Antigens derived from citrullinated 14-3-3 and uses thereof in the diagnosis of rheumatoid arthritis
10132806 ยท 2018-11-20
Assignee
Inventors
Cpc classification
C07K14/4713
CHEMISTRY; METALLURGY
G01N2800/105
PHYSICS
G01N33/564
PHYSICS
International classification
G01N33/564
PHYSICS
G01N33/543
PHYSICS
Abstract
The present invention provides citrullinated 14-3-3 peptides and antibodies thereto and methods of using same to evaluate arthritic conditions such as rheumatoid arthritis.
Claims
1. A method for diagnosing Rheumatoid Arthritis in a subject comprising: i) obtaining a biological sample from a subject suspected of having or at risk for developing Rheumatoid Arthritis, ii) contacting said biological sample from the subject with at least one citrullinated 14-3-3 eta protein or fragment thereof comprising at least one citrullinated 14-3-3 eta epitope under a condition suitable for the formation of at least one immune complex between the citrullinated 14-3-3 eta protein or fragment thereof and autoantibodies specific for said citrullinated 14-3-3 eta epitope that may be present in the biological sample, wherein said citrullinated 14-3-3 eta epitope comprises a citrulline residue at a position selected from the group consisting of position 4, position 12, position 19, position 42, position 61, position 86 and position 227 of SEQ ID NO: 5; and iii) detecting the presence of immune complexes between the citrullinated 14-3-3 eta protein or fragment thereof and autoantibodies that specifically bind the citrullinated 14-3-3 eta epitope of the citrullinated 14-3-3 eta protein or fragment thereof, wherein said presence of said immune complexes is indicative of Rheumatoid Arthritis in said subject.
2. The method of claim 1, wherein said detecting step further comprises measuring the amount of autoantibodies against the citrullinated 14-3-3 eta protein or fragment thereof.
3. The method according to claim 1, wherein the citrullinated 14-3-3 eta protein or fragment thereof is detectably labeled with a label selected from the group consisting of a radioactive label, a luminescent label, and a fluorescent label, and an enzyme.
4. The method according to claim 1, wherein the citrullinated 14-3-3 eta protein or fragment thereof is bound to a solid support.
5. The method according to claim 1, wherein the autoantibodies are detected by an ELISA assay.
6. The method according to claim 1, wherein said detection occurs by chemiluminescence.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
DETAILED DESCRIPTION
(3) 14-3-3 and 14-3-3 protein are used interchangeably and refer to at least one member of the 14-3-3 family. A 14-3-3 protein is a member of a family of conserved intracellular regulatory molecules that are ubiquitously expressed in eukaryotes. 14-3-3 proteins have the ability to bind a multitude of functionally diverse signaling proteins, including kinases, phosphatases, and transmembrane receptors. Indeed, more than 100 signaling proteins have been reported as 14-3-3 ligands. 14-3-3 proteins may be considered evolved members of the Tetratrico Peptide Repeat superfamily. They generally have 9 or 10 alpha helices, and usually form homo- and/or hetero-dimer interactions along their amino-termini helices. These proteins contain a number of known domains, including regions for divalent cation interaction, phosphorylation and acetylation, and proteolytic cleavage, among others.
(4) There are seven distinct genetically encoded isoforms of the 14-3-3 proteins that are known to be expressed in mammals, with each isoform comprising between 242-255 amino acids. The seven 14-3-3 protein isoforms are designated as 14-3-3 a/ (alpha/beta), 14-3-3 / (delta/zeta), 14-3-3 (epsilon), 14-3-3 (gamma), 14-3-3 (eta), 14-3-3 / (tau/theta), and 14-3-3 (sigma/stratifin). 14-3-3 proteins have a high degree of sequence similarity, and are known to undergo post-translational processing, e.g., phosphorylation, citrullination, etc. See, e.g., Megidish et al. (1998) J. Biol. Chem. 273: 21834-45. Consequently, anti-14-3-3 autoantibodies may specifically bind to and/or recognize more than one 14-3-3 protein isoform, or may specifically bind and/or recognize only one isoform (e.g., 14-3-3 eta).
(5) Citrullination is a form of a post-translational modification (PTM) whereby peptidylarginine deiminases (PAD) catalyze the deimination of the amino acid arginine (R) to citrulline (C) resulting in a chemical change liberating a nitrogen-based moiety. Accordingly, the terms citrullinated 14-3-3 protein and citrullinated 14-3-3 peptide are interchangeable and refer to a protein that has an amino acid sequence that is identical to the amino acid sequence of a native 14-3-3 protein (e.g., a 14-3-3 protein that has not been modified post-translationally) but for the substitution of at least one arginine residue in the native sequence with a citrulline residue in the citrullinated sequence.
(6) Substituted by or replaced by include modified into, e.g., an arginine residue that is substituted or replaced by a citrulline residue can also mean an arginine residue modified into a citrulline residue, e.g. by incubation with PAD. Citrullination by PAD starts mostly at the NH.sub.2-terminus of the protein, but exceptionally it can start from the COOH terminus of the protein. In case several arginine residues are replaced by citrulline residues, this means that for said several arginine residues each single arginine residue is replaced by one single citrulline residue.
(7) Peptidylarginine deiminases (PADs), also referred to as protein-arginine deiminases, are a family of posttranslational modification enzymes that convert arginine residues in peptides to citrulline residues in the presence of calcium ion.
(8) Citrulline and Cit refers to 2-amino-5-(carbamoylamino)pentanoic acid and is an alfa-amino acid with formula: H.sub.2NC(O)NH(CH.sub.2).sub.3CH(NH.sub.2)CO.sub.2H.
(9) The terms peptide and protein are interchangeable as used herein and refer to a molecule comprising an amino acid sequence of between 2 and 200 amino acids, connected by peptide bonds. Peptides may contain any of the conventional 20 amino acids or modified versions thereof and any non-naturally occurring amino-acids incorporated by chemical peptide synthesis or by chemical or enzymatic modification. Peptides may be used as antigens and may comprise one or more epitopes.
(10) The term derivative variant and fragment as used herein with reference to a protein refers to molecules which comprises at least the active portion of said protein, e.g., comprises at least the epitope and/or the citrulline residue of said protein, either or both of which are specifically bound by anti-14-3-3 autoantibodies.
(11) The term epitope refers to one or several portions (which may define a conformational epitope) of an antigenic protein which is/are specifically recognized and bound by an antibody or a portion thereof (Fab, Fab2, etc.) or a receptor presented at the cell surface of a B or T cell lymphocyte, and which is able, by said binding, to induce an immune response. Epitopes are chemical features generally present on surfaces of molecules and accessible to interaction with an antibody. Typical chemical features are amino acids and sugar moieties, having three-dimensional structural characteristics as well as chemical properties including charge, hydrophilicity, and lipophilicity. Conformational epitopes are distinguished from non-conformational epitopes by loss of reactivity with an antibody following a change in the spatial elements of the molecule without any change in the underlying chemical structure.
(12) An ordinarily skilled artisan will recognize that autoantibodies recognize fragments of the antigen. Accordingly, as used herein, fragment thereof and epitope are used interchangeably and generally refer to a determinant of 14-3-3 that is capable of binding to an antibody, e.g., an autoantibody. Accordingly, the term epitope when used in reference to 14-3-3 proteins or specific isomers generally refers to a fragment of the protein, including a citrullinated 14-3-3 protein, that is capable of binding to an antibody, e.g., an autoantibody.
(13) Described herein are citrullinated 14-3-3 epitopes that comprise at least one citrulline residue and are recognized by autoantibodies in a patient diagnosed with arthritis, particularly rheumatoid arthritis, methods of using such epitopes to evaluate and/or characterize an arthritic condition in a subject, and kits comprising such epitopes. An epitope can comprise as few as 3 amino acids in a spatial conformation which is unique to the epitope. Generally an epitope consists of at least 6 such amino acids, and more usually at least 8-10 such amino acids. Methods for determining the amino acids which make up an epitope include x-ray crystallography, 2-dimensional nuclear magnetic resonance, and epitope mapping.
(14) Antibody refers to a composition comprising a protein that binds specifically to a corresponding antigen and has a common, general structure of immunoglobulins. The term antibody specifically covers polyclonal antibodies, monoclonal antibodies, dimers, multimers, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments, so long as they exhibit the desired biological activity. Antibodies may be murine, human, humanized, chimeric, or derived from other species. Typically, an antibody will comprise at least two heavy chains and two light chains interconnected by disulfide bonds, which when combined form a binding domain that interacts with an antigen. Each heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region (CH). The heavy chain constant region is comprised of three domains, CH1, CH2 and CH3, and may be of the mu, delta, gamma, alpha or epsilon isotype. Similarly, the light chain is comprised of a light chain variable region (VL) and a light chain constant region (CL). The light chain constant region is comprised of one domain, CL, which may be of the kappa or lambda isotype. The VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (CIq) of the classical complement system. The heavy chain constant region mediates binding of the immunoglobulin to host tissue or host factors, particularly through cellular receptors such as the Fc receptors (e.g., FcyRI, FcyRII, FcyRIII, etc.). As used herein, antibody also includes an antigen binding portion of an immunoglobulin that retains the ability to bind antigen. These include, as examples, F(ab), a monovalent fragment of VL CL and VH CH antibody domains; and F(ab).sub.2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region. The term antibody also refers to recombinant single chain Fv fragments (scFv) and bispecific molecules such as, e.g., diabodies, triabodies, and tetrabodies (see, e.g., U.S. Pat. No. 5,844,094).
(15) Antigen is to be construed broadly and refers to any molecule, composition, or particle that can bind specifically to an antibody. An antigen may have one or more epitopes that interact with the antibody, although it does not necessarily induce production of that antibody.
(16) Autoantibodies are endogenous antibodies that specifically bind self antigens, i.e., a normal tissue component. An autoantibody is produced in response to a naturally occurring antigen of the same body that produces the autoantibody. Accordingly, the terms autoantibodies against 14-3-3 and autoantibodies to 14-3-3 are used interchangeably and refer to endogenous antibodies produced by a mammalian subject that specifically bind a 14-3-3 protein, which may be citrullinated, or a fragment thereof from said host.
(17) Immunological binding and formation of an immune complex are used interchangeably and as used in this context, generally refer to the non-covalent interactions of the type which occur between an antibody, e.g., an autoantibody, and an antigen for which the antibody is specific. The strength, or affinity of immunological binding interactions can be expressed in terms of the dissociation constant (K.sub.d) of the interaction, wherein a smaller K.sub.d represents a greater affinity. Immunological binding properties can be quantified using methods well known in the art. For example, see Davies et al. (1990) Annual Rev. Biochem. 59:439-473. An antibody, or antigen-binding fragment thereof, is said to specifically bind, immunologically bind, and/or is immunologically reactive if it reacts at a detectable level (within, for example, an ELISA assay) with ligand, and does not react detectably with unrelated ligands under similar conditions.
(18) The phrase specifically (or selectively) binds to an antibody, when referring to a protein or peptide, refers to a binding reaction that is determinative of the presence of the protein in a heterogeneous population of proteins and other biologics. The term directed against a protein or peptide, when referring to an antibody, refers also to the specific binding reaction that is determinative of the presence of the protein by said antibody in a heterogeneous population of proteins and other biologics. Thus, under designated immunoassay conditions, the specified antibodies bind to a particular protein at least two times the background and do not substantially bind in a significant amount to other proteins present in the sample. Specific binding to an antibody under such conditions may require an antibody that is selected for its specificity for a particular protein. For example, polyclonal antibodies raised to marker X from specific species such as rat, mouse, or human can be selected to obtain only those polyclonal antibodies that are specifically immunoreactive with marker X and not with other proteins, except for polymorphic variants and alleles of marker X. This selection may be achieved by subtracting out antibodies that cross-react with marker X molecules from other species. A variety of immunoassay formats may be used to select antibodies specifically immunoreactive with a particular protein. For example, solid-phase ELISA immunoassays are routinely used to select antibodies specifically immunoreactive with a protein (see, e.g., Harlow & Lane, Antibodies, A Laboratory Manual (1988), for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity). Typically a specific or selective reaction will be at least twice background signal or noise and more typically more than 10 to 100 times background.
(19) Diagnostic means identifying the presence or nature of a pathologic condition in a subject based on the presence or absence of one or more autoantibodies to the citrullinated 14-3-3 protein(s) disclosed herein. The diagnostic method makes the correlation between the presence of autoantibodies directed against citrullinated 14-3-3 protein(s) and the occurrence of a specific disease, e.g., rheumatoid arthritis, or a group of diseases (e.g. arthritic conditions).
(20) Prognostic means determining the potential progression or outcome of a pathologic condition and/or disease process in a subject, with or without treatment, based on the presence/absence and/or amount of one or more autoantibodies to the citrullinated 14-3-3 protein(s) disclosed herein. The prognostic method makes the correlation between the presence and/or amount of autoantibodies directed against citrullinated 14-3-3 protein(s) and the progression and/or likely outcome of the arthritic condition.
(21) Theranostic means determining the potential and/or likely reaction to a proposed treatment protocol for a pathologic condition and/or disease process in a subject, based on the presence/absence and/or amount of one or more autoantibodies to the citrullinated 14-3-3 protein(s) disclosed herein, and tailoring an appropriate treatment for the subject based on the results. The theranostic method makes the correlation between the presence and/or amount of autoantibodies directed against citrullinated 14-3-3 protein(s) and the likely efficacy of different treatment options on the arthritic condition in the subject.
(22) Subject and patient are used interchangeably and refer to, except where indicated, mammals such as humans and non-human primates, as well as rabbits, rats, mice, goats, pigs, and other mammalian species.
(23) Arthritic condition, arthritis, and arthralgia are used interchangeably, and generally refer to, except where indicated, an inflammatory disorder of the joints of the body. Pain, swelling, stiffness, and difficulty of movement are frequently associated with arthritic conditions. Arthritis consists of more than 100 different conditions. These can be anything from relatively mild forms to crippling systemic forms, see, e.g., www.arthritis.ca/types%20of%20arthritis/default.asp?s=1. An arthritic condition may result from any of several causes, including infection, trauma, degenerative disorders, metabolic disorders or disturbances, or other unknown etiologies.
(24) An arthritic condition may be more specifically described according to the subtype, for example, rheumatoid arthritis, mixed connective tissue disease (MCTD), crystal induced arthritis, reactive arthritis, spondylarthropathy, osteoarthritis, sarcoidosis, palindromic rheumatism, post traumatic arthritis, malignancy related arthritis, septic arthritis, lyme arthritis, osteoarthritis, bacterial, infectious arthritis, etc. Arthritis may further accompany other identified disorders, including gout, ankylosing spondylitis, systemic lupus erythematosus, inflammatory bowel disease, psoriasis, etc. Well-defined arthritic condition refers to knowledge regarding the type of arthritis and its stage, e.g., onset, remission, relapse etc.
(25) Citrullinated 14-3-3 Proteins
(26) The amino acid sequences of native 14-3-3 proteins are set forth in Table 1. In some embodiments, a 14-3-3 protein is identical to the native 14-3-3 protein sequences provided in Table 1. The 14-3-3 protein may also be substantially homologous to a native 14-3-3 protein sequence provided in Table 1 and retain the functional activity of the 14-3-3 protein, e.g., specific binding to an anti-14-3-3 autoantibody, yet differs in amino acid sequence due to natural allelic variation or mutagenesis.
(27) TABLE-US-00001 TABLE 1 14-3-3 proteins 14-3-3 Protein NCBI Accession No. SEQ ID NO: 14-3-3 a/ NP_003395.1 1 14-3-3 / NP_001129171.1 2 14-3-3 NP_006752.1 3 14-3-3 NP_036611.2 4 14-3-3 NP_003396.1 5 14-3-3 / NP_006817.1 6 14-3-3 NP_006133.1 7
(28) As used herein, the phrase 14-3-3 eta protein refers to a protein comprising SEQ ID NO: 5 as well as a protein substantially homologous thereto, e.g., a protein having at least 75%, yet more preferably 80% to 90%, still more preferably 90%-95%, again more preferable 95%, and most preferably at least 98% amino acid sequence identity with SEQ ID NO:5. The amino acid sequence of SEQ ID NO:5 is provided below.
(29) TABLE-US-00002 MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNE DRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLE KVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESK VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEI SKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQA FDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDE EAGEGN
(30) To determine the percent identity of two amino acid sequences or of two polynucleotide sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or polynucleotide sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). In a preferred embodiment, the length of a reference sequence aligned for comparison purposes is at least 30%, preferably at least 40%, more preferably at least 50%, even more preferably at least 60%, and even more preferably at least 70%, 80%, or 90% of the length of the reference sequence. The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein amino acid or polynucleotide identity is equivalent to amino acid or polynucleotide homology). The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
(31) The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. In a preferred embodiment, the percent identity between two amino acid sequences is determined using the Needleman and Wunsch (J. Mol. Biol. (48):444-453 (1970)) algorithm which has been incorporated into the GAP program in the GCG software package (available at http://www.gcg.com), using either a Blossom 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6. In yet another preferred embodiment, the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6. In another embodiment, the percent identity between two amino acid or nucleotide sequences is determined using the algorithm of E. Meyers and W. Miller (CABIOS, 4:11-17 (1989)) which has been incorporated into the ALIGN program (version 2.0), using a PAM 120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
(32) The protein sequences of the present invention can further be used as a query sequence to perform a search against public databases to, for example, identify other family members or related sequences. Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10. BLAST nucleotide searches can be performed with the NBLAST program, score=100, wordlength=12 to obtain nucleotide sequences homologous to polynucleotide molecules of the invention. BLAST protein searches can be performed with the XBLAST program, score=50, wordlength=3 to obtain amino acid sequences homologous to 14-3-3 protein molecules of the invention. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al., (1997) Polynucleotides Res. 25(17):3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used, e.g., at www.ncbi.nim.nih.gov.
(33) Incubation of a 14-3-3 protein, fragment, or fusion thereof with a peptidylarginine deiminase according to well-known methods results in a citrullinated 14-3-3 protein, fragment or fusion thereof. Such citrullinated 14-3-3 protein, fragment or fusion thereof can be used as an immunogen, to produce anti-14-3-3 antibodies, purify anti-14-3-3 antibodies, and in diagnostic, prognostic and theranostic assays as described herein.
(34) In accordance with the present invention, the human 14-3-3 eta citrullination sites identified in silico, in vitro and using clinical samples are provided in Table 2.
(35) TABLE-US-00003 TABLE2 AA AA Position Sequence ArginylatedPeptide CitrullinatedPeptide 4 1-12 MGD[R]EQLLQRAR MGD[Cit]EQLLQRAR (SEQIDNO:9) (SEQIDNO:16) 12 4-18 REQLLQRA[R]LAEQAE REQLLQRA[Cit]LAEQAE (SEQIDNO:10) (SEQIDNO:17) 19 12-26 RLAEQAE[R]YDDMASA RLAEQAE[Cit]YDDMASA (SEQIDNO:1) (SEQIDNO:18) 42 29-45 KAVTELNEPLSNED[R]NLL KAVTELNEPLSNED[Cit]NLL (SEQIDNO:12) (SEQIDNO:19) 61 50-69 KNVVGARRSSW[R]VISSIEQK KNVVGARRSSW[Cit]VISSIEQK (SEQIDNO:13) (SEQIDNO:20) 86 77-89 KKLEKVKAY[R]EKI KKLEKVKAY[Cit]EKI (SEQIDNO:14) (SEQIDNO:21) 227 217-235 KDSTLIMQLL[R]DNLTLWTS KDSTLIMQLL[Cit]DNLTLWTS (SEQIDNO:15) (SEQIDNO:22)
(36) Citrullinated proteins of the invention comprise at least citrulline residue at one of the amino acid positions listed in Table 2. In one embodiment, a citrullinated 14-3-3 eta fragment according to the present invention comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 16-22.
(37) As shown in Table 3, several if not all of the seven citrullinated sites listed in Table 2 are conserved in other 14-3-3 isoforms as well. Accordingly, to the extent that these citrullination sites are conserved in other 14-3-3 isoforms, these sites may also be used to determine the citrullination status of these other 14-3-3 isoforms using the methods and materials disclosed herein.
(38) TABLE-US-00004 TABLE 3 Amino Acid Site in Eta Eta Gamma Alpha/beta Epsilon Sigma Theta Zeta 4 Present Present No Present Present No No 12 Present Present No No No No No 19 Present Present Present Present Present Present Present 42 Present Present Present Present Present Present Present 61 Present Present Present Present Present Present Present 86 Present Present Present Present Present Present Present 227 Present Present Present Present Present Present Present
(39) Several aspects of the invention pertain to isolated citrullinated 14-3-3 proteins, and biologically active portions thereof, e.g., fragments suitable for use as antigens to anti-citrullinated 14-3-3 autoantibodies. Citrullinated 14-3-3 proteins, including fragments thereof, may be isolated from natural, recombinant or synthetic 14-3-3 protein (including fragments thereof, respectively), through the action of peptidylarginine deiminase, e.g., by incubating native 14-3-3 protein or fragments thereof, respectively, with peptidylarginine deiminases according to well-known methods. Alternatively, citrullinated 14-3-3 proteins may be isolated by peptide synthesis according to well-known methods, e.g., by directly incorporating citrulline residues into the peptide synthesized.
(40) In one embodiment, 14-3-3 proteins can be isolated from cells or tissue sources by an appropriate purification scheme using standard protein purification techniques. In another embodiment, 14-3-3 proteins are produced by recombinant DNA techniques.
(41) Preferably, a 14-3-3 protein or fragment thereof of the invention is produced by standard recombinant DNA techniques. For example, DNA fragments coding for the 14-3-3 protein or fragment thereof are ligated in an expression vector in-frame in accordance with conventional techniques, for example by employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation. Alternatively, PCR amplification of gene fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can subsequently be annealed and reamplified to generate a c gene sequence (see, e.g., Current Protocols In Molecular Biology, eds. Ausubel et al. John Wiley & Sons: 1992). Moreover, many expression vectors are commercially available that already encode a moiety, e.g., a detectable moiety. A polynucleotide encoding a 14-3-3 protein or fragment thereof can be cloned into such an expression vector such that a moiety, e.g., a detectable moiety, is linked in-frame to the 14-3-3 protein or fragment.
(42) A signal sequence can be used to facilitate secretion and isolation of the secreted protein or other proteins of interest. Signal sequences are typically characterized by a core of hydrophobic amino acids which are generally cleaved from the mature protein during secretion in one or more cleavage events. Such signal peptides contain processing sites that allow cleavage of the signal sequence from the mature proteins as they pass through the secretory pathway. Thus, the invention pertains to the described polypeptides having a signal sequence, as well as to polypeptides from which the signal sequence has been proteolytically cleaved (i.e., the cleavage products). In one embodiment, a polynucleotide sequence encoding a signal sequence can be operably linked in an expression vector to a protein of interest, such as a protein which is ordinarily not secreted or is otherwise difficult to isolate. The signal sequence directs secretion of the protein, such as from a eukaryotic host into which the expression vector is transformed, and the signal sequence is subsequently or concurrently cleaved. The protein can then be readily purified from the extracellular medium by art recognized methods.
(43) Alternatively, the signal sequence can be linked to the native or citrullinated 14-3-3 protein, fragment, or fusion thereof, using a sequence which facilitates purification, such as with a GST domain.
(44) Antibodies to Citrullinated 14-3-3 Protein and Fragments Thereof
(45) In other embodiments, the invention provides antibodies, i.e., intact antibodies and antigen binding fragments thereof, that specifically bind to a citrullinated 14-3-3 protein or fragment thereof, preferably mammalian (e.g., human) 14-3-3 protein, which may be useful in diagnosing, prognosing, monitoring and/or treating RA.
(46) Antibody molecules to the polypeptides of the present invention, e.g., citrullinated 14-3-3 protein or citrullinated fragments thereof, may be produced by methods well known to those skilled in the art. For example, monoclonal antibodies may be produced by generation of hybridomas in accordance with known methods. Hybridomas formed in this manner are then screened using standard methods, such as an enzyme-linked immunosorbent assay (ELISA), to identify one or more hybridomas that produce an antibody that specifically binds with the polypeptides of the present invention. For example, a citrullinated 14-3-3 protein or a citrullinated fragment thereof of the invention may also be used to immunize non-human hosts, e.g., donkey, goat, sheep, guinea pig, hamster, rabbit, rat and mouse, to obtain polyclonal and monoclonal antibodies that react with the citrullinated 14-3-3 protein or a citrullinated fragment thereof but not the native 14-3-3 protein or native fragment thereof. The peptide immunogens additionally may contain a cysteine residue at the carboxyl terminus, and may be conjugated to a hapten such as keyhole limpet hemocyanin (KLH). Additional peptide immunogens may be generated by replacing tyrosine residues with sulfated tyrosine residues. Methods for synthesizing such peptides are well known in the art. A full-length polypeptide of the present invention may be used as the immunogen, or, alternatively, antigenic peptide fragments of the polypeptides may be used. An antigenic peptide of a polypeptide of the present invention comprises at least 7 continuous amino acid residues and encompasses an epitope such that an antibody raised against the peptide forms a specific immune complex with the polypeptide. Preferably, the antigenic peptide comprises at least 10 amino acid residues, more preferably at least 15 amino acid residues, even more preferably at least 20 amino acid residues, and most preferably at least 30 amino acid residues.
(47) Monoclonal antibodies may be generated by other methods known to those skilled in the art of recombinant DNA technology. As an alternative to preparing monoclonal antibody-secreting hybridomas, a monoclonal antibody to a polypeptide of the present invention may be identified and isolated by screening a recombinant combinatorial immunoglobulin library (e.g., an antibody phage display library) with a polypeptide related to the present invention (e.g., citrullinated 14-3-3 protein or a citrullinated fragment thereof) to thereby isolate immunoglobulin library members that bind to the polypeptides related to the present invention (e.g., citrullinated 14-3-3 protein or a citrullinated fragment thereof). Techniques and commercially available kits for generating and screening phage display libraries are well known to those skilled in the art. Additionally, examples of methods and reagents particularly amenable for use in generating and screening antibody display libraries can be found in the literature. For example, the combinatorial antibody display method is well known and was developed to identify and isolate antibody fragments having a particular antigen specificity, and can be utilized to produce monoclonal antibodies. After immunizing an animal with an immunogen as described above, the antibody repertoire of the resulting B-cell pool is cloned. Methods are generally known for obtaining the DNA sequence of the variable regions of a diverse population of immunoglobulin molecules by using a mixture of oligomer primers and PCR. For instance, mixed oligonucleotide primers corresponding to the 5 leader (signal peptide) sequences and/or framework 1 (FR1) sequences, as well as primers to a conserved 3 constant region, can be used for PCR amplification of the heavy and light chain variable regions from a number of murine antibodies; a similar strategy has also been used to amplify human heavy and light chain variable regions from human antibodies.
(48) Polyclonal sera and antibodies may be produced by immunizing a suitable subject with a polypeptide of the present invention. The antibody titer in the immunized subject may be monitored over time by standard techniques, such as with ELISA using immobilized protein. If desired, the antibody molecules directed against a polypeptide of the present invention may be isolated from the subject or culture media and further purified by well-known techniques, such as protein A chromatography, to obtain an IgG fraction.
(49) Fragments of antibodies to the polypeptides of the present invention may be produced by cleavage of the antibodies in accordance with methods well known in the art. For example, immunologically active Fab and F(ab).sub.2 fragments may be generated by treating the antibodies with an enzyme such as pepsin.
(50) Additionally, chimeric, humanized, and single-chain antibodies to the polypeptides of the present invention, comprising both human and nonhuman portions, may be produced using standard recombinant DNA techniques and/or a recombinant combinatorial immunoglobulin library. Humanized antibodies may also be produced using transgenic mice which are incapable of expressing endogenous immunoglobulin heavy and light chain genes, but which can express human heavy and light chain genes. For example, human monoclonal antibodies (mAbs) directed against, e.g., a citrullinated 14-3-3 protein or fragment thereof, may be generated using transgenic mice carrying the human immunoglobulin genes rather than murine immunoglobulin genes. Splenocytes from these transgenic mice immunized with the antigen of interest may then be used to produce hybridomas that secrete human mAbs with specific affinities for epitopes from a human protein.
(51) Chimeric antibodies, including chimeric immunoglobulin chains, may be produced by recombinant DNA techniques known in the art. For example, a gene encoding the Fc constant region of a murine (or other species) monoclonal antibody molecule is digested with restriction enzymes to remove the region encoding the murine Fc, and the equivalent portion of a gene encoding a human Fc constant region is substituted.
(52) An antibody or an immunoglobulin chain may be humanized by methods known in the art. Humanized antibodies, including humanized immunoglobulin chains, may be generated by replacing sequences of the Fv variable region that are not directly involved in antigen binding with equivalent sequences from human Fv variable regions. General methods for generating humanized antibodies are provided by Morrison (1985) Science 229:1202-07; Oi et al. (1986) BioTechniques 4:214; Queen et al., U.S. Pat. Nos. 5,585,089; 5,693,761; 5,693,762, the contents of all of which are hereby incorporated by reference. Those methods include isolating, manipulating, and expressing the nucleic acid sequences that encode all or part of immunoglobulin Fv variable regions from at least one of a heavy or light chain. Sources of such nucleic acid sequences are well known to those skilled in the art and, for example, may be obtained from a hybridoma producing an antibody against a predetermined target. The recombinant DNA encoding the humanized antibody, or fragment thereof, then can be cloned into an appropriate expression vector.
(53) Humanized or CDR-grafted antibody molecules or immunoglobulins may be produced by CDR grafting or CDR substitution, wherein one, two, or all CDRs of an immunoglobulin chain can be replaced. See, e.g., U.S. Pat. No. 5,225,539; Jones et al. (1986) Nature 321:552-25; Verhoeyan et al. (1988) Science 239:1534; Beidler et al. (1988) J. Immunol. 141:4053-60; Winter, U.S. Pat. No. 5,225,539, the contents of all of which are hereby incorporated by reference. Winter describes a CDR-grafting method that may be used to prepare the humanized antibodies of the present invention (UK Patent Application GB 2188638A; Winter, U.S. Pat. No. 5,225,539), the contents of which are hereby incorporated by reference. All of the CDRs of a particular human antibody may be replaced with at least a portion of a nonhuman CDR, or only some of the CDRs may be replaced with nonhuman CDRs. It is only necessary to replace the number of CDRs required for binding of the humanized antibody to a predetermined antigen.
(54) Human antibodies may additionally be produced using transgenic nonhuman animals that are modified so as to produce fully human antibodies rather than the animal's endogenous antibodies in response to challenge by an antigen. See, e.g., PCT publication WO 94/02602. The endogenous genes encoding the heavy and light immunoglobulin chains in the nonhuman host have been incapacitated, and active loci encoding human heavy and light chain immunoglobulins are inserted into the host's genome. The human genes are incorporated, for example, using yeast artificial chromosomes containing the requisite human DNA segments. An animal which provides all the desired modifications is then obtained as progeny by crossbreeding intermediate transgenic animals containing fewer than the full complement of the modifications. The preferred embodiment of such a nonhuman animal is a mouse, and is termed the XENOMOUSE as disclosed in PCT publications WO 96/33735 and WO 96/34096. This animal produces B cells that secrete fully human immunoglobulins. The antibodies can be obtained directly from the animal after immunization with an immunogen of interest, as, for example, a preparation of a polyclonal antibody, or alternatively from immortalized B cells derived from the animal, such as hybridomas producing monoclonal antibodies. Additionally, the genes encoding the immunoglobulins with human variable regions can be recovered and expressed to obtain the antibodies directly, or can be further modified to obtain analogs of antibodies such as, for example, single chain Fv molecules.
(55) Monoclonal, chimeric and humanized antibodies that have been modified by, e.g., deleting, adding, or substituting other portions of the antibody, e.g., the constant region, are also within the scope of the invention. As nonlimiting examples, an antibody can be modified by deleting the constant region, by replacing the constant region with another constant region, e.g., a constant region meant to increase half-life, stability, or affinity of the antibody, or a constant region from another species or antibody class, and by modifying one or more amino acids in the constant region to alter, for example, the number of glycosylation sites, effector cell function, Fc receptor (FcR) binding, complement fixation, etc.
(56) Methods for altering an antibody constant region are known in the art. Antibodies with altered function, e.g., altered affinity for an effector ligand, such as FcR on a cell, or the C1 component of complement, can be produced by replacing at least one amino acid residue in the constant portion of the antibody with a different residue (see, e.g., EP 388,151 A1, U.S. Pat. No. 5,624,821 and U.S. Pat. No. 5,648,260, the contents of all of which are hereby incorporated by reference). Similar types of alterations to the murine (or other species) immunoglobulin may be applied to reduce or eliminate these functions, and are known in the art.
(57) For example, it is possible to alter the affinity of an Fc region of an antibody (e.g., an IgG, such as a human IgG) for an FcR (e.g., Fc gamma R1), or for C1q binding by replacing the specified residue(s) with a residue(s) having an appropriate functionality on its side chain, or by introducing a charged functional group, such as glutamate or aspartate, or an aromatic nonpolar residue such as phenylalanine, tyrosine, tryptophan or alanine (see, e.g., U.S. Pat. No. 5,624,821).
(58) Diagnostic, Prognostic and Therapeutic Methods, and Treatment Monitoring
(59) In one aspect, the invention provides methods for diagnosing diseases and conditions that involve autoantibodies against citrullinated 14-3-3. In general, the presence or absence of an rheumatoid arthritis, or patient prognosis, may be determined by (a) contacting a biological sample obtained from a mammalian subject with at least one citrullinated 14-3-3 protein or fragment thereof; (b) detecting in the sample the level of autoantibodies that specifically bind to the citrullinated 14-3-3 protein or fragment thereof; and (c) comparing the level in such antibodies with an appropriate control, e.g., the level of native or non-citrullinated 14-3-3 protein.
(60) The methods comprise using at least one citrullinated 14-3-3 protein or fragment thereof to detect autoantibodies against the protein. There are a variety of assay formats known to those of ordinary skill in the art for using a protein to detect antibodies in a sample. See, e.g., Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, 1988. As nonlimiting examples, detection of autoantibodies against citrullinated 14-3-3 may be performed using well-known methods or assays, e.g. immunoprecipitation, ELISA, Western blot analysis, immunohistochemistry, immunofluorescence, sandwich immunoassays, immunoradiometric assays, gel diffusion precipitation reactions, immunodiffusion assays, in situ immunoassays, precipitation reactions, agglutination assays, complement fixation assays, protein A assays, Immunoelectrophoresis assays, fluorescence activated cell sorting (FACS) analysis, radioimmunoassay, a strip test, a point of care test, and the like. The ordinarily skilled artisan will recognize that these methods may also be used to measure the level of autoantibodies against, or immune complexes with, citrulinated 14-3-3 proteins in the biological sample.
(61) In some embodiments, an automated detection assay is utilized. Methods for the automation of immunoassays include those described in U.S. Pat. Nos. 5,885,530, 4,981,785, 6,159,750, and 5,358,691, each of which is herein incorporated by reference. In some embodiments, the analysis and presentation of results is also automated. For example, in some embodiments, software that generates a prognosis based on the presence or absence of a series of proteins corresponding to arthritic conditions is utilized, including citrullinated 14-3-3 proteins.
(62) In one embodiment, the assays involve the use of at least one citrullinated 14-3-3 protein or a fragment thereof immobilized on a solid support to bind to and capture autoantibodies that specifically bind the citrullinated 14-3-3 protein(s) from the remainder of the sample. The bound autoantibodies may then be detected using a detection reagent that contains a reporter group and specifically binds to the antibody/protein complex. Such detection reagents may comprise, for example, a binding agent that specifically binds to the autoantibody such as an anti-human antibody.
(63) The solid support may be any material known to those of ordinary skill in the art. For example, the solid support may be a test well in a microtiter plate or a nitrocellulose or other suitable membrane. Alternatively, the support may be a bead or disc, such as glass, fiberglass, latex or a plastic material such as polystyrene or polyvinylchloride. The support may also be a magnetic particle or a fiber optic sensor, such as those disclosed, for example, in U.S. Pat. No. 5,359,681. The citrullinated 14-3-3 protein or fragment thereof may be immobilized on the solid support using a variety of techniques known to those of skill in the art, which are amply described in the patent and scientific literature. In the context of the present invention, the term immobilization refers to both noncovalent association, such as adsorption, and covalent attachment (which may be a direct linkage between the antibody and functional groups on the support or may be a linkage by way of a cross-linking agent). Immobilization by adsorption to a well in a microtiter plate or to a membrane is preferred. In such cases, adsorption may be achieved by contacting the antibody, in a suitable buffer, with the solid support for a suitable amount of time. The contact time varies with temperature, but is typically between about 1 hour and about 1 day. In one embodiment, a microtitre plate coated with streptavidin is used in conjunction with a biotinylated citrullinated 14-3-3 protein or fragment thereof.
(64) Covalent attachment of the citrullinated 14-3-3 protein or fragment thereof to a solid support may generally be achieved by first reacting the support with a bifunctional reagent that will react with both the support and the citrullinated 14-3-3 protein or fragment thereof. The captured autoantibody can then be detected using the non-competitive sandwich technique where labeled ligand for the autoantibody is exposed to the washed solid phase. Alternatively, competitive formats rely on the prior introduction of a labeled antibody to the sample so that labeled and unlabelled forms compete for binding to the solid phase. Such assay techniques are well known and well described in both the patent and scientific literature. See, e.g., U.S. Pat. Nos. 3,791,932; 3,817,837; 3,839,153; 3,850,752; 3,850,578; 3,853,987; 3,867,517; 3,879,262; 3,901,654; 3,935,074; 3,984,533; 3,996,345; 4,034,074; and 4,098,876. Enzyme-linked immunosorbent assay (ELISA) methods are described in detail in U.S. Pat. Nos. 3,791,932; 3,839,153; 3,850,752; 3,879,262; and 4,034,074. ELISA assays detect very low titers of autoantibodies.
(65) Autoantibodies can also be detected by solid-phase radioimmunoassay (RIA). The solid phase is exposed to the serum sample in the presence of radio-labeled antibodies that compete for binding to the immobilized ligand. In this assay, the amount of radiolabel bound to the solid phase is inversely related to the amount of autoantibodies initially present in the serum sample. After separation of the solid phase, non-specifically bound radiolabel is removed by washing, and the amount of radiolabel bound to the solid phase determined. The amount of bound radiolabel is, in turn, related to the amount of autoantibodies initially present in the sample.
(66) In one embodiment, the assay is performed in a flow-through or strip test format, wherein the citrullinated 14-3-3 protein or fragment thereof is immobilized on a membrane, such as nitrocellulose. In the flow-through test, autoantibodies to citrullinated 14-3-3 proteins within the sample bind to the immobilized citrullinated 14-3-3 protein or fragment thereof as the sample contacts the membrane. A second, labeled binding agent then binds to the immune complex as a solution containing the second binding agent contacts the membrane. The detection of bound second binding agent may then be performed as described above. In the strip test format, one end of the membrane to which citrullinated 14-3-3 protein or fragment thereof is bound is immersed in a solution containing the sample. The sample migrates along the membrane through a region containing second binding agent, e.g., to the autoantibodies, and to the area of immobilized citrullinated 14-3-3 protein or fragment thereof. Concentration of second binding agent at the area of immobilized citrullinated 14-3-3 protein or fragment thereof indicates the presence of an arthritic condition, or patient prognosis, etc. Typically, the concentration of second binding agent at that site generates a pattern, such as a line, that can be read visually. The absence of such a pattern indicates a negative result. In general, the amount of binding agent immobilized on the membrane is selected to generate a visually discernible pattern when the biological sample contains a level of the autoantibody that would be sufficient to generate a positive signal in the assay, in the format discussed above. Preferred binding agents for use in such assays are citrullinated 14-3-3 proteins and fragments thereof. Such tests can typically be performed with a very small amount of biological sample and at the point of care, which may also be quantifiable.
(67) In addition to detecting the presence of autoantibodies in a sample, many methods can be used to quantitatively measure the levels of the autoantibodies. In some methods, the antigen reacts with the autoantibody in a liquid phase, and the autoantibodies are quantitatively measured by an immunoprecipitation technique. For example, a citrullinated 14-3-3 protein or fragment thereof (i.e., full length isomer or antigenic fragments) can be detectably labeled (e.g., with an isotope or an enzyme). The polypeptides can be labeled during synthesis (e.g., by adding 35S-methionine to an in vitro translation system or cellular expression system) or after synthesis. The detectable antigen is added directly to a liquid biological sample (e.g., a serum) to form immune complexes. The immune complexes can be precipitated with polyethylene glycol. The immune complexes can also be isolated with a secondary antibody (e.g., goat anti-human immunoglobulin) or other kind of binding molecules (e.g., protein A or protein G) that is bound to a solid support (e.g., agarose or sepharose beads). The immunoprecipitates are washed several times after being separated from the liquid sample and examined for intensity of the detectable label (e.g., radioactivity). Any autoantibody present in the sample can thus be detected and quantified. Optionally, an unlabelled polypeptide can also be added to compete with the labeled polypeptide for binding to autoantibodies.
(68) The diagnostic methods of the present invention are also directed to detecting in a subject circulating immune complexes formed between citrullinated 14-3-3 proteins and an autoantibody. The methods discussed above can be readily modified for detection of such immune complexes. For example, an immobilized binding molecule (e.g., protein A or protein G bound to a bead) can be added to a liquid biological sample. After separation from the liquid phase, immune complexes captured by the binding molecules can be analyzed with SDS-PAGE and probed with various antibodies against citrullinated 14-3-3 proteins. The captured antigens can also be subject to direct amino acid sequence analysis. Identity of the immune complexes can thus be revealed. A number of assays are routinely practiced to detect circulating immune complexes in a subject, e.g., as described in Tomimori-Yamashita et al., Lepr Rev, 70(3):261-71, 1999 (antibody-based enzyme-linked immunosorbent assay); Krapf et al., J Clin Lab Immunol, 21(4):183-7, 1986 (fluorescence linked immunosorbent assay); Kazeem et al., East Afr Med J, 67(6):396-403, 1990 (laser immunonephelometry); and Rodrick et al., J Clin Lab Immunol, 7(3):193-8, 1982 (Protein A-glass fiber filter assay, PA-GFF, and polyethylene glycol solubilization assay).
(69) To improve clinical sensitivity, multiple markers may be assayed within a given sample. In particular, one or more other markers of arthritis, or prognostic indicators, etc., may be assayed in combination with autoantibodies to citrullinated 14-3-3 protein. These other markers may be proteins or nucleic acids. In a preferred embodiment, one or more of the other markers are MMP proteins or nucleic acids or other factors which are commonly used as indicators for arthritis, e.g., anti-CCP, anti-RF, CRP, SAA, IL-6, SIOO, osteopontin, RF, MMP-1, MMP-3, hyaluronic acid, sCD14, angiogenesis markers and products of bone, cartilage or synovium metabolism (e.g., CTX-I and CTX-II), etc. Methods for isolating and assaying nucleic acids based on reference sequences are well known in the art, as are methods for detecting proteins of interest within a patient sample.
(70) An ordinarily skilled artisan will recognize that each of these well known assays can be employed to detect circulating immune complexes in a biological sample for the methods of the present invention. Similarly, each of these well known assays can be employed using the antibodies to citrullinated 14-3-3 protein (and fragments thereof) disclosed in this invention to monitor the citrullination status of a 14-3-3 protein in a biological sample, e.g., determine how much how much of the 14-3-3 protein is citrullinated and/or which and how many sites of the 14-3-3 protein is citrullinated, as part of a clinical testing procedure, e.g., in diagnostic, prognostic and theranostic assays as described herein. An ordinarily skilled artisan will readily recognize how to adapt each of the assay formats, diagnostic, prognostic and theranostic assays, and kits to use the antibodies to citrullinated 14-3-3 protein as described herein to determine the citrullination status of 14-3-3 protein in a biological sample.
(71) Combination assays may be done concurrently or sequentially. The selection of markers may be based on routine experiments to determine combinations that results in optimal sensitivity.
(72) In one embodiment, the invention provides methods for diagnosing arthritic conditions. In general, arthritic conditions may be detected in a patient based on the presence of autoantibodies to citrullinated 14-3-3 in the synovial fluid, synovial joint, blood, plasma, or serum of a patient. In other words, autoantibodies to citrullinated 14-3-3 protein may be used as a marker to indicate arthritic conditions.
(73) In a preferred embodiment, the invention provides methods for diagnosing rheumatoid arthritis. In general, rheumatoid arthritis may be detected in a patient based on the presence of autoantibodies to citrullinated 14-3-3 in the synovial fluid, synovial joint, blood, plasma, or serum of a patient. In other words, autoantibodies to citrullinated 14-3-3 protein may be used as a marker to indicated rheumatoid arthritis. In a particularly preferred embodiment, the citrullinated 14-3-3 protein is 14-3-3 eta.
(74) In addition, the presence of autoantibodies to citrullinated 14-3-3, or the relative levels of autoantibodies to citrullinated 14-3-3, as determined through the use of a citrullinated 14-3-3 protein or fragment thereof may be a prognostic indicator of early-stage rheumatoid arthritis, before it progresses to a debilitating form. An advantage of early prognosis or diagnosis is earlier implementation of a treatment regimen.
(75) To determine the presence or absence of rheumatoid arthritis in a subject, the level of autoantibodies against, or immune complexes with, citrullinated 14-3-3 in a biological sample from the subject may generally be compared to a level of autoantibodies/immune complexes corresponding to a normal control. In one preferred embodiment, the normal control is established from the average mean level of autoantibodies against, or immune complexes with, citrullinated 14-3-3 in samples from patients without rheumatoid arthritis. In an alternative embodiment, the normal control value may be determined using a Receiver Operator Curve, for example see the method of Sackett et al., Clinical Epidemiology: A Basic Science for Clinical Medicine, Little Brown and Co., 1985, p. 106-7. Briefly, in this embodiment, the control value may be determined from a plot of pairs of true positive rates (i.e., sensitivity) and false positive rates (100%-specificity) that correspond to each possible cut-off value for the diagnostic test result. The control value on the plot that is the closest to the upper left-hand corner (i.e., the value that encloses the largest area) provides the most accurate value, and a sample generating a signal that is higher than the value determined by this method may be considered positive. Alternatively, the control value may be shifted to the left along the plot, to minimize the false positive rate, or to the right, to minimize the false negative rate. In general, a sample generating a signal that is higher than the control value determined by this method is considered positive for arthritis.
(76) In one aspect, the invention provides methods for differentiating between subtypes of arthritis. In one embodiment, the methods involve determining the level of autoantibodies against, or immune complexes with, at least one citrullinated 14-3-3 protein or fragment thereof. In a preferred embodiment, the level of autoantibodies/immune complexes to citrullinated 14-3-3 in the patient is compared to that of samples from subjects whose subtype of arthritis is known and/or previously-established.
(77) In one aspect, the invention provides methods for determining the response potential of a patient to treatment directed at rheumatoid arthritis. In one embodiment, the methods involve determining the level of autoantibodies against, or immune complexes with, at least one citrullinated 14-3-3 protein or fragment thereof in a patient sample. In a preferred embodiment, the level of autoantibodies to/immune complexes with citrullinated 14-3-3 in the patient sample is compared to that of samples from subjects whose ability to respond to treatment is known. A relatively high level of autoantibodies to/immune complexes with citrullinated 14-3-3 in a first patient sample as compared to a sample from a non-inflammatory subject and/or a sample from another inflammatory patient may indicate the first patient is a preferred candidate for a well-known treatment, e.g., disease-modifying anti-rheumatic drug (DMARD) therapy such as anti-TNF, methotrexate, minocycline, hydroxychloroquine, sulphasalazine, azathiprine, anti-IL-1, anti-IL-6r, and the like. Conversely, a relatively low level of autoantibodies/immune complexes to citrullinated 14-3-3 in a first patient sample as compared to a sample from another inflammatory patient may indicate the first patient is not a preferred candidate for a well-known treatment, especially if the level is closer to that of a sample from a non-inflammatory subject.
(78) Treatment regimens for various types of arthritis are known in the art. For example, a patient diagnosed with rheumatoid arthritis may be prescribed non-steroidal anti-inflammatory medications (NSAIDs) initially, to ease the discomfort and reduce the inflammation. Other treatment regimens may include, for example, steroidal anti-inflammatory medications (SAIDs e.g. Cortisol, prednisone), cyclooxygenase 2 specific inhibitors (CSIs), glucocorticoids, and/or standard disease-modifying antirheumatic drugs (DMARDs) such as, e.g., anti-TNF-alpha neutralizing agents, immunosuppressive drugs (e.g., cyclosporine, azathioprine, cyclophosphamide), antibiotics, antimalarials and cytotoxic drugs (e.g., methotrexate, sulfasalazine, leflunomide,). Treatment regimens may also advantageously include those that target citrullinated 14-3-3 proteins directly, see, e.g., PCT/CA2008/002154. Details on dosage or examples of particular drugs will be known to those of skill in the art, and may be found in, for example Harrison's Principles of Internal Medicine 15th ed. BRAUNWALD et al eds. McGraw-Hill or The Pharmacological basis of therapeutics, 10th edition. 5 HARDMAN HG., LIMBIRD LE. editors. McGraw-Hill, New York, and in Clinical Oncology, 3rd edition. Churchill Livingstone/Elsevier Press, 2004. ABELOFF, MD. editor.
(79) In one aspect, the invention provides methods for monitoring treatment of rheumatoid arthritis. In one embodiment, the methods involve determining the level of autoantibodies against, or immune complexes with, at least one citrullinated 14-3-3 protein or fragment thereof in patient samples and monitoring the level of autoantibodies to/immune complexes with citrullinated 14-3-3 in a patient undergoing treatment.
(80) The presence or relative levels of autoantibodies to/immune complexes with citrullinated 14-3-3 may correlate with the presence or relative levels of other proteins known to be associated with arthritic conditions in patients. Nonlimiting examples of proteins well-known to be associated with an arthritic condition include inflammatory cytokines, such as tumor necrosis factor, and matrix metalloproteinases (MMPs), such as MMP-1 or MMP-3, etc. At least 25 different MMPs have been identified. Detection of autoantibodies to citrullinated 14-3-3 in combination with detection of at least one inflammatory cytokine and/or MMP in a patient sample may be used to diagnose arthritis. Additionally, the presence or relative levels of autoantibodies/immune complexes to citrullinated 14-3-3 in combination with at least one MMP and/or at least one inflammatory cytokine in a patient sample may be used as a prognostic indicator of early-stage arthritis, before the arthritis progresses to a debilitating form.
(81) Also described herein are kits for evaluating an arthritic condition, and in particular, rheumatoid arthritis. Such kits typically comprise two or more components necessary for performing a diagnostic, prognostic and/or theranostic assay. Components may be compounds, reagents, containers, instructions and/or equipment. For example, one container within a kit may contain one or more citrullinated 14-3-3 protein(s) or fragment(s) thereof. Such kits may also contain a detection reagent as described above that contains a reporter group suitable for direct or indirect detection of antibody binding.
(82) Accordingly, described herein are kits for detecting the presence of autoantibodies to/immune complexes with citrullinated 14-3-3 and optionally other markers, e.g., MMPs, in a patient sample, the kit being useful for providing a diagnostic or prognostic result suitable for diagnosing or differentiating various arthritic conditions, and more preferably, rheumatoid arthritis. Additional indications where the presence of citrullinated 14-3-3 proteins and/or autoantibodies may be implicated also include, for example, cardiovascular and/or neurodegenerative disorders. A kit may comprise at least one citrullinated 14-3-3 protein or fragment thereof, which may optionally be detectably labeled, e.g., with a radioactive label, a luminescent label, a fluorescent label, an enzyme, etc. Methods for detectably labeling proteins are well-known in the art. Such a kit may further include detection reagents specific for other markers of arthritis e.g., anti-CCP, anti-RF, CRP, SAA, IL-6, S100, osteopontin, RF, MMP-I, MMP-3, hyaluronic acid, sCD14, angiogenesis markers and products of bone, cartilage or synovium metabolism (e.g., CTX-I and CTX-II), etc. The kit may further include secondary reagents necessary for the detection of autoantibodies to citrullinated 14-3-3 immunologically, such as labeled secondary antibodies (e.g. anti-human antibodies), chromogenic or fluourogenic reagents, polymerization agents and the like. Instructions for using the kit for diagnostic or prognostic purposes, including appropriate comparison standards for quantifying and/or evaluating the level of such autoantibodies in the context of a particular disease state, may also be advantageously provided in printed form and/or recorded on a suitable media.
EXAMPLES
(83) As 14-3-3 is liberated into the synovial space in RA where PAD enzymes are present, we investigated whether 14-3-3 is a citrullination target that may be used in the diagnosis of RA, and if so, whether citrullinated 14-3-3 or fragments could be used to identify anti-CCP negative RA patients. Identification of citrullination sites on 14-3-3 involved a three (3) stage process 1) in silico prediction, 2) in vitro determination and 3) validation or identification with clinical specimens.
Example 1: In Silico Identification of Citrullination Sites
(84) Ariginine (R) moieties that represent putative citrullination sites were identified based on 1) location of the R in relation to the native 3D protein configuration; 2) accessibility of R to PAD enzyme and 3) sequence flanking R. Five (5) putative citrullination sites were identified corresponding to R: 4, 12, 19, 61 and 227.
Example 2: In Vitro Determination of Citrullination Sites
(85) In vitro citrullination was performed whereby recombinant human 14-3-3 eta was co-incubated with either recombinant human PAD2 or PAD4 since these two isoforms have been reported to be the two most relevant in RA.
(86) Briefly, PAD2 (MQ16.201) and PAD4 (MQ16.203) were procured from ModiQuest Research. The enzymes were further diluted in 100 l of PAD buffer (0.1 M Tris HCl, pH 7.4, mM CaCl2 with 5 mM DTT, 1 mM PMSF, 10 g/ml aprotonin, 10 g/ml leupeptin and 10 g/ml pepstatin) bringing the stock concentrations of PAD2 to 80 mU/l and PAD4 to 82.5 mU/l.
(87) Ten (10) g of full-length recombinant 14-3-3 eta was incubated with either PAD2 (8 mU) or PAD4 (8.2 mU). The reaction mixture was adjusted to 100 l with PAD buffer and incubated at 37 C. for 2 h. Following incubation, the reaction was terminated through the addition of 25 l of 4 Lammelli buffer. The proteins were resolved by SDS-PAGE and the band corresponding to 14-3-3 eta was excised. The excised bands were eluted from the gel, trypsinized and then analysed using Fourier Transform Mass Spectrometry to identify determinated sites as described by others. The results yielded four putative citrullination sites with PAD2 and 3 with PAD4 for which the results are described in Table 4.
(88) TABLE-US-00005 TABLE 4 Citrullination sites for 14-3-3 as determined in vitro SEQ ID No Site Sequence NO: PAD PAD2 PAD4 Position 4 mgdReqllq 23 No Yes Yes Position 19 qaeRyddma 24 No Yes Yes Position 42 dRnllsvayk 25 No Yes Yes Position 61 sswRvissie 26 No Yes No
Example 3: Detection of Antibodies Directed to Citrullinated 14-3-3 Eta Using Clinical Samples
(89) In vitro citrullination was performed as described in Example 2, and 96-well plates were coated with either the citrullinated or non-citrullinated form of recombinant 14-3-3 eta. The human auto-antibody response directed to either the native or citrullinated forms of 14-3-3 eta in anti-CCP positive and negative patients were quantified using an anti-human antibody.
(90) To evaluate whether these novel autoantibodies are detectable in anti-CCP negative RA patients and differentially expressed compared to healthy controls, reactivity to both non-citrullinated and citrullinated-14-3-3 eta was measured in 30 anti-CCP negative RA patients and 30 confirmed anti-CCP negative healthy controls. Mean and median autoantibody levels expressed in units (U) was evaluated and corresponding t-tests and Mann-Whitney U-tests were used to determine differences within and between groups. The area under the ROC curve (AUC) was generated for diagnostic utility estimates and to determine likelihood ratios (LR) for various anti-citrulinated-14-3-3 eta cut-offs.
(91)
(92) TABLE-US-00006 Healthy CCP-ve RA patients N = 58 N = 30 mean (SD) 155 U (122 U) 1943 U (3045 U) median (min-max) 100 U (45-564 U) 306 U (68-8982 U) AUC 0.79 95% CI 0.68-0.91 P-value <0.0001 Cut-off 439 U LR 14 Specificity 97% Sensitivity 47%
Example 4: Identification of Citrullination Sites Using Clinical Samples
(93) 14-3-3 eta is immunoprecipitated from clinical samples positive for the 14-3-3 eta protein and the immunoprecipitated protein is resolved by SDS-PAGE and the band corresponding to 14-3-3 eta excised. The excised bands are eluted from the gel, trypsinized and then analysed using Fourier Transform Mass Spectrometry to identify determinated sites on the protein.
(94) Selection of clinically relevant 14-3-3 eta citrullination sites
(95) To identify the most relevant 14-3-3 eta citrillunation sites, peptides bearing either an arginylated or a citrullinated moiety are used to screen and select the most relevant citrullination sites on 14-3-3 eta that can be used to distinguish both the non-citrullinated form of the protein as well as differentiate between healthy individuals or those affected with an arthritide.
(96) Comparing 14-3-3 eta expression levels in clinical samples using two distinct approaches, measurement by MRM/LC-MS and ELISA, illustrates that differences in expression may be attributable to citrullination since determination of arginine yielding citrulline results in a mis-cleavage since trypsin does not cut when the protein is citrullinated, see Table 5. Specifically in samples 1-6 high levels of the 14-3-3 eta protein are detectable by ELISA but appear to have negligible levels when measured by mass spectrometry compared with samples 7-12. With mass spectrometry samples are trypsinized and 14-3-3 eta levels are quantified through measurement of a peak intensity as a results of a specific peptide mass, the peptide of which is AV TELNEPLSNED (SEQ ID NO: 27) which resides next to Arg-42 which has been described here as a citrullination site. Citrullination specific antibodies to Arg-42 will be examined by ELISA in samples 1-12 to verify that Arg-42 is a clinically relevant citrullination site.
(97) TABLE-US-00007 TABLE 5 Sample Mass ID Spec ELISA 1 0 297.8 2 0 23.85 3 0 33.11 4 139 1078.1 5 0 65.85 6 0 18.7 7 5679 64.47 8 1283 29.07 9 9791 7.9 10 14278 47.7 11 1602 3.2 12 2451 31.3
Example 5: Diagnosis, Prognosis, and/or Treatment Monitoring
(98) Detection of Autoantibodies to Citrullinated 14-3-3 Eta Protein in a Clinical Sample
(99) The data presented in
(100) Determination of the Citrullination Status of a 14-3-3 Protein in a Clinical Sample
(101) If a patient measures positive for autoantibodies to citrullinated 14-3-3 eta protein, the protein's citrullination status will be evaluated using monoclonal antibodies raised against either or both full-length citrullinated 14-3-3 eta protein or citrullinated fragments thereof to evaluate two parameters:
(102) 1) How much of the protein is citrullinated?
(103) 2) What sites on protein are citrullinated and/or how many sites are citrullinated?
(104) Titres of the citrullinated 14-3-3 eta auto-antibodies will be examined on their own and in relation to the 14-3-3 eta serum protein levels as well as the citrullination status of the protein. Table 5 below defines possible outcomes.
(105) TABLE-US-00008 TABLE 5 anti-citrullinated 14-3-3 eta 14-3-3 eta auto-antibodies levels protein levels Prognosis High High Bad Low Good Low High Bad Low Good or 14-3-3 eta is not central to disease process
(106) For therapy response and monitoring, high levels of anti-citrullinated 14-3-3 eta autoantibodies may implicate use of certain therapies over others. Additionally, it is expected that a higher % of the protein being citrullinated is correlated with a more significant disease burden. It is also expected that different citrullination sites may impart different biological activity on the protein and thus associate with different clinical outcomes. This information may then be used to assists in determining the type of therapy that would be best for a particular patient and for monitoring therapy response.
(107) For instance, high titres and/or high citrullination status would be useful for treatment using B-cell inhibitors like rituximab or inhibitors that directly target peptidyl arginine deminiases. Monitoring outcomes by measuring pre- and post-treatment levels may also be useful. For instance if levels decrease, then patient may be receiving a benefit from drug i.e. respond to therapy whereas if the levels remain unchanged or increase, then the therapeutic dose may need to be increase or the class of therapy may need to be switched.
(108) All patents and patent publications referred to herein are hereby incorporated by reference.
(109) Certain modifications and improvements will occur to those skilled in the art upon a reading of the foregoing description. It should be understood that all such modifications and improvements have been deleted herein for the sake of conciseness and readability but are properly within the scope of the following claims.