E−11 4.02E+05 2.53E+03 4.62E−04 2.93E−06 0.9826 MF20191024 * hGal9M-human Galectin 9; mGal9M-mouse Galectin 9.

[0259] Sequence alignments for selected humanized antibodies of the invention were performed using standard sequence alignment software, and the results are shown in FIGS. 1 and 2. Specifically, in FIG. 1, the V.sub.H and V.sub.L regions of the 4 humanized antibodies were aligned to show the changes in amino acid residues compared to the original V.sub.H and V.sub.L regions, respectively, of the human-mouse chimeric antibody HFB9-1. Humanization mostly changed amino acid sequences in the framework regions of the heavy and light chain variable regions (HCVR and LCVR). However, extensive changes also occurred within the heavy chain CDR2 sequence (see FIG. 1).

[0260] Similarly, in FIG. 2, the V.sub.H and V.sub.L regions of the 6 humanized antibodies were aligned to show the changes in amino acid residues compared to the original V.sub.H and V.sub.L regions, respectively, of the human-mouse chimeric antibody HFB9-2. Humanization mostly changed amino acid sequences in the framework regions of the heavy and light chain variable regions (HCVR and LCVR). However, extensive changes also occurred within the heavy chain CDR2 sequence, and one residue within the heavy chain CDR1 sequence for one humanized antibody (see FIG. 2).

Example 2 Anti-Gal9 Antibodies Exhibit Sub-Nanomolar (nM) Affinity for Gal9

[0261] This experiment demonstrates that the humanized antibodies of the invention exhibit very high (sub-nanomolar) affinity for recombinant human Gal9, and cross-react with recombinant mouse Gal9 as well as monkey Gal9 (data not shown). EC50 values for each tested humanized antibodies were measured over increasing concentrations of each antibody, and the results were tabulated in the table in FIG. 3 for binding to recombinant human Gal9, and in FIG. 4 for binding to recombinant mouse Gal9.

[0262] It is apparent that, other than the 1hz4 antibody, all three humanized variants of the HFB9-1 exhibited sub-nM level of affinity for both the human and mouse Gal-9 (see FIGS. 3 and 4). Meanwhile, 5 of the 6 humanized HFB9-2 antibodies (except for 2hz12) exhibited sub-nM level of affinity for human Gal9, but only 4 of the 5 (except for 2h14) maintained sub-nM level of affinity for mouse Gal9.

[0263] Strong cross-reactivity against the monkey ortholog Gal9 was also observed (data not shown).

[0264] The sequences of these representative antibodies, including the light chain (LC) and heavy chain (HC) variable regions, the CDR regions, and the framework regions (FR), are listed below.

TABLE-US-00011 HFB9-1hz1-hG1AA VH-CDR1: (SEQ ID NO: 2) GYTFTDYTIH VH-CDR2: (SEQ ID NO: 4) WFYPGSHSIKYAQKFQGR VH-CDR3: (SEQ ID NO: 6) HGGYDGFDY HCVR: (SEQ ID NO: 8) QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYTIH WVRQAPGQGLEWMGWFYPGSHSIKYAQKFQGRVTM TADTSISTAYMELSRLRSDDTAVYFCTRHGGYDGF DYWGQGTLVTVSS (SEQ ID NO: 10) VL-CDR1: KSSQSLFYSTNQKNYLA VL-CDR2: (SEQ ID NO: 12) WASTRES VL-CDR3: (SEQ ID NO: 14) QQYYYFPYT VL-LCVR: (SEQ ID NO: 16) DIVMTQSPDSLAVSLGERATINCKSSQSLFYSTNQ KNYLAWYQQKPGQPPKLLTYWASTRESGVPDRFSG SGSGTDFTLTISSLQAEDVAVYYCQQYYYFPYTFG QGTKLEIK

[0265] For all the antibody heavy chain sequences, the framework region sequences HFR1-HFR4 are defined by the VH-CDR sequences. For example, HFR1 is the sequence of HCVR that is N-terminal to VH-CDR1. HFR2 is the sequence of HCVR that is between VH-CDR1 and VH-CDR2. HFR3 is the sequence of HCVR that is between VH-CDR2 and VII-CDR3. HFR4 is the most C-terminal sequence of HCVR.

[0266] Likewise, for all the antibody light chain sequences, the framework region sequences LFR1-LFR4 are defined by the VL-CDR sequences. For example, LFR1 is the sequence of LCVR that is N-terminal to VL-CDR1. LFR2 is the sequence of LCVR that is between VL-CDR1 and VL-CDR2. LFR3 is the sequence of LCVR that is between VL-CDR2 and VL-CDR3. LFR4 is the most C-terminal sequence of LCVR.

[0267] The HFR1-HFR4 sequences of HFB9-1hz1-hG1AA is SEQ ID NOs: 1, 3, 5, and 7. The LFR1-LFR4 sequences of HFB9-1hz1-hG1AA is SEQ ID NOs: 9, 11, 13, and 15.

TABLE-US-00012 HFB9-1hz2-hG1AA VH-CDR1: (SEQ ID NO: 18) GYTFTDYTIH VH-CDR2: (SEQ ID NO: 20) WFYPGSHSIKYAQKFQGR VH-CDR3: (SEQ ID NO: 22) HGGYDGFDY (SEQ ID NO: 24) QVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYTIH WVRQAPGQGLEWMGWFYPGSHSIKYAQKFQGRVTI TADKSTSTAYMELSSLRSEDTAVYFCTRHGGYDGF DYWGQGTLVTVSS VL-CDR1: (SEQ ID NO: 26) KSSQSLFYSTNQKNYLA VL-CDR2: (SEQ ID NO: 28) WASTRES VL-CDR3: (SEQ ID NO: 30) QQYYYFPYT (SEQ ID NO: 32) DIVMTQSPDSLAVSLGERATINCKSSQSLFYSTNQ KNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSG SGSGTDFTLTISSLQAEDVAVYYCQQYYYFPYTFG QGTKLEIE

[0268] The HFR1-HFR4 sequences of HFB9-1hz2-hG1AA is SEQ ID NOs: 17, 19, 21, and 23. The LFR1-LFR4 sequences of HFB9-1hz2-hG1AA is SEQ ID NOs: 25, 27, 29, and 31.

TABLE-US-00013 HFB9-1hz3-hG1AA VH-CDR1: (SEQ ID NO: 34) GYTFTDYTIH VH-CDR2: (SEQ ID NO: 36) WPYPGSHSIKYAOKFQGR VH-CDR3: (SEQ ID NO: 38) HGGYDGFDY (SEQ ID NO: 40) QVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYTIH WVRQAPGQGLEWMGWFYPGSHSIKYAQKFQGRVTI TADKSTSTAYMELSSLRSEDTAVYYCTRHGGYDGF DYWGQGTLVTVSS VL-CDR1: (SEQ ID NO: 42) KSSQSLFYSTNQKNYLA VL-CDR2: (SEQ ID NO: 44) WASTRES VL-CDR3: (SEQ ID NO: 46) QQYYYFPYT (SEQ ID NO: 48) DIVMTQSPDSLAVSLGERATINCKSSQSLFYSTNQ KNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSG SGSGTDFTLTISSLQAEDVAVYYCQQYYYFPYTFG QGTKLEIK

[0269] The HFR1-HFR4 sequences of HFB9-1hz3-hG1AA is SEQ ID NOs: 33, 35, 37, and 39. The LFR1-LFR4 sequences of HFB9-1hz3-hG1AA is SEQ ID NOs: 41, 43, 45, and 47.

TABLE-US-00014 HFB9-1hz4-hG1AA VH-CDR1: (SEQ ID NO: 50) GYTFTDYTIH VH-CDR2: (SEQ ID NO: 52) WFYPGSHSIKYAQKFQGR VH-CDR3: (SEQ ID NO: 54) HGGYDGFDY (SEQ ID NO: 56) QVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYTIHW VRQAPGQGLEWMGWFYPGSHSIKYAQKFQGRVTIT ADKSTSTAYMELSSLRSEDTAVYYCARHGGYDGFD YWGQGTLVTVSS VL-CDR1: (SEQ ID NO: 58) KSSQSLFYSTNOKNYLA VL-CDR2: (SEQ ID NO: 60) WASTRES VL-CDR3: (SEQ ID NO: 62) QQYYYFPYT (SEQ ID NO: 64) DIVMTQSPDSLAVSLGERATINCKSSQSLFYSTNQ KNYLAWYQQKPGQPPKLLIYWASTRESGVPDRPSG SGSGTDFTLTISSLQAEDVAVYYCQQYYYFPYTFG QGTKLEIK

[0270] The HFR1-HFR4 sequences of HFB9-1 hz4-hG1AA is SEQ ID NOs: 49, 51, 53, and 55. The LFR1-LFR4 sequences of HFB9-1 hz4-hG1AA is SEQ ID NOs: 57, 59, 61, and 63.

TABLE-US-00015 HFB9-2hz11-hG1AA GYTFTEYTIH (SEQ ID NO: 66) VH-CDR1: VH-CDR2: (SEQ ID NO: 68) WFYPGSGSTEYAQKFQG VH-CDR3: (SEQ ID NO: 70) HGGYDGFDY (SEQ ID NO: 72) QVQLVQSGAEVKKPGASVKVSCKASGYTFTEYTLH WVRQAPGQGLEWMGWFYPGSGSTEYAQKFQGRVTM TADTSISTAYMELSRLRSDDTAVYFCERHGGYDGF DYWGQGTTVTVSS VL-CDR1: (SEQ ID NO: 74) KSSQSLLYSNNQKNYLA VL-CDR2: (SEQ ID NO: 76) WASTRGS VL-CDR3: (SEQ ID NO: 78) QQYYSYPPT (SEQ ID NO: 80) DIVMTQSPDSLAVSLGERATINCKSSQSLLYSNNQ KNYLAWYQQKPGQPPKLLIYWASTRGSGVPDRFSG SGSGTDFTLTISSLQAEDVAVYYCQQYYSYPFTFG GGTKVEIK

[0271] The HFR1-HFR4 sequences of HFB9-2hz11-hG1AA is SEQ ID NOs: 65, 67, 69, and 71. The LFR1-LFR4 sequences of HFB9-2hz11-hG1AA is SEQ ID NOs: 73, 75, 77, and 79.

TABLE-US-00016 HFB9-2hzl2-hG1AA VH-CDR1: (SEQ ID NO: 82) GYTFTEYTIH VH-CDR2: (SEQ ID NO: 84) WPYPGSGSAEYAQKFQG VH-CDR3: (SEQ ID NO: 86) HGGYDGFDY (SEQ ID NO: 88) QVQLVQSGAEVKKPGSSVKVSCKASGYTFTEYTIH WVRQAPGQGLEWMGWFYPGSGSAEYAQKFQGRVTI TADESTSTAYMELSSLRSEDTAVYYCERRGGYDGF DYWGQGTTVTVSS VL-CDR1: (SEQ ID NO: 90) KSSQSLLYSNNQKNYLA VL-CDR2: (SEQ ID NO: 92) WASTRGS VL-CDR3: (SEQ ID NO: 94) QQYYSYPFT (SEQ ID NO: 96) DIVMTQSPDSLAVSLGERATINCKSSQSLLYSNNQ KNYLAWYQQKPGQPPKLLIYWASTRGSGVPDRFSG SGSGTDFTLTISSLQAEDVAVYYCQQYYSYPFTFG GGTKVEIK

[0272] The HFR1-HFR4 sequences of HFB9-2hz12-hG1AA is SEQ ID NOs: 81, 83, 85, and 87. The LFR1-LFR4 sequences of HFB9-2hz12-hG1AA is SEQ ID NOs: 89, 91, 93, and 95.

TABLE-US-00017 HFB9-2hz13-hG1AA VH-CDR1: (SEQ ID NO: 98) GYTFTEYTIH VH-CDR2: (SEQ ID NO: 100) WFYPGSGSTEYAQKFQG VH-CDR3: (SEQ ID NO: 102) HGGYDGFDY (SEQ ID NO: 104) QVQLVQSGAEVKKPGASVKVSCKASGYTFTEYTIH WVRQAPGQGLEWMGWFYPGSGSTEYAQKFQGRVTM TADTSTSTVYMELSSLRSEDTAVYYCERHGGYDGF DYWGQGTTVTVSS VL-CDR1: (SEQ ID NO: 106) KSSQSLLYSNNQKNYLA VL-CDR2: (SEQ ID NO: 108) WASTRGS VL-CDR3: (SEQ ID NO: 110) QQYYSYPFT (SEQ ID NO: 2) DIVMTQSPDSLAVSLGERATINCKSSQSLLYSNNQ KNYLAWYQQKPGQPPKLLIYWASTRGSGVPDRFSG SGSGTDFTLTISSLQAEDVAVYYCQQYYSYPFTFG GGTKVEIK

[0273] The HFR1-HFR4 sequences of HFB9-2hz13-hG1AA is SEQ 113 NOs: 97, 99, 101, and 103. The LFR1-LFR4 sequences of HFB9-2hz13-hG1AA is SEQ ID NOs: 105, 107, 109, and 111.

TABLE-US-00018 HFB9-2hz14-hG1AA (SEQ ID NO: 114) VH-CDR1: GYTFTEYTIH VH-CDR2: (SEQ ID NO: 116) WFYPGSGSTEYSPSFQG VH-CDR3: (SEQ ID NO: 118) HGGYDGFDY (SEQ ID NO: 120) EVQLVQSGAEVKKPGESLKISCKGSGYTFTEYTIH WVRQMPGKGLEWMGWFYPGSGSTEYSPSFQGQVTI SADKSISTAYLQWSSLKASDTAMYYCERHGGYDGF DYWGQGTTVTVSS VL-CDR1: (SEQ ID NO: 122) KSSQSLLYSNNQKNYLA VL-CDR2: (SEQ ID NO: 124) WASTRGS VL-CDR3: (SEQ ID NO: 126) QQYYSYPFT (SEQ ID NO: 128) DIVMTQSPDGLAVSLGBRATINCKSSQSLLYSNNQ KNYLAWYQQKPGQPPKLLIYWASTRGSGVPDRFSG SGSGTDFTLTISSLQAEDVAVYYCQQYYSYPFTFG GGTKVEIK

[0274] The HFR1-HFR4 sequences of HFB9-2hz14-hG1AA is SEQ ID NOs: 113, 115, 117, and 119. The LFR1-LFR4 sequences of HFB9-2hz14-hG1AA is SEQ ID NOs: 121, 123, 125, and 127.

Example 3 Binding by Anti-Gal9 Antibodies Blocks Gal9 Binding to Receptors TIM3 and CD44

[0275] This experiment demonstrates that the anti-Gal9 antibodies of the invention can block Gal-9 binding to its receptors TIM3 and CD44, thus antagonizing downstream signaling from Gal-9.

[0276] The data in FIG. 5 clearly showed that the humanized antibodies of the invention blocked Gal9 binding to both the TIM3 and CD44 receptors in a dose-dependent manner.

Example 4 Anti-Gal9 Antibodies Neutralize Gal9-Induced Th1 Apoptosis

[0277] Yang et al. (Inflammation 40(3):1062-1071, 2017) reported that elevated Galectin-9 suppresses Th1 effector function and induces apoptosis of activated CD4.sup.+ T cells in osteoarthritis. This experiment demonstrates that the anti-Gal9 antibodies of the invention neutralize Gal9-induced Th1 apoptosis.

[0278] Specifically, human PBMCs were isolated from healthy donors, and were incubated with increasing concentrations of the antibodies of the invention at the presence of an amount of Gal9 that induces T cell apoptosis in the absence of antibody. The percentages of apoptotic CD4+ T cells were determined over the antibody concentration range to determine EC50 values for the antibodies. The results were summarized in FIG. 6. The data clearly showed that treatment of human PBMCs from healthy donors with the antibodies of the invention prevented Gal-9-induced Th1 cell apoptosis in a dose dependent manner.

Example 5 Anti-Gal9 Antibodies Suppress Gal9-Induced Treg Expansion

[0279] As discussed above, Galectin-9 is directly expressed by Tregs, which activation is associated with increased expression of Gal9. This experiment demonstrates that inhibition of Galectin-9 by the anti-Gal9 antibody of the invention suppresses Treg expansion.

[0280] Specifically, human PBMCs were isolated from healthy donors, and were incubated with increasing concentrations of the antibodies of the invention at the presence of an amount of Gal9 that stimulates Treg expansion in the absence of antibody. The percentages of Foxp3.sup.+Ki67.sup.high T cells among all viable cells were determined over the antibody concentration range to determine EC50 values for the antibodies. The results were summarized in FIG. 7. The data clearly showed that treatment of human PBMCs from healthy donors with the antibodies of the invention suppressed Gal-9-induced Treg expansion in a dose dependent manner, in that higher antibody concentrations were associated with lower percentages of expanded Tregs based on the Foxp3 and Ki67 marker genes expression.

Example 6 Combination Treatment with Anti-Gal9 Antibody and Anti-PD-1 Antibody Showed Synergistic Effect in Inhibiting Tumor Growth In Vivo and Prolonging Survival

[0281] This experiment demonstrates that the anti-Gal9 monoclonal antibodies of the invention and anti-PD-1 antibody have synergistic effect in inhibiting tumor growth in vivo in a xenograph mouse model.

[0282] In particular, about half million cancer cells were innoculated into experimental mice and the tumor mass was allowed to grow to a pre-determined size. Mice were then randomized and injected intraperitoneally (i.p.) with one of four antibody or antibody combinations: (1) IgG isotype control at a dose of 10 mg/kg, (2) anti-Gal9 antibody HFB9-2 (clone RMP1-14) at a dose of 10 mg/kg, (3) anti-mPD-1 antibody at a dose of 10 mg/kg, or (4) a combination of anti-mPD-1 antibody at 10 mg/kg and anti-HFB9-2 antibody at 10 mg/kg.

[0283] The first dose of the antibodies for the various groups were administered on Day 1, and subsequent doses were administered every 3 days, for four doses in total for any groups with anti-mPD-1 antibody, and for seven doses in total for any groups with anti-HFB9-2 antibody and the control antibody. Data are presented as mean s.e.m. (n=8 mice per group) (FIG. 8).

[0284] It is apparent that the subject anti-Gal9 antibody and anti-mPD-1 antibody exhibited synergistic effect in inhibiting tumor growth in vivo, in that the combination therapy essentially completely suppressed tumor growth to no more than 500 mm.sup.3 during the 7-week study period. Meanwhile, tumor growth in the control group and the anti-HFB9-2 group exceeded this level as early as 2 weeks, and the anti-mPD-1 group exceeded this level as early as 4 weeks.

[0285] Furthermore, in terms of survival (FIG. 9), all mice in the control group died around the end of week 3, all mice in the anti-HFB9-2 antibody group died around the end of week 5, and only 25% of the mice (2 out of 8) in the anti-mPD-1 group survived tumor-free at the end of week 7. By the same time, however, the combination therapy group had 75% survival rate, including 5 out of 8 mice tumor-free, and one with about 100 mm.sup.3 tumor.

[0286] This surprising finding strongly suggests that simultaneously inhibiting Gal-9 function and the PD-1/PD-L1 immune checkpoint can synergistically inhibit tumor growth in vivo and prolong survival.

Example 7 Anti-Gal9 Antibodies are Stable

[0287] In order to confirm that the subject humanized anti-Gal9 antibodies are stable in storage, thus suitable for further development as a therapeutic agent, a variety of developability assays were run for selected humanized antibodies.

[0288] In the first experiment, 1-2.75 mg/mL of the subject humanized antibodies, HFB9-1hz1-hG1AA, HFB9-1 hz2-hG1AA, HFB9-1 hz3-hG1AA, HFB9-2hz11-hG1AA, and HFB9-2hz13 hG1 AA, were stored at 25 or 40° C. in PBS (pH7.4), and the stability of the various antibodies were determined on Days 0, 3, 7, and 14. The results (not show) demonstrated that all tested antibodies were stable at the conditions tested.

[0289] In the second experiment, the same antibodies were tested for stability under low pH conditions (100 mM AcH, pH3.5, 25° C.), for 0, 3, and 6 hours. The results (not show) again demonstrated that all tested antibodies were stable at the conditions tested.

[0290] In the third experiment, the same antibodies were subject to 1, 2, or 3 freeze-thaw cycles. The results (not show) again demonstrated that all tested antibodies were stable at the conditions tested.

Example 8 Galectin-9 Levels in Plasma and Serum from AML Patients

[0291] To determine the levels of Gal-9 in patient plasma and serum, peripheral blood samples from AML patients were obtained from the Clinical Hematology Department of the Gustave Roussy Institute (Villejuif, FRANCE), in accordance to Institutional Review Board-approved protocols. Informed consent was obtained from all patients, in accordance with the Declaration of Helsinki. Patients were stratified according to the French-American-British (FAB) classification criteria. Peripheral blood-derived plasma or serum from AML patients were prepared following standard procedures. For Healthy Donors, plasma or serum samples were obtained from commercial sources.

[0292] Galectin-9 protein levels in plasma or serum were assessed by ELISA, using the “Quantikine® ELISA Human Galectin-9” from R&D SYSTEMS® and statistical analyses (impaired, two-tailed t-tests) were performed using the PRISM® 5 for Windows software.

[0293] As shown in FIG. 10. Galectin-9 protein levels in plasma of AML patients at the diagnosis or relapse/refractory stages (R/R) of the disease were significantly higher than those observed in plasma from healthy individuals. Galectin-9 protein levels in plasma of AML patients at complete remission post chemotherapy were close to the normal, physiological range.

[0294] As shown in FIG. 11, Galectin-9 protein levels in plasma of FAB M2 or FAB M3 AML patients at diagnosis were significantly lower than those observed in plasma from FAB M0, M1, M4 or M5 AML patients. Galectin-9 protein levels in plasma of FAB M3 AML patients at diagnosis were within the normal, physiological range.

[0295] Additionally, the LGALS9 mRNA expression levels were examined in AML patients and healthy individuals. LGALS9 mRNA expression levels were extracted from the publicly available “AML . . . Ohsu . . . Nature 2018” dataset deposited by Tyner et al (see PMID 30333627 for a complete description of the study). Data are expressed as normalized log 2 RPKM in FIG. 12. Dotted lines represent the medians of LGALS9 levels in BM-derived MNC from healthy individuals or AML patients, respectively.

[0296] As shown in FIG. 12, Galectin-9-encoding mRNA levels in BM-derived MNC from AML patients at diagnosis (all FAB considered) were higher than those observed in BM-derived MNC or CD34+ cells from healthy individuals. Additionally. Galectin-9-encoding mRNA levels in BM-derived MNC from FAB M3 AML patients at diagnosis were significantly lower than those observed in BM-derived MNC from FAB M0, M1, M4 or M5 AML patients or from BM-derived MNC or CD34.sup.+ cells from healthy individuals.