COMPOSITIONS AND METHODS FOR MODULATING KINASE ACTIVITY

20180334510 ยท 2018-11-22

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention features an antibody mimetic, or an antigen binding fragment thereof, that specifically binds to an allosteric site of Aurora A kinase, therapeutic compositions comprising this antibody mimetic, and the use of the monobody to modulate Aurora A kinase for the treatment of cancer.

Claims

1. A fusion polypeptide comprising a first polypeptide and a second polypeptide fused to the first polypeptide, wherein the first polypeptide is an antibody mimetic, or an antigen binding fragment thereof, that specifically binds to an allosteric site of Aurora A kinase, and the second polypeptide comprises at least one of the following: (i) a fragment sufficient to mediate intracellular delivery of the antibody mimetic, (ii) an epitope tag, and (iii) a detectablemoiety.

2. The fusion polypeptide of claim 1, wherein the antibody mimetic is a monobody.

3. The fusion polypeptide of claim 1, wherein the antibody mimetic comprises any one of the following sequences: TABLE-US-00012 AuroraA_2(Mb2) (SEQIDNO:1) SVSSVPTKLEVVAATPTSLLISWDAFGHQYEPVYYYRI TYGETGGNSPVQEFTVPGYYSTATISGLKP GVDYTITVYAWYVDGSYSSPISINYRT AuroraA_44(Mb44) (SEQIDNO:2) SVSSVPTKLEVVAATPTSLLISWDAPAVTVDFYVITYG ETGGYSYPWQEFEVPGSKSTATISGLKPGV DYTITVYADYGQYFYSPISINYRT AuroraA_51(Mb51) (SEQIDNO:3) SVSSVPTKLEVVAATPTSLLISWDAKPMSYEPVYYYRI TYGETGGNSPVQEFTVPGYYSTATISGLKP GVDYTITVYADSMSSYYYSPISINYRT AuroraA_54(Mb54) (SEQIDNO:4) SVSSVPTKLEVVAATPTSLLISWDAQTYQMYDYVSYYR ITYGETGGNSPVQEFTVPGYYSTATISGLK PGVDYTITVYAEGYYSSYSPISINYRT AuroraA_56(Mb56) (SEQIDNO:5) SVSSVPTKLEVVAATPTSLLISWDAMSDWYYWVDYYRI TYGETGGNSPVQEFTVPGSYSTATISGLKP GVDYTITVYASDDVWGDYSPISINYRT AuroraA_60(Mb60) (SEQIDNO:6) SVSSVPTKLEVVAATPTSLLISWDAPAVTVVHYVITYG ETGGNSPVQEFTVPGSKSTATISGLKPGVD YTITVYAIDFYWGSYSPISINYRT

4. The fusion polypeptide of claim 1, wherein the fusion polypeptide binds to the allosteric site with affinity of at least about 1 nM, at least about 10 nM, at least about 100 nM, or at least about 1 M.

5. The fusion polypeptide of claim 1, wherein the allosteric site is a PIF pocket.

6. The fusion polypeptide of claim 1, wherein binding of the fusion polypeptide to the allosteric site alters an activity of Aurora A kinase.

7. The fusion polypeptide of claim 6, wherein the fusion polypeptide binding decreases kinase activity of Aurora A kinase.

8. The fusion polypeptide of claim 7, wherein the fusion polypeptide binding disrupts binding of TPX2 to Aurora A kinase.

9. The fusion polypeptide of claim 1, wherein the fragment is a supercharged polypeptide.

10. An isolated polynucleotide encoding a fusion polypeptide of claim 1.

11. An expression vector comprising a polynucleotide encoding an antibody mimetic, or an antigen binding fragment thereof, that specifically binds to an allosteric site of Aurora A kinase, and the second polypeptide comprises at least one of the following: (i) a fragment sufficient to mediate intracellular delivery of the antibody mimetic, (ii) an epitope tag, and (iii) a detectable moiety.

12. (canceled)

13. The expression vector of claim 11, wherein the polynucleotide encodes an amino acid sequence of at least one monobody selected from the group consisting of: Mb2, Mb44, Mb51, Mb56, Mb54, and Mb60.

14. A cell comprising the expression vector of claim 1.

15. (canceled)

16. A method of producing a fusion polypeptide comprising an antibody mimetic, or an antigen binding fragment thereof, that specifically binds to an allosteric site of Aurora A kinase, the method comprising (a) heterologously expressing an expression vector encoding the fusion polypeptide of claim 1 in a host cell; (b) isolating the fusion polypeptide from the host cell.

17. The method of claim 16, wherein the expression vector is the expression vector of claim 11.

18. (canceled)

19. A pharmaceutical composition comprising an effective amount of an antibody mimetic, or an antigen binding fragment thereof, that specifically binds to an allosteric site of Aurora A kinase.

20. A pharmaceutical composition comprising an effective amount of the fusion polypeptide of claim 1 or the polynucleotide or expression vector of claim 11.

21-23. (canceled)

24. A method of identifying an antibody mimetic that specifically binds to an allosteric site of Aurora A kinase, the method comprising (a) contacting a candidate antibody mimetic with an Aurora A kinase having an unbound allosteric site, (b) contacting the candidate antibody mimetic with an Aurora A kinase having a bound allosteric site or an Aurora A kinase mutant that has a mutation within an allosteric site, and (c) measuring binding of the candidate antibody mimetic with Aurora A kinase in step (a) and in step (b), wherein a candidate antibody mimetic having an increased binding to Aurora A kinase in step (a) relative to step (b) is identified as an antibody mimetic that specifically binds to an allosteric site of Aurora A kinase.

25-27. (canceled)

28. A method of modulating activity of an Aurora A kinase, inhibiting proliferation, and/or reducing survival of a cell, the method comprising contacting the Aurora A kinase with a polypeptide comprising an antibody mimetic, or antigen binding fragment thereof, that specifically binds to an allosteric site of Aurora A kinase.

29. (canceled)

30. A method of treating a cancer in a subject, the method comprising administering to the subject an effective amount of a composition comprising a polypeptide comprising an antibody mimetic, or antigen binding fragment thereof, that specifically binds to an allosteric site of Aurora A kinase, thereby treating the cancer in the subject.

31-43. (canceled)

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0082] FIGS. 1A-1C are sets of exemplary plots depicting the monobody selection strategy used to generate monobodies in a study described herein. FIG. 1A is a set of plots showing enrichment of pools of monobodies that bind more strongly to Aurora A than Aurora A-TPX2 chimera. Dark grey dots represent 50 nM Aurora A. Light grey dots represent 50 nM AuroraA-TPX2. FIG. 1B is a set of plots showing further refinement of selection by using Y199H and Y199K Aurora A hotspot mutants in negative selection rounds of current monobody pools. FIG. 1C is a set of plots showing binding of isolated monobody clones to Aurora A wild type, Y199H mutant Aurora A, or Y199K mutant Aurora A in a yeast display format. The dissociation constant (K.sub.d) shown in each plot is the K.sub.d for binding to wild type Aurora A.

[0083] FIGS. 2A-2F are plots showing that monobodies in the study described herein (Mb2, Mb44, Mb51, Mb56, Mb54, and Mb60) bind to Aurora A kinase with nanomolar (nM) to low micromolar (M) affinity. The plots show results of isothermal titration calorimetry experiments to measure the thermodynamics of the binding of monobodies Mb2 (FIG. 2A), Mb44 (FIG. 2B), Mb51 (FIG. 2C), Mb54 (FIG. 2D), Mb56 (FIG. 2E) and Mb60 (FIG. 2F) to dephosphorylated Aurora A (deP AurA). The dissociation constant (K.sub.d), heat of enthalpy (H), and heat of entropy (S) of each of the binding reactions are indicated in the respective figures.

[0084] FIG. 3 is a set of plots showing that monobodies in the study described herein (Mb2, Mb44, Mb51, Mb56, Mb54, and Mb60) can activate or inhibit Aurora A kinase activity. The top plot shows measurements of phosphorylation of kemptide (a peptide substrate for Aurora A kinase) when incubated with Aurora A kinase and TPX2, Mb2, Mb44, Mb51, Mb56, Mb54, and Mb60. The bottom plot shows a portion of the top plot, with the vertical axis re-scaled. The measurements indicate that the monobodies Mb2, Mb44, Mb51, Mb56, Mb54, and Mb60 modulate Aurora A kinase activity by activating or inhibiting Aurora A kinase activity, with various degrees of activation or inhibition.

[0085] FIGS. 4A-4E are images depicting the structural mechanism of inhibition or activation of Aurora A kinase by monobodies in the study described herein. FIG. 4A shows the inhibitory WY-motif of the monobody Mb60 (inhibitor of Aurora A kinase) locks an C-helix of Aurora A in an inactive conformation (FIG. 4A). FIG. 4B is a magnified view of the structures depicted in FIG. 4A, showing contact between Mb60 and Aurora A kinase. FIG. 4C shows that activating anchor points of the monobody Mb54 (activator of Aurora A kinase) push on the C-helix and coordinate Aurora A's activation loop to keep the kinase in an active conformation. FIG. 4D shows a magnified view of the anchor points of Mb54.

[0086] FIG. 4E shows how monobodies Mb60 (inhibitor) and Mb54 (activator) shift equilibria between active and inactive Aurora A kinase.

[0087] FIG. 5 shows purification of monobody Mb60 fused to supercharged GFP by gradient elution chromatography.

[0088] FIGS. 6A-6C are plots showing characterization of binding to Aurora A kinase and effect on Aurora A kinase activity of monobody Mb60 and monobody Mb60 fused to supercharged GFP (sGFP-Mb60). FIG. 6A is a plot showing Aurora A kinase activity when Aurora A kinase is incubated with monobody Mb60 (Mb60), monobody Mb60 fused to supercharged GFP (sGFP_Mb60), and no monobody (no Mb). FIG. 6A shows that Mb60 and sGFP-Mb60 both inhibit Aurora A kinase activity, but Mb60 more strongly inhibits Aurora A kinase than sGFP-Mb60. FIG. 6B is a set of plots depicting measurement of the thermodynamics of binding of Mb60 fused to supercharged GFP to Aurora A kinase (FIG. 6B) and binding of Mb60 to Aurora A kinase (FIG. 6C) using isothermal titration calorimetry. The dissociation constant (K.sub.d) of the binding reaction is indicated in the respective plots.

[0089] FIGS. 7A-7C are micrographs showing live cell images during optimization of delivery of monobody Mb60 fused to supercharged GFP (sGFP-Mb60) into cells using cationic liposomes. FIG. 7A depicts the optimization of delivery of sGFP-Mb60 (sGFP_Mb60) to cells. To optimize delivery, various concentrations (1 nM, 25 nM, 50 nM, and 500 nM) of sGFP-Mb60 were incubated with various amounts of cationic liposomes (2 l, 3 l, and 4 l), and delivery of sGFP-Mb60 was assayed by live cell imaging. Optimal delivery was achieved at a combination of 50 nM sGFP-Mb60 and 4 l cationic liposomes (FIG. 7B). FIG. 7C shows monitored delivery of sGFP-Mb60 to cells, at various incubation time points (0 hr, 1 hr, 7 hr, and 24 hr).

[0090] FIGS. 8A-8H are a series of micrographs showing intracellular locations of Aurora A kinase and monobody Mb60 fused to supercharged GFP (sGFP-Mb60) during various stages of the cell cycle. FIG. 8A shows high magnification views of DNA, Aurora A kinase (AurA), and sGFP-Mb60 (sGFP Mb60) during interphase, prophase, prometaphase, and metaphase. The micrographs at the top of FIG. 8A show visualization of Aurora A kinase in a cell during prophase (left) and metaphase (right) in a study described in Bischoff et al. (1998) EMBO J., 1; 17(11):3052-65. FIG. 8A shows co-localization of sGFP-Mb60 with Aurora A kinase during prophase, prometaphase, and metaphase. FIG. 8B is a set of micrographs depicting high magnification views of subsets of micrographs in FIG. 8A. The micrographs show DNA, Aurora A kinase (AurA), and sGFP-Mb60 in a cell during interphase (left column), prophase (middle column), and metaphase (right column). FIGS. 8C-8E are sets of micrographs further showing co-localization of sGFP-Mb60 with Aurora A kinase during metaphase. In each of FIGS. 8C-8E, the set of micrographs on the left show high magnification views of DNA, Aurora A kinase (AurA), and sGFP-Mb60 in a cell. The micrograph on the right of each of FIGS. 8C-8E is a low magnification view of the micrographs in the left, showing DNA (FIG. 8C), Aurora A kinase (FIG. 8D), and sGFP-Mb60 (FIG. 8E). FIG. 8F is a set of micrographs showing a low magnification view of micrographs in FIG. 8A showing DNA, Aurora A kinase, and sGFP-Mb60 in a cell in prometaphase. FIG. 8G is a set of micrographs showing a low magnification view of micrographs in FIG. 8A showing DNA, Aurora A kinase, and sGFP-Mb60 in a cell in interphase.

[0091] FIG. 9 is a set of micrographs showing DNA, Aurora A kinase, and TPX2 in a cell in prometaphase.

[0092] FIG. 10 is an image showing a setup of an experiment measuring cell death. FIG. 10 shows a 12-well plate containing samples of human embryonic kidney (HEK) cells with sGFP-Mb60 delivered via liposomes and appropriate control cells. Cell death in cell samples treated with sGFP-Mb60 (inhibitor of Aurora A kinase activity) was observed.

DETAILED DESCRIPTION OF THE INVENTION

[0093] The invention features compositions and methods that are useful for modulating kinase activity in a cell. The invention is based, at least in part, on the discovery that monobodies generated to specifically bind to a PIF pocket in Aurora A kinase differentially modulated Aurora A's kinase activity. The monobodies were found to activate or inhibit kinase activity of Aurora A, with varying strengths of activation or inhibition. Treatment of cells with monobodies inhibiting Aurora A activity was found to disrupt TPX2 binding to Aurora A, disrupt Aurora A localization to the spindles, and trigger cell death.

Antibody Mimetics Targeting an Allosteric Site (PIF Pocket) of Aurora a Kinase

[0094] Aurora A is an oncoprotein that is overexpressed in a multitude of cancers. Aurora A kinase is implicated in the regulation of mitotic entry and progression, spindle assembly, and spindle stability. Deregulation of Aurora A's kinase activity can result in defects in spindle assembly, chromosome alignment, and cytokinesis. Without intending to be bound by theory, overexpression of Aurora A kinase is believed to contribute to tumor formation, growth, and proliferation.

[0095] Thus, ways to inhibit Aurora A via small molecules have been actively pursued by researchers in both academia and industry. In particular, efforts to develop small molecule inhibitors of Aurora A's kinase activity have focused primarily on targeting Aurora A's ATP-binding site. However, these efforts generally have not focused on targeting the PIF pocket of Aurora A, an allosteric site on Aurora A. The allosteric site of Aurora A is bound by TPX2. In order to localize to the spindle microtubules and allow for proper progression of mitosis, Aurora A must bind to TPX2, and must be allosterically activated by TPX2. Binding of TPX2 to the PIF pocket of Aurora A allosterically activates Aurora A. Inhibitors of kinase activity of Aurora A that bind to the PIF pocket in Aurora A are not previously known.

[0096] Targeting the allosteric site (i.e., PIF pocket) of Aurora A kinase offers a more attractive strategy for inhibiting Aurora A's kinase activity. Unlike the ATP-binding pocket (the major target to date for kinase inhibitors as cancer drugs), which is highly conserved across kinases, the allosteric PIF pocket of human protein kinases is variable among different kinases, thereby offering the potential of developing much more specific kinase inhibitors. Using a highly specific kinase inhibitor is less likely to result in side effects.

[0097] Accordingly, the present invention features antibody mimetics, such as monobodies, that specifically bind to an allosteric site of Aurora A kinase. Monobodies are not routinely explored in the kinase field. Not many monobodies are known to bind kinases, although few examples are known (e.g., monobodies that bind to Abl).

[0098] In some embodiments, the antibody mimetic or monobody specifically binds to the PIF pocket of Aurora A kinase. In some other embodiments, binding of the antibody mimetic or monobody disrupts binding of TPX2 to Aurora A kinase The PIF pocket is a highly malleable interface that is ideal for drug discovery. Because the interaction surface between Aurora A and TPX2 is extensive and lacks the classic, small, confined, binding pocket that is preferred when designing small molecule inhibitors, an antibody mimetic such as a monobody could mimic best the TPX2 interaction and thus displace this protein. Further, due to phage display selection, antibody mimetics or monobodies having high selectivity and high affinity to the activation pocket (PIF pocket) of Aurora A could be generated. Also, using a small protein (such as a monobody) with high specificity for Aurora A instead of a small molecule compound (which tend to have low specificity) to inhibit Aurora A's kinase activity poses a lower risk of side effects.

[0099] Antibody mimetics or monobodies of the invention are highly specific to Aurora A kinase and have high affinity to Aurora A kinase. In some embodiments, antibody mimetics or monobodies of the invention bind Aurora A with affinities of at least about 1 nM, least about 5 nM, at least about 10 nM, least about 50 nM, least about 100 nM, least about 500 nM, least about 1 M, at least about 5 M, or at least about 10 M.

[0100] Antibody mimetics or monobodies of the invention are also capable of differentially modulating the kinase activity of Aurora A kinase. In some embodiments, binding of the antibody mimetic or monobody to the allosteric site alters an activity of Aurora A kinase. In some embodiments, the antibody mimetic or monobody modulates Aurora A's activity such that the rate of phosphorylation of a substrate by Aurora A kinase is increased by at least about 1.1. fold, at least about 1.2 fold, at least about 1.3 fold, at least about 1.4 fold, at least about 1.5 fold, at least about 1.6 fold, at least about 1.7 fold, at least about 1.8 fold, at least about 1.9 fold, at least about 2 fold, at least about 3 fold, at least about 4 fold, at least about 5 fold, at least about 6 fold, at least about 7 fold, at least about 8 fold, at least about 9 fold, at least about 10 fold, at least about 15 fold, and at least about 20 fold relative to a reference rate. In some other embodiments, the antibody mimetic or monobody modulates Aurora A's activity such that the rate of phosphorylation of a substrate by Aurora A kinase is decreased by at least about 1.1 fold, at least about 1.2 fold, at least about 1.3 fold, at least about 1.4 fold, at least about 1.5 fold, at least about 1.6 fold, at least about 1.7 fold, at least about 1.8 fold, at least about 1.9 fold, at least about 2 fold, at least about 3 fold, at least about 4 fold, at least about 5 fold, at least about 6 fold, at least about 7 fold, at least about 8 fold, at least about 9 fold, or at least about 10 fold relative to a reference rate. The reference rate may be, for example, the rate of phosphorylation of unbound Aurora A kinase (e.g. Aurora A kinase that is not contacted with any agent, such as TPX2) measured under substantially identical conditions (e.g., same temperature).

[0101] In particular embodiments, the antibody mimetic or monobody binds to the PIF pocket of Aurora A and inhibits or decreases Aurora A's kinase activity. In some embodiments, when an inhibitory antibody mimetic or monobody is added to an Aurora A-catalyzed reaction, the rate of Aurora A's phosphorylation of a substrate is decreased by at least about 1.1 fold, at least about 1.2 fold, at least about 1.3 fold, at least about 1.4 fold, at least about 1.5 fold, at least about 1.6 fold, at least about 1.7 fold, at least about 1.8 fold, at least about 1.9 fold, at least about 2 fold, at least about 3 fold, at least about 4 fold, at least about 5 fold, at least about 6 fold, at least about 7 fold, at least about 8 fold, at least about 9 fold, or at least about 10 fold. In other embodiments, the antibody or monobody binds to the PIF pocket of Aurora A and activates Aurora A's kinase activity. In particular embodiments, when an activating antibody mimetic or monobody is added to an Aurora A-catalyzed reaction, the rate of Aurora A's phosphorylation of a substrate is increased by at least about 1.1. fold, at least about 1.2 fold, at least about 1.3 fold, at least about 1.4 fold, at least about 1.5 fold, at least about 1.6 fold, at least about 1.7 fold, at least about 1.8 fold, at least about 1.9 fold, at least about 2 fold, at least about 3 fold, at least about 4 fold, at least about 5 fold, at least about 6 fold, at least about 7 fold, at least about 8 fold, at least about 9 fold, at least about 10 fold, at least about 15 fold, and at least about 20 fold.

[0102] Antibody mimetics or monobodies of the invention were generated using a novel screening assay. The screening assay comprised (a) contacting a candidate antibody mimetic with an Aurora A kinase having an unbound allosteric site, (b) contacting the candidate antibody mimetic with an Aurora A kinase having a bound allosteric site or an Aurora A kinase mutant that has a mutation within an allosteric site, and (c) measuring binding of the candidate antibody mimetic with Aurora A kinase in step (a) and in step (b). A candidate antibody mimetic having an increased binding to Aurora A kinase in step (a) relative to step (b) was then identified as a potential antibody mimetic that specifically bound to an allosteric site (PIF pocket) of Aurora A kinase.

[0103] The screening assay for generating antibody mimetics or monobodies of the invention overcomes problems associated with generation of monobodies binding to other sites of Aurora A (e.g., Aurora A's ATP binding site). As described elsewhere herein, antibody mimetics or monobodies specifically binding a target are typically generated by sorting libraries of antibody mimetics for those that bind the desired target (e.g., Aurora A). However, merely selecting antibody mimetics or monobodies for those binding to Aurora A generates monobodies that potentially bind to any site on Aurora A, rather than monobodies that bind specifically to the allosteric site (PIF pocket) of Aurora A. Thus, to select only those antibody mimetics or monobodies that specifically bound the allosteric site (PIF pocket) of Aurora A, in addition to performing a first round of selection for antibody mimetics or monobodies binding to Aurora A, a second round of selection for antibody mimetics or monobodies that did not bind to an Aurora A-TPX2 chimeric construct (i.e., Aurora A kinase having a bound PIF pocket or allosteric site) or an Aurora A kinase mutant that has a mutation within an allosteric site was performed. The second round of negative selection for monobodies using the mutant Aurora A ensured that monobodies binding to other portions of Aurora A (e.g., ATP-binding site) were eliminated from the screen, thus enriching the pool of monobodies with only those binding to the allosteric site (PIF pocket) of Aurora A kinase.

[0104] The structure of the antibody mimetics or monobodies of the present invention are advantageous for multiple applications because they (1) lack disulfide bonds, rendering them resistant against reducing agents; (2) are very stable even at high temperature; and (3) can be produced in a bacterial expression system with yields of up to 50-100 mg per liter of culture. Moreover, because they are derived from the endogenous human protein fibronectin, which is non-immunogenic, it is believed that the antibody mimetics or monobodies will not elicit an immune response. As a small, single-chain molecule, DNA encoding the antibody mimetics or monobodies can be incorporated into gene delivery vectors (e.g. viral vectors, liposomes) for cell or tissue-specific gene expression. As a result of these properties, the antibody mimetics or monobodies of the present invention can be used to treat or prevent a number of cancers or Aurora A-associated diseases or disorders as well as for diagnostic imaging of Aurora A-expressing tissues (e.g., tumors or cancers overexpressing Aurora A). Accordingly, the invention provides methods of producing recombinant polypeptides comprising antibody mimetics or monobodies specifically binding to Aurora A's PIF pocket and methods of using these polypeptides to treat a cancer or an Aurora A-associated disease.

Recombinant Polypeptide Expression

[0105] The invention provides recombinant antibody mimetics (in particular, monobodies) and fusion polypeptides comprising the antibody mimetics, which are useful for treating a cancer or inhibiting growth and/or proliferation of a cancer in a subject. When delivered to a cell (particularly a cancer cell), the polypeptides of the invention modulate or inhibit Aurora A's kinase activity in a cell, disrupt TPX2 binding to Aurora A kinase, and/or disrupt Aurora A's localization to the spindles. Inhibition of Aurora A's kinase activity and/or disruption of any of Aurora A's other activities (e.g., binding with TPX2 or localization to the spindles) causes cell death.

[0106] Recombinant polypeptides of the invention are produced using virtually any method known to the skilled artisan. Typically, recombinant polypeptides are produced by transformation of a suitable host cell with all or part of a polypeptide-encoding nucleic acid molecule or fragment thereof in a suitable expression vehicle. Accordingly, the invention provides methods of producing a polypeptide of the invention, the method comprising (a) heterologously expressing an expression vector comprising a polynucleotide encoding the polypeptide in a host cell; and (b) isolating the polypeptide from the host cell.

[0107] Those skilled in the field of molecular biology will understand that any of a wide variety of expression systems may be used to provide the recombinant protein. The precise host cell used is not critical to the invention. A polypeptide of the invention may be produced in a prokaryotic host (e.g., E. coli) or in a eukaryotic host (e.g., Saccharomyces cerevisiae, insect cells, e.g., Sf21 cells, or mammalian cells, e.g., NIH 3T3, HeLa, COS cells). Such cells are available from a wide range of sources (e.g., the American Type Culture Collection, Rockland, Md.; also, see, e.g., Ausubel et al., Current Protocol in Molecular Biology, New York: John Wiley and Sons, 1997). The method of transformation or transfection and the choice of expression vehicle will depend on the host system selected. Transformation and transfection methods are described, e.g., in Ausubel et al. (supra); expression vehicles may be chosen from those provided, e.g., in Cloning Vectors: A Laboratory Manual (P. H. Pouwels et al., 1985, Supp. 1987).

[0108] A variety of expression systems exist for the production of the polypeptides of the invention. Expression vectors useful for producing such polypeptides include, without limitation, chromosomal, episomal, and virus-derived vectors, e.g., vectors derived from bacterial plasmids, from bacteriophage, from transposons, from yeast episomes, from insertion elements, from yeast chromosomal elements, from viruses such as baculoviruses, papova viruses, such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses and retroviruses, and vectors derived from combinations thereof.

[0109] In some embodiments, the polypeptides of the invention are produced in a bacterial expression system with yields of up to 50-100 mg per liter of culture. One particular bacterial expression system for polypeptide production is the E. coli pET expression system (e.g., pET-28) (Novagen, Inc., Madison, Wis.). According to this expression system, DNA encoding a polypeptide is inserted into a pET vector in an orientation designed to allow expression. Since the gene encoding such a polypeptide is under the control of the T7 regulatory signals, expression of the polypeptide is achieved by inducing the expression of T7 RNA polymerase in the host cell. This is typically achieved using host strains that express T7 RNA polymerase in response to IPTG induction. Once produced, recombinant polypeptide is then isolated according to standard methods known in the art, for example, those described herein.

[0110] Another bacterial expression system for polypeptide production is the pGEX expression system (Pharmacia). This system employs a GST gene fusion system that is designed for high-level expression of genes or gene fragments as fusion proteins with rapid purification and recovery of functional gene products. The protein of interest is fused to the carboxyl terminus of the glutathione S-transferase protein from Schistosoma japonicum and is readily purified from bacterial lysates by affinity chromatography using Glutathione Sepharose 4B. Fusion proteins can be recovered under mild conditions by elution with glutathione. Cleavage of the glutathione S-transferase domain from the fusion protein is facilitated by the presence of recognition sites for site-specific proteases upstream of this domain. For example, proteins expressed in pGEX-2T plasmids may be cleaved with thrombin; those expressed in pGEX-3X may be cleaved with factor Xa.

[0111] Alternatively, recombinant polypeptides of the invention are expressed in Pichia pastoris, a methylotrophic yeast. Pichia is capable of metabolizing methanol as the sole carbon source. The first step in the metabolism of methanol is the oxidation of methanol to formaldehyde by the enzyme, alcohol oxidase. Expression of this enzyme, which is coded for by the AOX1 gene is induced by methanol. The AOX1 promoter can be used for inducible polypeptide expression or the GAP promoter for constitutive expression of a gene of interest.

[0112] Once the recombinant polypeptide of the invention is expressed, it is isolated, for example, using affinity chromatography. In one example, an antibody (e.g., produced as described herein) raised against a polypeptide of the invention may be attached to a column and used to isolate the recombinant polypeptide. In some embodiments, to facilitate purification of the recombinant polypeptide, the polypeptide comprises an epitope tag fused to antibody mimetic or monobody. The polypeptide is then isolated using an antibody against the epitope tag. Lysis and fractionation of polypeptide-harboring cells prior to affinity chromatography may be performed by standard methods (see, e.g., Ausubel et al., supra). Alternatively, the polypeptide is isolated using a sequence tag, such as a hexahistidine tag, that binds to nickel column. Once isolated, the recombinant protein can, if desired, be further purified, e.g., by high performance liquid chromatography (see, e.g., Fisher, Laboratory Techniques In Biochemistry and Molecular Biology, eds., Work and Burdon, Elsevier, 1980). Polypeptides of the invention, particularly short peptide fragments, can also be produced by chemical synthesis (e.g., by the methods described in Solid Phase Peptide Synthesis, 2nd ed., 1984 The Pierce Chemical Co., Rockford, Ill.). These general techniques of polypeptide expression and purification can also be used to produce and isolate useful peptide fragments or analogs (described herein).

[0113] In addition, or in the alternative, the polypeptides or fusion polypeptides of the invention may be produced using chemical methods to synthesize the desired amino acid sequence, in whole or in part. For example, polypeptides can be synthesized by solid phase techniques, cleaved from the resin, and purified by preparative high performance liquid chromatography (e.g., Creighton (1983) Proteins: Structures And Molecular Principles, WH Freeman and Co, New York N.Y.). The composition of the synthetic polypeptides may be confirmed by amino acid analysis or sequencing (e.g., the Edman degradation procedure). Additionally, the amino acid sequence of a fusion polypeptide of the invention, or any part thereof, may be altered during direct synthesis and/or combined using chemical methods with a sequence from other subunits, or any part thereof, to produce a variant polypeptide.

Assays for Activity of Fusion Polypeptide

[0114] Any of the kinase activity and/or kinetics or binding assays known in the art or described herein may be used to measure the binding or effect on Aurora A kinase of the fusion polypeptides of the invention. For example, the inhibitory or activating effect of a fusion polypeptide comprising a monobody of the invention fused to a supercharged polypeptide (e.g., a supercharged GFP) may be measured by contacting the fusion polypeptide with Aurora A kinase in the presence of a substrate of Aurora A kinase (e.g., ATP, kemptide), and measuring a rate of phosphorylation of the substrate. The measured rate may be compared with a reference rate. The reference rate may be, for example, the rate of phosphorylation of the substrate by Aurora A kinase contacted with a monobody not fused to any other polypeptide. The reference rate may also be the rate of phosphorylation of the substrate by Aurora A kinase not contacted with any agent.

[0115] The rates are then compared to determine whether the fusion polypeptide comprising the monobody has similar activity to the monobody by itself (e.g., increases or decreases Aurora A's kinase activity to the same degree, or to a lesser or greater degree). In some embodiments, the fusion polypeptide comprising a monobody fused to a supercharged polypeptide (e.g., a supercharged GFP) has activity that is identical or similar to the monobody not fused to another polypeptide. For example, a fusion polypeptide comprising a monobody fused to a supercharged polypeptide decreases or increases Aurora A's kinase activity (e.g., rate of phosphorylation of a substrate) to a degree within about 5%, about 10%, or about 20% of the decrease or increase of Aurora A's kinase activity by the monobody by itself. In some embodiments, the fusion polypeptide comprising an inhibitory monobody fused to a supercharged polypeptide inhibits Aurora A's kinase activity to a lesser degree than inhibition of Aurora A kinase activity by the monobody by itself (i.e., not fused to another polypeptide).

[0116] Binding affinity of a fusion polypeptide to Aurora A kinase may also be measured according to methods known in the art or described herein. The affinity of binding of the fusion polypeptide comprising a monobody to Aurora A kinase may be compared to a reference affinity (e.g., the affinity of binding of the monobody by itself (not fused to another polypeptide) to Aurora A kinase). In some embodiments, the affinity of binding of the fusion polypeptide comprising a monobody fused to a supercharged polypeptide is within about 5%, about 10% or about 20% of the affinity of binding of the monobody by itself (i.e., not fused to another polypeptide) to Aurora A kinase.

Methods of Treatment

[0117] The present invention provides methods using polypeptides comprising antibody mimetics, monobodies, or fragments thereof, for treatment of cancer. As described herein, Aurora A kinase is overexpressed in many cancer types and is believed to contribute to cancer formation and growth. Antibody mimetics or monobodies of the invention are able to (1) inhibit activity of Aurora A, and (2) disrupt Aurora A localization to the spindles. As described herein, inhibition of Aurora A's kinase activity and disruption of localization of Aurora A to the spindles in a cell (in particular, a cancer cell) triggers cell death.

[0118] Thus, the present invention provides methods of inhibiting proliferation and/or reducing survival of a cancer cell and methods of treating a cancer or symptoms thereof, which comprise administering a therapeutically effective amount of a pharmaceutical composition comprising an antibody mimetic, monobody, of fragment thereof (or a polynucleotide encoding the antibody mimetic, monobody, of fragment thereof), herein to a subject (e.g., a mammal such as a human). One embodiment is a method of treating a subject suffering from or susceptible to a cancer or disorder or symptom thereof, particularly a cancer associated with overexpressed Aurora A kinase or deregulated Aurora A kinase activity. The method includes the step of administering to the mammal a therapeutic amount of the antibody mimetic, monobody, or polynucleotide herein sufficient to treat the disease or disorder or symptom thereof, under conditions such that the disease or disorder is treated.

[0119] The methods herein include administering to the subject (including a subject identified as in need of such treatment) an effective amount of an antibody mimetic, monobody, or polynucleotide described herein, or a composition described herein to produce such effect. Identifying a subject in need of such treatment can be in the judgment of a subject or a health care professional and can be subjective (e.g. opinion) or objective (e.g. measurable by a test or diagnostic method).

[0120] As used herein, the terms treat, treating, treatment, and the like refer to reducing or ameliorating a disorder and/or symptoms associated therewith. It will be appreciated that, although not precluded, treating a disorder or condition does not require that the disorder, condition or symptoms associated therewith be completely eliminated.

[0121] As used herein, the terms prevent, preventing, prevention, prophylactic treatment and the like refer to reducing the probability of developing a disorder or condition in a subject, who does not have, but is at risk of or susceptible to developing a disorder or condition.

[0122] The therapeutic methods of the invention (which include prophylactic treatment) in general comprise administration of a therapeutically effective amount of the agents herein, such as an antibody mimetic, monobody, of fragment thereof (or a polynucleotide encoding the antibody mimetic, monobody, of fragment thereof) herein to a subject (e.g., animal, human) in need thereof, including a mammal, particularly a human. Such treatment will be suitably administered to subjects, particularly humans, suffering from, having, susceptible to, or at risk for a disease, disorder, or symptom thereof. Determination of those subjects at risk can be made by any objective or subjective determination by a diagnostic test or opinion of a subject or health care provider (e.g., genetic test, enzyme or protein marker, activity or expression of Aurora A kinase, family history, and the like). The therapeutic agents herein may be also used in the treatment of any other disorders in which Aurora A kinase may be implicated.

[0123] In one embodiment, the invention provides a method of monitoring treatment progress. The method includes the step of determining a level of activity of a kinase (e.g., any target delineated herein modulated by an antibody mimetic or monobody herein, such as Aurora A kinase) or diagnostic measurement (e.g., screen, assay) in a subject suffering from or susceptible to a disorder or symptoms thereof associated with Aurora A kinase, in which the subject has been administered a therapeutic amount of an antibody mimetic, monobody, or polynucleotide herein sufficient to treat the disease or symptoms thereof. An activity of Aurora A may include, for example, Aurora A's kinase activity, localization to the spindles, or functions during mitotic progress. The activity level of Aurora A determined in the method can be compared to known activity levels of Aurora A in either healthy normal controls or in other afflicted patients to establish the subject's disease status. In preferred embodiments, a second activity level of Aurora A in the subject is determined at a time point later than the determination of the first level, and the two levels are compared to monitor the course of disease or the efficacy of the therapy. In certain preferred embodiments, a pre-treatment level of Aurora A activity in the subject is determined prior to beginning treatment according to this invention; this pre-treatment level of Aurora A activity can then be compared to the level of activity of Aurora A in the subject after the treatment commences, to determine the efficacy of the treatment.

Methods of Delivery

[0124] Antibody mimetics or monobodies of the invention, which are useful for specifically modulating or inhibiting Aurora A kinase in a cell, may be delivered to a cell (particularly a cancer cell) in any manner such that the antibody mimetic or monobody is in functional form in the cell. The antibody mimetic or monobody may be delivered to cells as polypeptides. Alternatively, a polynucleotide encoding an amino acid sequence of the antibody mimetic or monobody may be delivered to cells for heterologous expression of the antibody mimetic or monobody in the cells. Thus, the present invention features monobodies or polypeptides delivered to a cell by contacting the cell with a composition comprising the monobody or polypeptide or by heterologously expressing the monobody or polypeptide in the cell.

Intracellular Delivery of Polypeptides

[0125] Polypeptides of the invention, such as antibody mimetics or monobodies, may be delivered intracellularly to cells. The polypeptide must be delivered to the cells of a subject in a form in which they can be taken up so that therapeutically effective levels of the antibody mimetic or monobody, or fragment thereof, is in functional form in the cells.

[0126] Methods of intracellular delivery of polypeptides are known to one of skill in the art. Exemplary methods of intracellular delivery of polypeptides include, without limitation, incorporation of the polypeptide into a liposome. Liposomes are phospholipid vesicles with sizes varying from 50 to 1000 nm, which can be loaded with polypeptides or other agents. Liposomal intracellular delivery of polypeptides into cells typically relies on endocytosis of the liposome-encapsulated polypeptide into the cell. Examples of suitable liposomes for intracellular delivery of polypeptides may be pH-sensitive liposomes. Such liposomes are made of pH-sensitive components; after being endocytosed in intact form, the liposome fuses with the endovacuolar membrane under lowered pH inside the endosome and destabilizes it, thereby releasing the contents (including the polypeptides encapsulated in the liposome) into the cytoplasm. The liposomes may also be further modified to enhance their stability or lifetime during circulation (e.g., by PEGylated liposomes). Liposomes may also be modified to specifically target antigens (e.g., immunoliposomes or liposomes embedded with antibodies an antigen). Antibody-bearing liposomes may have the advantages of targetability and facilitated uptake via receptor-mediated endocytosis.

[0127] Other methods of intracellular delivery of polypeptides include, without limitation, use of cell penetrating peptides (CPPs). A cell penetrating peptide or CPP is a protein or peptide that can translocate through cellular membranes. A polypeptide for delivery into a cell is fused with a CPP, thereby enabling or enhancing delivery of the polypeptide fusion into the cell. Cell penetrating peptides include, for example, a trans-activating transcriptional activator (TAT) from HIV-1, Antenapedie (Antp, a transcription factor in Drosophila), and VP22 (a herpes virus protein).

[0128] Another exemplary method for intracellular delivery of polypeptides of the invention is the use of supercharged proteins. Supercharged proteins or supercharged polypeptides are a class of engineered or naturally existing polypeptides having an unusually high positive or negative net theoretical charge. Membranes of cells are typically negatively charged. Superpositively charged polypeptides are able to penetrate cells (particularly mammalian cells), and associating cargo with superpositively charged polypeptides (e.g., polypeptides or polynucleotides) can enable functional delivery of these macromolecules into cells, in vitro or in vivo. Methods of generating supercharged polypeptides and using supercharged polypeptides for intracellular polypeptide delivery are described in further detail in, for example, Zuris et al. Nat. Biotechnol. (2015) 33:73-80 and Liu et al. Methods Enzymol. 2012, 503: 293-319.

[0129] The present invention features a monobody fused to a supercharged fragment sufficient to mediate intracellular delivery of the polypeptide. Supercharged polypeptides (or fusion polypeptides) may also be used in combination with charged liposomes to enable efficient delivery of polypeptides in a cell. In some embodiments, the polypeptides (antibody mimetics or monobodies) of the invention are delivered intracellularly by fusion of the polypeptide with a supercharged polypeptide (e.g., supercharge green fluorescent protein (GFP)). The supercharged polypeptide may be supernegatively charged. In some other embodiments, the polypeptide fusions (e.g. antibody mimetic or monobody fused to a supercharged polypeptide) are incorporated into a liposome. In particular embodiments, the liposome is a cationic liposome. The cationic liposomes bearing supercharged antibody mimetic or monody fusion are contacted with cells and efficiently delivered into the cells in functional form.

Polynucleotide Therapy

[0130] Another therapeutic approach for treating a cancer or a disease associated with Aurora A is polynucleotide therapy using a polynucleotide encoding an antibody mimetic or monobody of the invention, or an antigen binding fragment thereof. Thus, provided herein are isolated polynucleotides encoding an antibody mimetic or monobody of the invention, or an antigen binding fragment thereof. Expression of such polynucleotides or nucleic acid molecules in a cancer cell is expected to reduce survival of the cell and/or increase cell death. Such nucleic acid molecules can be delivered to cells of a subject having a cancer. The nucleic acid molecules must be delivered to the cells of a subject in a form in which they can be taken up so that therapeutically effective levels of the antibody mimetic or monobody, or fragment thereof, can be produced.

[0131] Transducing viral (e.g., retroviral, adenoviral, and adeno-associated viral) vectors can be used for somatic cell gene therapy, especially because of their high efficiency of infection and stable integration and expression (see, e.g., Cayouette et al., Human Gene Therapy 8:423-430, 1997; Kido et al., Current Eye Research 15:833-844, 1996; Bloomer et al., Journal of Virology 71:6641-6649, 1997; Naldini et al., Science 272:263-267, 1996; and Miyoshi et al., Proc. Natl. Acad. Sci. U.S.A. 94:10319, 1997). For example, a polynucleotide encoding an antibody mimetic or monobody, or a fragment thereof, can be cloned into a retroviral vector and expression can be driven from its endogenous promoter, from the retroviral long terminal repeat, or from a promoter specific for a target cell type of interest. Other viral vectors that can be used include, for example, a vaccinia virus, a bovine papilloma virus, or a herpes virus, such as Epstein-Barr Virus (also see, for example, the vectors of Miller, Human Gene Therapy 15-14, 1990; Friedman, Science 244:1275-1281, 1989; Eglitis et al., BioTechniques 6:608-614, 1988; Tolstoshev et al., Current Opinion in Biotechnology 1:55-61, 1990; Sharp, The Lancet 337:1277-1278, 1991; Cornetta et al., Nucleic Acid Research and Molecular Biology 36:311-322, 1987; Anderson, Science 226:401-409, 1984; Moen, Blood Cells 17:407-416, 1991; Miller et al., Biotechnology 7:980-990, 1989; Le Gal La Salle et al., Science 259:988-990, 1993; and Johnson, Chest 107:77S-83S, 1995). Retroviral vectors are particularly well developed and have been used in clinical settings (Rosenberg et al., N. Engl. J. Med 323:370, 1990; Anderson et al., U.S. Pat. No. 5,399,346). In some embodiments, a viral vector is used to administer a polynucleotide encoding an antibody mimetic or monobody (or fragment thereof) systemically.

[0132] Non-viral approaches can also be employed for the introduction of therapeutic to a cell of a patient requiring inhibition of a cancer or induction of cell death in a cancer. For example, a nucleic acid molecule can be introduced into a cell by administering the nucleic acid in the presence of lipofection (Feigner et al., Proc. Natl. Acad. Sci. U.S.A. 84:7413, 1987; Ono et al., Neuroscience Letters 17:259, 1990; Brigham et al., Am. J. Med. Sci. 298:278, 1989; Staubinger et al., Methods in Enzymology 101:512, 1983), asialoorosomucoid-polylysine conjugation (Wu et al., Journal of Biological Chemistry 263:14621, 1988; Wu et al., Journal of Biological Chemistry 264:16985, 1989), or by micro-injection under surgical conditions (Wolff et al., Science 247:1465, 1990). Preferably the nucleic acids are administered in combination with a liposome and protamine.

[0133] Gene transfer can also be achieved using non-viral means involving transfection in vitro. Such methods include the use of calcium phosphate, DEAE dextran, electroporation, and protoplast fusion. Liposomes can also be potentially beneficial for delivery of DNA into a cell. Transplantation of normal genes into the affected tissues of a patient can also be accomplished by transferring a normal nucleic acid into a cultivatable cell type ex vivo (e.g., an autologous or heterologous primary cell or progeny thereof), after which the cell (or its descendants) are injected into a targeted tissue.

[0134] cDNA expression for use in polynucleotide therapy methods can be directed from any suitable promoter (e.g., the human cytomegalovirus (CMV), simian virus 40 (SV40), or metallothionein promoters), and regulated by any appropriate mammalian regulatory element. For example, if desired, enhancers known to preferentially direct gene expression in specific cell types can be used to direct the expression of a nucleic acid. The enhancers used can include, without limitation, those that are characterized as tissue- or cell-specific enhancers. Alternatively, if a genomic clone is used as a therapeutic construct, regulation can be mediated by the cognate regulatory sequences or, if desired, by regulatory sequences derived from a heterologous source, including any of the promoters or regulatory elements described above.

Pharmaceutical Compositions

[0135] The present invention features compositions useful for treating a cancer in a subject. In some embodiments, the composition comprises an antibody mimetic, monobody, or fragment thereof, that specifically binds to an allosteric site (PIF pocket) of Aurora A kinase. In some other embodiments, the composition comprises a polynucleotide encoding an amino acid sequence of the antibody mimetic, monobody, or fragment thereof. In particular embodiments, the composition further comprises a liposome.

[0136] The administration of a composition comprising an antibody mimetic, monobody, or polynucleotide herein for the treatment of a cancer may be by any suitable means that results in a concentration of the therapeutic that, combined with other components, is effective in ameliorating, reducing, or stabilizing a cancer in a subject. The composition may be administered systemically, for example, formulated in a pharmaceutically-acceptable buffer such as physiological saline. Preferable routes of administration include, for example, subcutaneous, intravenous, interperitoneally, intramuscular, or intradermal injections that provide continuous, sustained levels of the agent in the patient. The amount of the therapeutic agent to be administered varies depending upon the manner of administration, the age and body weight of the patient, and with the clinical symptoms of the cancer. Generally, amounts will be in the range of those used for other agents used in the treatment of cancer or other diseases associated with Aurora A kinase, although in certain instances lower amounts will be needed because of the increased specificity of the agent. A composition is administered at a dosage that inhibits Aurora A activity or that decreases cancer cell proliferation as determined by a method known to one skilled in the art.

[0137] The antibody mimetic, monobody, or polynucleotide may be contained in any appropriate amount in any suitable carrier substance, and is generally present in an amount of 1-95% by weight of the total weight of the composition. The composition may be provided in a dosage form that is suitable for parenteral (e.g., subcutaneously, intravenously, intramuscularly, or intraperitoneally) administration route. The pharmaceutical compositions may be formulated according to conventional pharmaceutical practice (see, e.g., Remington: The Science and Practice of Pharmacy (20th ed.), ed. A. R. Gennaro, Lippincott Williams & Wilkins, 2000 and Encyclopedia of Pharmaceutical Technology, eds. J. Swarbrick and J. C. Boylan, 1988-1999, Marcel Dekker, New York).

[0138] Pharmaceutical compositions according to the invention may be formulated to release the active agent substantially immediately upon administration or at any predetermined time or time period after administration. The latter types of compositions are generally known as controlled release formulations, which include (i) formulations that create a substantially constant concentration of the drug within the body over an extended period of time; (ii) formulations that after a predetermined lag time create a substantially constant concentration of the drug within the body over an extended period of time; (iii) formulations that sustain action during a predetermined time period by maintaining a relatively, constant, effective level in the body with concomitant minimization of undesirable side effects associated with fluctuations in the plasma level of the active substance (sawtooth kinetic pattern); (iv) formulations that localize action by, e.g., spatial placement of a controlled release composition adjacent to or in contact with a tumor; (v) formulations that allow for convenient dosing, such that doses are administered, for example, once every one or two weeks; and (vi) formulations that target a cancer using carriers or chemical derivatives to deliver the therapeutic agent to a particular cell type (e.g., cancer cell). For some applications, controlled release formulations obviate the need for frequent dosing during the day to sustain the plasma level at a therapeutic level.

[0139] Any of a number of strategies can be pursued in order to obtain controlled release in which the rate of release outweighs the rate of metabolism of the agent in question. In one example, controlled release is obtained by appropriate selection of various formulation parameters and ingredients, including, e.g., various types of controlled release compositions and coatings. Thus, the therapeutic is formulated with appropriate excipients into a pharmaceutical composition that, upon administration, releases the therapeutic in a controlled manner. Examples include single or multiple unit tablet or capsule compositions, oil solutions, suspensions, emulsions, microcapsules, microspheres, molecular complexes, nanoparticles, patches, and liposomes.

[0140] The pharmaceutical composition may be administered parenterally by injection, infusion or implantation (subcutaneous, intravenous, intramuscular, intraperitoneal, or the like) in dosage forms, formulations, or via suitable delivery devices or implants containing conventional, non-toxic pharmaceutically acceptable carriers and adjuvants. The formulation and preparation of such compositions are well known to those skilled in the art of pharmaceutical formulation. Formulations can be found in Remington: The Science and Practice of Pharmacy, supra.

[0141] Compositions for parenteral use may be provided in unit dosage forms (e.g., in single-dose ampoules), or in vials containing several doses and in which a suitable preservative may be added (see below). The composition may be in the form of a solution, a suspension, an emulsion, an infusion device, or a delivery device for implantation, or it may be presented as a dry powder to be reconstituted with water or another suitable vehicle before use. Apart from the active agent that reduces or ameliorates a cancer, the composition may include suitable parenterally acceptable carriers and/or excipients. The active therapeutic agent(s) (e.g., an antibody mimic, monobody, or polynucleotide described herein) may be incorporated into microspheres, microcapsules, nanoparticles, liposomes, or the like for controlled release. Furthermore, the composition may include suspending, solubilizing, stabilizing, pH-adjusting agents, tonicity adjusting agents, and/or dispersing, agents.

[0142] In some embodiments, the composition comprising the active therapeutic (i.e., a monobody, antibody mimetic, or polynucleotide herein) is formulated for intravenous delivery. As indicated above, the pharmaceutical compositions according to the invention may be in the form suitable for sterile injection. To prepare such a composition, the suitable therapeutic(s) are dissolved or suspended in a parenterally acceptable liquid vehicle. Among acceptable vehicles and solvents that may be employed are water, water adjusted to a suitable pH by addition of an appropriate amount of hydrochloric acid, sodium hydroxide or a suitable buffer, 1,3-butanediol, Ringer's solution, and isotonic sodium chloride solution and dextrose solution. The aqueous formulation may also contain one or more preservatives (e.g., methyl, ethyl or n-propyl p-hydroxybenzoate). In cases where one of the agents is only sparingly or slightly soluble in water, a dissolution enhancing or solubilizing agent can be added, or the solvent may include 10-60% w/w of propylene glycol or the like.

Combination Therapies

[0143] Optionally, an anti-cancer therapeutic of the invention (e.g., an antibody mimetic, monobody, or polynucleotide described herein) may be administered in combination with any other standard anti-cancer therapy; such methods are known to the skilled artisan and described in Remington's Pharmaceutical Sciences by E. W. Martin.

Screening Assays Using Monobodies

[0144] Antibody mimetics or monobodies of the present invention are useful tools for investigating kinase activation mechanisms (particularly, activation of Aurora A kinase) in vitro and in vivo. Accordingly, the invention provides a method of modulating activity of an Aurora A kinase, the method comprising contacting the Aurora A kinase with an antibody mimetic or monobody of the invention. In some embodiments, the antibody mimetic or monobody contacts Aurora A kinase in vitro. In other embodiments, the antibody mimetic or monobody contacts Aurora A kinase in a cell. It is expected that use of a monobody to disrupt an extensive protein-protein interaction area will be useful for advancing research and investigation of mechanisms of kinase (particularly, Aurora A kinase) regulation and activities in cancer. The dual effect of disruption of allosteric activation and localization, and the specific effect of the monobodies on Aurora A's function in the spindles while keeping its function in the centrosome intact offers a unique intrinsic control of Aurora A's activities that may be useful in certain experiments, particularly live-cell imaging experiments using the monobodies. To facilitate detection of the antibody mimetics or monobodies of the invention (particularly in live-cell imaging experiments), fusion polypeptides comprising an antibody mimetic or monobody fused to a detectable tag are provided herein.

Kits

[0145] The invention provides kits for the treatment or prevention of cancer, particularly cancers associated with overexpression of Aurora A kinase. In one embodiment, the kit includes a therapeutic or prophylactic composition containing an effective amount of an antibody mimetic, monobody, or fragment thereof (or a polynucleotide encoding such) in unit dosage form. In some embodiments, the kit comprises a sterile container which contains a therapeutic or prophylactic composition; such containers can be boxes, ampoules, bottles, vials, tubes, bags, pouches, blister-packs, or other suitable container forms known in the art. Such containers can be made of plastic, glass, laminated paper, metal foil, or other materials suitable for holding medicaments.

[0146] If desired a composition comprising a therapeutic agent (e.g., antibody mimetic, monobody, or polynucleotide) of the invention is provided together with instructions for administering the agent to a subject having or at risk of developing cancer. The instructions will generally include information about the use of the composition for the treatment or prevention of cancer. In other embodiments, the instructions include at least one of the following: description of the therapeutic agent; dosage schedule and administration for treatment or prevention of ischemia or symptoms thereof; precautions; warnings; indications; counter-indications; overdosage information; adverse reactions; animal pharmacology; clinical studies; and/or references. The instructions may be printed directly on the container (when present), or as a label applied to the container, or as a separate sheet, pamphlet, card, or folder supplied in or with the container.

[0147] The practice of the present invention employs, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry and immunology, which are well within the purview of the skilled artisan. Such techniques are explained fully in the literature, such as, Molecular Cloning: A Laboratory Manual, second edition (Sambrook, 1989); Oligonucleotide Synthesis (Gait, 1984); Animal Cell Culture (Freshney, 1987); Methods in Enzymology Handbook of Experimental Immunology (Weir, 1996); Gene Transfer Vectors for Mammalian Cells (Miller and Calos, 1987); Current Protocols in Molecular Biology (Ausubel, 1987); PCR: The Polymerase Chain Reaction, (Mullis, 1994); Current Protocols in Immunology (Coligan, 1991). These techniques are applicable to the production of the polynucleotides and polypeptides of the invention, and, as such, may be considered in making and practicing the invention. Particularly useful techniques for particular embodiments will be discussed in the sections that follow.

[0148] The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the assay, screening, and therapeutic methods of the invention, and are not intended to limit the scope of what the inventors regard as their invention.

EXAMPLES

Example 1: Generation of Monobodies Specifically Binding to the PIF Pocket of Aurora a Kinase

[0149] A high-throughput yeast-display library screening of more than a million monobody clones to identify activating and inhibitory monobodies towards Aurora A kinase was performed. Using phage display and Aurora A constructs, monobody libraries were screened for monobodies that bound tightly to the PIF pocket of human Aurora A kinase (FIGS. 1A-1B). The selection scheme relied on (1) a round of positive selection that selected for monobodies binding more strongly to Aurora A than Aurora A-TPX2 chimera (FIG. 1A) and (2) further refinement of selection by using Y199H and Y199K Aurora A hotspot mutants in negative selection rounds of current monobody pools (FIG. 1B). From the screen, a number of monobodies specifically binding to and having a high affinity for the PIF pocket of Aurora A were identified (FIG. 1C). These monobodies were selected for further biochemical characterization.

Example 2: Biochemical Characterization of Monobodies Specifically Binding to the PIF Pocket of Aurora a Kinase

[0150] Monobodies Mb2, Mb44, Mb51, Mb56, Mb54, and Mb60 were selected for further biochemical characterization of the Aurora A-monobody interaction. Specifically, the affinity to Aurora A kinase and the ability of these monobodies to activate or inhibit the kinase activity of Aurora A kinase were measured.

[0151] Isothermal titration calorimetry (ITC) experiments using the monobodies were performed to determine the thermodynamics of the Aurora Amonobody interaction. Results showed that the monobodies bound to Aurora A kinase with affinities ranging in the nanomolar (nM) to low micromolar (M) range (FIGS. 2A-2F). The monobodies bound to Aurora A with higher affinity than TPX2's affinity to Aurora A (affinity of TPX2 for Aurora A was measured to be 50 M).

[0152] Next, a quantitative High Performance Liquid Chromatography (HPLC)-based assay was established and used to determine the kinetics of Aurora A activation by the monobodies. Assay results showed that the monobodies had a differential effect on the kinase activity of Aurora A (FIG. 3). As shown in FIG. 3, at least one monobody (Mb54) showed activation of kinase activity of Aurora A. Several showed strong inhibition of Aurora A's kinase activity (e.g., Mb60).

Example 3: High-Resolution X-Ray Crystallography Structures of Aurora A in the Presence of Activating and Inhibitory Monobodies Bound to the PIF Pocket and ATP-Competitive Drug Bound to the ATP Pocket

[0153] High-resolution X-ray crystallography structures of Aurora A in the presence of an activating (Mb54) bound to the PIF pocket, an inhibitory monobody (Mb60) bound to the PIF pocket, and ATP-competitive drugs bound to the ATP-binding pocket were solved. The high-resolution x-ray structures of complexes with activating and inhibiting monobodies with Aurora A revealed the mechanism of activation and inhibition of the kinase activity of Aurora A.

[0154] FIGS. 4A-4E depict the mechanism of inhibition of Aurora A's kinase activity by inhibitory monobody Mb60 and activation of Aurora A's kinase activity by activating monobody Mb54. The inhibitory WY-motif on Mb60 locks the C-helix of Aurora A in an inactive conformation (FIGS. 4A-4B). The activator Mb54 activates Aurora A kinase activity via anchor points that push on the C-helix of Aurora A (FIG. 4C). The activating anchor points of Mb54 (FIG. 4D) push on the C-helix and coordinate Aurora A's activation loop to keep the kinase in an active conformation. The monobodies shift equilibria between active and inactive Aurora A kinase (FIG. 4E).

Example 4: Intracellular Delivery of Inhibitory Monobodies by Cationic Liposome Mediated Delivery of Monobodies Fused to Supercharged Green Fluorescent Protein (GFP)

[0155] The Aurora Amonobody interaction was further characterized in mammalian cells. To perform this characterization, monobodies were fused to a supercharged green fluorescent protein (GFP) and the monobody-supercharged GFP fusion polypeptides were delivered to HEK293 and HeLa cells using cationic liposomes according to the method described in Zuris et al. Nat. Biotechnol. (2015) 3373-80. Monobody Mb60 was fused to supercharged GFP and purified (FIG. 5). Next, biochemical characterization of the Mb60-supercharged GFP fusion (sGFP-Mb60) was performed. FIGS. 6A-6C show the affinity and the effect on Aurora A's kinase activity of sGFP-Mb60 compared to Mb60. As shown in FIG. 6A, sGFP-Mb60 inhibited kinase activity of Aurora A. Mb60 showed stronger inhibition of kinase activity than sGFP-Mb60. FIGS. 6B-6C show the thermodynamics of binding of sGFP-Mb60 and Mb60 to Aurora A kinase. As indicated by the dissociation constant values (K.sub.d) in the plots in FIGS. 6B-6C, Mb60 bound to Aurora A kinase with about 1.0 M affinity (FIG. 6C), whereas sGFP-Mb60 bound Aurora A kinase at a lower affinity of about 9.9 M (FIG. 6B).

[0156] Efficiency of delivery of sGFP-Mb60 into mammalian cells (HEK and HeLa cells) was then optimized. To optimize delivery, various concentrations (1 nM, 25 nM, 50 nM, and 500 nM) of sGFP-Mb60 were incubated with various amounts of cationic liposomes (2 l, 3 l, and 4 l), and delivery of sGFP-Mb60 into cells was assayed by live cell imaging (FIG. 7A). Optimal delivery was achieved at a combination of 50 nM sGFP_Mb60 and 4 l cationic liposomes (FIG. 7B). FIG. 7C shows delivery of sGFP-Mb60 to cells monitored at various time points (0 hr, 1 hr, 7 hr, and 24 hr).

Example 5: Co-Localization of Inhibitory Monobody with Aurora a Kinase During Various Cell Cycle Stages and Mediation of Cell Death

[0157] Activity of the monobody Mb60 fused to supercharged GFP (sGFP-Mb60) in vivo was assayed by fluorescence microscopy. Aurora A kinase is implicated in regulation of mitotic progression, particularly spindle assembly and maintenance of the mitotic spindle. During the transition to mitosis, Aurora A kinase is known to localize to the centrosomes and the spindle, with levels and activity of Aurora A kinase peaking during this point.

[0158] FIG. 8A shows expression and localization of sGFP-Mb60 and Aurora A kinase in vivo during various stages of the cell cycle (interphase, prophase, prometaphase, and metaphase). As shown in FIG. 8A, during prophase, prometaphase, and metaphase, expression of Aurora A kinase is elevated. FIG. 8A further shows that sGFP-Mb60 co-localized with Aurora A kinase during prophase, prometaphase, and metaphase. FIGS. 8B-8H provide the same micrographs shown in FIG. 8A, at different levels of magnification. In FIG. 9, in vivo localization of Aurora A kinase and TPX2 in during prometaphase is shown.

[0159] Delivery of sGFP-Mb60 into cells was found to disrupt the TPX2/Aurora A interaction in the cells. It was also observed that delivery of sGFP-Mb60 disrupted Aurora A's function in the spindles, but kept its function in the centrosome intact. For example, in FIG. 8A, Aurora A was observed to localize to the centrosomes during at least prophase and prometaphase. It was also observed that the cells stayed in prometaphase, and never entered anaphase. Cell death was also observed (FIG. 10). Without being bound by theory, it is believed that the inhibitory monobody sGFP-Mb60 disrupted Aurora A's regulation of spindle assembly and/or maintenance, thereby inhibiting mitotic progression in the cells and causing cell death.

OTHER EMBODIMENTS

[0160] From the foregoing description, it will be apparent that variations and modifications may be made to the invention described herein to adopt it to various usages and conditions. Such embodiments are also within the scope of the following claims.

[0161] The recitation of a listing of elements in any definition of a variable herein includes definitions of that variable as any single element or combination (or subcombination) of listed elements. The recitation of an embodiment herein includes that embodiment as any single embodiment or in combination with any other embodiments or portions thereof.

[0162] All patents and publications mentioned in this specification are herein incorporated by reference to the same extent as if each independent patent and publication was specifically and individually indicated to be incorporated by reference.