LENTIVIRAL VECTORS AND USES THEREOF
20180327782 ยท 2018-11-15
Inventors
Cpc classification
C12N2830/50
CHEMISTRY; METALLURGY
C12N7/00
CHEMISTRY; METALLURGY
C07K16/2866
CHEMISTRY; METALLURGY
C12N2740/16043
CHEMISTRY; METALLURGY
C07K2319/60
CHEMISTRY; METALLURGY
A61K48/00
HUMAN NECESSITIES
C12N2830/48
CHEMISTRY; METALLURGY
C07K16/00
CHEMISTRY; METALLURGY
C12N15/1037
CHEMISTRY; METALLURGY
C12N2840/44
CHEMISTRY; METALLURGY
C12N2740/15043
CHEMISTRY; METALLURGY
C12N2740/16045
CHEMISTRY; METALLURGY
C07K2319/035
CHEMISTRY; METALLURGY
C12N2800/30
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
International classification
C12N15/86
CHEMISTRY; METALLURGY
C07K16/00
CHEMISTRY; METALLURGY
C12N7/00
CHEMISTRY; METALLURGY
C07K16/28
CHEMISTRY; METALLURGY
Abstract
The invention relates to compositions containing polynucleotide vectors capable of expressing a nucleic acid encoding a fusion polypeptide on the surface of a viral particle and/or a eukaryotic cell.
Claims
1. A method of displaying a candidate polypeptide on the surface of a mammalian cell, comprising the steps of: a) contacting a packaging cell with a viral display vector comprising a nucleic acid sequence encoding a fusion protein under conditions such that said packaging cell generates one or more viral particles comprising said nucleic acid sequence, wherein said fusion protein comprises: i) a leader peptide; ii) a candidate polypeptide; iii) at least a portion of an immunoglobulin molecule; iv) a transmembrane moiety; and b) contacting said viral particles with a mammalian cell, under conditions sufficient to express said fusion protein in said mammalian cell, wherein said candidate polypeptide is displayed on the surface of the mammalian cell.
2. The method of claim 1, wherein said immunoglobulin molecule is further displayed on the surface of the mammalian cell.
3. The method of claim 1, wherein said immunoglobulin molecule comprises the hinge region, the CH2 region or the CH3 region of an IgG molecule or a combination thereof.
4. The method of claim 1, wherein said viral display vector is a lentiviral vector.
5. The method of claim 1, wherein said candidate polypeptide is an antibody or fragment thereof.
6. The method of claim 5, wherein said antibody is a single chain antibody, a domain antibody, a diabody, or Fab fragment.
7. The method of claim 1, wherein said candidate polypeptide is derived from a library.
8. The method of claim 4, wherein said lentiviral vector is obtained from a lentivirus selected from the group consisting of human immunodeficiency virus (HIV), simian immunodeficiency virus (SIV), equine infectious anemia virus (EIAV), visna virus, caprine arthritis-encephalitis virus (CAEV), bovine immune deficiency virus (BIV), bovine leukemia virus (BLV), and feline immunodeficiency virus (FIV).
9. The method of claim 1, wherein said packaging cell further comprises; (i) an envelope vector comprising an env gene operably linked to a promoter and a polyadenylation sequence wherein said env gene encodes a functional envelope protein and; (ii) a helper vector comprising one or more viral structural genes.
10. The method of claim 1, wherein said candidate polypeptide is expressed on the surface of said viral particles prior to contacting said viral particles with said mammalian cell.
11. The method of claim 1, wherein said transmembrane moiety is a viral transmembrane moiety or a mammalian transmembrane moiety.
12. The method of claim 1, wherein said mammalian cell is a Ramos Burkitt's lymphoma cell.
13. A method of displaying a candidate polypeptide on the surface of a viral particle, comprising the step of contacting a packaging cell with a viral display vector comprising a nucleic acid sequence encoding a fusion protein under conditions such that said packaging cell generates one or more viral particles comprising the fusion protein, such that said candidate polypeptide is displayed on the surface of the viral particle, wherein said fusion protein comprises: i) a leader peptide; ii) a candidate polypeptide; iii) at least a portion of an immunoglobulin molecule; iv) a transmembrane moiety; and v) an envelope incorporation signal.
14. The method of claim 13, wherein said candidate polypeptide is an antibody or fragment thereof.
15. The method of claim 14, wherein said antibody is a single chain antibody, a domain antibody, a diabody, or Fab fragment.
16. The method of claim 13, wherein said candidate polypeptide is derived from a library.
17. The method of claim 13, wherein said viral display vector is a lentiviral vector.
18. The method of claim 17, wherein said lentiviral vector is obtained from a lentivirus selected from the group consisting of human immunodeficiency virus (HIV), simian immunodeficiency virus (SIV), equine infectious anemia virus (EIAV), visna virus, caprine arthritis-encephalitis virus (CAEV), bovine immune deficiency virus (BIV), bovine leukemia virus (BLV), and feline immunodeficiency virus (FIV).
19. The method of claim 13, wherein said immunoglobulin molecule comprises the hinge region, the CH2 region or the CH3 region of an IgG molecule or a combination thereof.
20. The method of claim 13, wherein said transmembrane moiety is a viral transmembrane moiety or a mammalian transmembrane moiety
21. The method of claim 13, wherein said packaging cell further comprises; (i) an envelope vector comprising an env gene operably linked to a promoter and a polyadenylation sequence wherein said env gene encodes a functional envelope protein and; (ii) a helper vector comprising one or more viral structural genes.
22. A method of identifying a candidate polypeptide that binds to a target antigen, comprising the steps of: a) contacting a packaging cell with a nucleic acid vector comprising a nucleic acid sequence encoding a fusion protein under conditions such said packaging cell generates one or more viral particles comprising said nucleic acid sequence, wherein said fusion protein comprises: i) a leader peptide; ii) a candidate polypeptide; iii) at least a portion of an immunoglobulin molecule; and iv) a transmembrane moiety, and b) contacting said viral particles with one or more mammalian cells, under conditions such that said one or more mammalian cells each generate a single species of said candidate polypeptide displayed on the surface of said mammalian cells; c) sorting said mammalian cells displaying said single species of said candidate polypeptide on the surface of said mammalian cell; d) contacting said sorted mammalian cells with a target antigen; and e) identifying the mammalian cells that bind to said target antigen, thereby identifying a candidate polypeptide that binds to said target antigen.
23. The method of claim 22, further comprising repeating steps d) and e) one or more times.
24. The method of claim 22, wherein said packaging cell further comprises; (i) an envelope vector comprising an env gene operably linked to a promoter and a polyadenylation sequence wherein said env gene encodes a functional envelope protein and; (ii) a helper vector comprising one or more viral structural genes.
25. The method of claim 22, wherein said candidate polypeptide is an antibody or fragment thereof.
26. The method of claim 22, wherein said candidate polypeptide is derived from a library.
27. The method of claim 28, wherein said viral display vector is a lentiviral vector.
28. The method of claim 27, wherein said lentiviral vector is obtained from a lentivirus selected from the group consisting of human immunodeficiency virus (HIV), simian immunodeficiency virus (SIV), equine infectious anemia virus (EIAV), visna virus, caprine arthritis-encephalitis virus (CAEV), bovine immune deficiency virus (BIV), bovine leukemia virus (BLV), and feline immunodeficiency virus (FIV).
29. The method of claim 22, wherein said nucleic acid vector further comprises an nucleic acid encoding a selectable marker.
30. The method of claim 29, wherein said selectable marker is selected from the group consisting of a green fluorescent protein, a red fluorescent protein, a yellow fluorescent protein, a blue fluorescent protein, a ferredoxin IV protein, a luciferase protein and a aequorin protein.
31. The method of claim 22, wherein said transmembrane moiety is a viral transmembrane moiety or mammalian transmembrane moiety.
32. A method of affinity maturing a candidate polypeptide, comprising the steps of: a) contacting a packaging cell with a nucleic acid vector comprising a nucleic acid sequence encoding a fusion protein, wherein said fusion protein comprises: i) a leader peptide; ii) a candidate polypeptide; iii) at least a portion of an immunoglobulin molecule; and iv) a transmembrane moiety under conditions such that the packaging cell generates one or more viral particles comprising said nucleic acid sequence; b) contacting said one or more viral particles with one or more second mammalian cells, under conditions such that said one or more mammalian cells each generate a single species of candidate polypeptide that is displayed on the surface of said one or more mammalian cells; c) sorting said one or more mammalian cells displaying said single species of candidate polypeptide on the surface of said mammalian cell; d) contacting said sorted one or more mammalian cells with a target antigen; e) identifying those mammalian cells that bind to said target antigen; f) contacting said identified mammalian cells with a decreasing concentration of said target antigen; and g) repeating steps e) and f) one or more times, thereby affinity maturing a candidate polypeptide that binds to said target antigen.
33. The method of claim 32, wherein said packaging cell further comprises; (i) an envelope vector comprising an env gene operably linked to a promoter and a polyadenylation sequence wherein said env gene encodes a functional envelope protein and; (ii) a helper vector comprising one or more viral structural genes.
34. The method of claim 32, wherein said mammalian cells express activation-induced cytosine deaminase (AID) protein.
35. The method of claim 32, wherein said mammalian cells are Ramos Burkitt's lymphoma cells.
36. The method of claim 32, wherein said candidate polypeptide is derived from a library.
37. The method of claim 32, wherein said viral display vector is a lentiviral vector.
38. The method of claim 32, wherein said candidate polypeptide is an antibody or fragment thereof
39. The method of claim 37, wherein said lentiviral vector is obtained from a lentivirus selected from the group consisting of human immunodeficiency virus (HIV), simian immunodeficiency virus (SIV), equine infectious anemia virus (EIAV), visna virus, caprine arthritis-encephalitis virus (CAEV), bovine immune deficiency virus (BIV), bovine leukemia virus (BLV), and feline immunodeficiency virus (FIV).
40. The method of claim 37, wherein said nucleic acid vector further comprises a selectable marker.
41. The method of claim 40, wherein said selectable marker is selected from the group consisting of a green fluorescent protein, a red fluorescent protein, a yellow fluorescent protein, a blue fluorescent protein, a ferredoxin IV protein, a luciferase protein and a aequorin protein.
42. A method of producing a soluble candidate polypeptide, comprising the step of: a) contacting a packaging cell comprising with a viral display vector under conditions such that said packaging cell generates one or more viral particles, wherein said viral vector comprises: i) a first a nucleic acid sequence encoding a fusion protein comprising: a) a leader peptide; b) a candidate polypeptide; c) at least a portion of an immunoglobulin molecule; and d) a transmembrane moiety flanked by a loxP sites ii) a second nucleic acid sequence encoding a cre recombinase polypeptide, operably linked to an inducible promoter, b) contacting said viral particles with a mammalian cell, under conditions sufficient to express said fusion protein and said cre recombinase in said mammalian cell, whereby a soluble candidate polypeptide is produced by said mammalian cell.
43. The method of claim 42, wherein said candidate polypeptide is an antibody.
44. The method of claim 43, wherein said antibody is a single chain antibody, a domain antibody, a diabody, or Fab fragment.
45. The method of claim 42, wherein said candidate polypeptide is derived from a library.
46. The method of claim 42, wherein said viral display vector is a lentiviral vector.
47. The method of claim 46, wherein said lentiviral vector is obtained from a lentivirus selected from the group consisting of human immunodeficiency virus (HIV), simian immunodeficiency virus (SIV), equine infectious anemia virus (EIAV), visna virus, caprine arthritis-encephalitis virus (CAEV), bovine immune deficiency virus (BIV), bovine leukemia virus (BLV), and feline immunodeficiency virus (FIV).
48. A viral display vector comprising a first nucleic acid sequence encoding a fusion protein comprising: i) a leader peptide; ii) a candidate polypeptide; iii) at least a portion of an immunoglobulin molecule; and iv) a transmembrane moiety; and
49. The method of claim 48, wherein said immunoglobulin molecule comprises the hinge region, the CH2 region or the CH3 region of an IgG molecule or a combination thereof.
50. The method of claim 48, wherein said candidate polypeptide is an antibody or fragment thereof.
51. The method of claim 50, wherein said antibody is a single chain antibody, a domain antibody, a diabody, or Fab fragment.
52. The method of claim 48, wherein said candidate polypeptide is derived from a library.
53. The method of claim 48, wherein said viral display vector is a lentiviral vector.
54. The method of claim 53, wherein said lentiviral vector is obtained from a lentivirus selected from the group consisting of human immunodeficiency virus (HIV), simian immunodeficiency virus (SIV), equine infectious anemia virus (EIAV), visna virus, caprine arthritis-encephalitis virus (CAEV), bovine immune deficiency virus (BIV), bovine leukemia virus (BLV), and feline immunodeficiency virus (FIV).
55. The viral display vector of claim 48, wherein said first nucleic acid further comprises a selectable marker.
56. The viral display vector of claim 55, wherein said selectable marker is a bioluminescent protein moiety.
57. The viral display vector of claim 56, wherein said bioluminescent protein moiety is selected from the group consisting of a green fluorescent protein, a red fluorescent protein, a yellow fluorescent protein, a blue fluorescent protein, a ferredoxin IV protein, a luciferase protein and a aequorin protein.
58. The viral display vector of claim 53, further comprising two or more loxP sites, wherein said loxP sites flank said transmembrane moiety,
59. The viral display vector of claim 53, further comprising a second nucleic acid sequence encoding a cre recombinase protein operably linked to an inducible promoter.
60. The viral display vector of claim 53, wherein said first nucleic acid sequence is operably linked to an inducible promoter.
61. The viral display vector of claim 60, wherein said inducible promoter is selected from the group consisting of a tetracycline inducible promoter, an alcohol inducible promoter, a steroid inducible promoter, a metal inducible promoter, a light inducible promoter, and a temperature inducible promoter.
62. A vector system, comprising: a) the viral display vector of claim 53; b) an envelope vector comprising an env gene operably linked to a promoter and a polyadenylation sequence wherein said env gene encodes a functional envelope protein and; (c) a helper vector comprising one or more viral structural genes.
63. The vector system of claim 62, wherein said env gene comprises a vesicular stomatitis virus glycoprotein gene.
64. The vector system of claim 62, wherein said one or more viral structural genes are selected from the group consisting of gag, pol, tat, and rev.
65. A nucleic acid viral targeting vector comprising: a) a first nucleic acid sequence encoding a fusion protein, wherein said fusion protein comprises: i) a leader peptide; ii) a candidate polypeptide; iii) at least a portion of an immunoglobulin molecule; and iv) a transmembrane moiety flanked by a loxP; b) a second nucleic acid sequence comprising a toxin c) a third nucleic acid sequence encoding cre recombinase operably linked to an inducible promoter; and d) a fourth nucleic acid sequence encoding an entry moiety.
66. The viral targeting vector of claim 65, wherein said entry moiety is selected from the group consisting of a viral envelope protein, a eukaryotic protein having fusogenic activity, a binding-defective hemagglutinin protein, and a binding-defective influenza hemagglutinin protein.
67. A nucleic acid viral targeting vector comprising: a) a first nucleic acid sequence encoding a fusion protein, wherein said fusion protein comprises: i) a leader peptide; ii) a candidate polypeptide; iii) at least a portion of an immunoglobulin molecule; iv) a toxin; and v) a transmembrane moiety flanked by a loxP; b) a second nucleic acid sequence encoding cre recombinase operably linked to an inducible promoter; and c) a third nucleic acid sequence encoding an entry moiety.
68. The viral targeting vector of claim 67, wherein said entry moiety is selected from the group consisting of a viral envelope protein, a eukaryotic protein having fusogenic activity, a binding-defective hemagglutinin protein, and a binding-defective influenza hemagglutinin protein.
69. A method for the targeted delivery of a nucleic acid sequence in a subject, wherein said nucleic acid sequence encodes a fusion protein, wherein said fusion protein comprises: i) a leader peptide; ii) a candidate polypeptide; iii) at least a portion of an immunoglobulin molecule; iv) a transmembrane moiety; and v) an entry moiety, wherein the nucleic acid is expressed on the surface of a viral particle, and wherein the candidate polypeptide specifically binds to a target cell surface antigen, the method comprising introducing said viral particle into the subject, such that said viral particle contacts a cell expressing said target cell surface antigen under conditions such that said candidate polypeptide selectively binds to said cell and said nucleic acid transduces said cell.
70. The viral targeting vector of claim 69, wherein said entry moiety is selected from the group consisting of a viral envelope protein, a eukaryotic protein having fusogenic activity, a binding-defective hemagglutinin protein, and a binding-defective influenza hemagglutinin protein.
71. The method of claim 22, wherein said one or more mammalian cells express a calcium-sensitive bioluminescent protein.
72. The method of claim 71, wherein said calcium-sensitive bioluminescent protein is aequorin.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
DETAILED DESCRIPTION OF THE INVENTION
[0051] This invention provides methods and compositions for displaying a candidate polypeptide on the surface of a viral particle (i.e. virion) or a eukaryotic cell, e.g., mammalian cell. The methods and compositions of the invention employ a viral display vector containing a nucleic acid sequence encoding a fusion protein containing the candidate polypeptide. The vector is introduced into a packaging cell such that the packaging cell generates one or more viral particles containing nucleic acid encoding the fusion protein and displaying the candidate polypeptide on the surface of the particle. A mammalian display cell is contacted with the viral particles such that the mammalian cell expresses (i.e., transiently or stably) the fusion protein such that the candidate polypeptide is displayed on surface of the cell.
[0052] The expression of candidate polypeptides on the surface of a mammalian cell has a number of advantages over other expression modalities, such as E. coli, yeast, and baculoviral infection of Sf9 insect cells. For example, the candidate polypeptide produced in mammalian cells contain post-translational modifications, such as glycosylation and sulfation, that are not made in these other expression systems. Moreover, correct protein folding is increased in mammalian cells as compared to cells that lack chaperone proteins and other cellular components that increase correct folding. Additionally, the candidate polypeptides are free of bacterial, yeast or baculovirus contaminants
[0053] The methods of the invention are useful, for example, to screen libraries containing nucleic acids encoding polypeptides in order to identify candidate polypeptide that binds a target antigen.
Viral Display Vectors
[0054] A viral display vector of the invention is a nucleic acid vector capable of expressing, constitutively or upon induction, a fusion protein. For example, the viral display vector is a lentiviral vector. Lentivirus vectors include, for example, a human immunodeficiency virus (HIV) (e.g, HIV-1 and HIV-2), simian immunodeficiency virus (SIV), equine infectious anemia virus (EIAV), visna virus, caprine arthritis-encephalitis virus (CAEV), bovine immune deficiency virus (BIV), bovine leukemia virus (BLV), or feline immunodeficiency virus (FIV).
[0055] A preferred lentiviral vector is obtained from HIV-1. HIV-1 vectors have been demonstrated to stably transduce non-dividing cells in vitro (See, J. Reiser et al., Proc. Natl. Acad. Sci. USA, 93:15266-15271 (1996)) and in vivo See, L. Naldini et al., Science, 272:263-267 (1996)). Thus, these vectors are capable of long-term expression. A list of suitable viruses and the cells infected thereby is provided in US Patent Application 2003/0044981, the contents of which are incorporated herein by reference in its entirety.
[0056] The nucleic acid sequence encoding the fusion protein is generally under the control of a regulatory element. By regulatory element is meant a nucleic acid sequence sufficient to direct transcription. Regulatory elements include, for example, promoters. Regulatory elements are constitutive or inducible, and may be coupled to additional sequences or elements, which render promoter-dependent gene expression cell-type specific, tissue-specific or inducible by external signals or agents. Such elements may be located in the 5 or 3 region of the native gene, or within an intron.
[0057] The regulatory element is operably linked to the fusion protein. By operably linked is meant that a coding sequence and a regulatory sequence(s) are connected in such a way as to permit gene expression when the appropriate molecules (e.g., transcriptional activator proteins) are bound to the regulatory sequence(s).
[0058] Suitable constitutive promoters include, e.g., SV40, CMV, CDK9, PGK, and ubiquitin C. An exemplary CMV promoter sequence is GenBank Accession numbers BD015376 and BD015377.
[0059] An inducible promoter system includes the tetracycline repressor (tetR), wherein expression of the nucleic acid encoding the fusion proteins of the invention is dependent on the activity of an inducible transcriptional activator. (See, Yao et al., Human Gene Therapy 9:1939-1950 (1998). (See, Baron et al. Tet repressor-based system for regulated gene expression in eukaryotic cells: Principles and advances. Methods Enzymol 327: 401-21(2000)).
[0060] The tet expression system includes Tet-On and Tet-Off systems. In the Tet-On system, transcription is active in the presence of the tetracycline (Tc) derivative doxycycline (Dox). Conversely, in the Tet-Off system, transcription is inactive in the presence of tetracycline or Dox. In the Tet-Off expression system, a tetracycline-controlled transactivator protein (tTA), which is composed of the Tet repressor DNA binding protein (TetR) from the Tc resistance operon of Escherichia coli transposon Tn10 fused to the strong transactivating domain of VP16 from Herpes simplex virus, regulates expression of a target gene that is under transcriptional control of a tetracycline-responsive promoter element (TRE). The TRE is made up of Tet operator (tetO) sequence concatamers fused to a minimal promoter (commonly the minimal promoter sequence derived from the human cytomegalovirus (hCMV) immediate-early promoter). In the absence of Tc or Dox, tTA binds to the TRE and activates transcription of the target gene. In the presence of Tc or Dox, tTA cannot bind to the TRE, and expression from the target gene remains inactive.
[0061] The Tet-On system is based on a reverse tetracycline-controlled transactivator, rtTA. Like tTA, rtTA is a fusion protein comprised of the TetR repressor and the VP16 transactivation domain; however, a four amino acid change in the tetR DNA binding moiety alters rtTA's binding characteristics such that it can only recognize the tetO sequences in the TRE of the target transgene in the presence of the Dox effector. Thus, in the Tet-On system, transcription of the TRE-regulated target gene is stimulated by rtTA only in the presence of Dox.
[0062] Alternatively, the inducible promoter system is the lac repressor system from E. coli. (See, Brown et al., Cell 49:603-612 (1987). The lac repressor system functions by regulating transcription of nucleic acids having mammalian cell promoters that contain the lac operator (lacO), a nucleic acid sequence to which the lac repressor (lacR) binds, preventing transcription of the target nucleic acids regulated by the lacO-containing promoter. Expression of the target nucleic acids is induced by isopropyl--D-thiogalactopyranoside (IPTG) treatment. For example, 293T cells are transfected with a lentiviral display vector containing a nucleic acid encoding an antibody fusion protein and a nucleic acid encoding eGFP, both of which are under the control CMV promoter having a lacO, e.g., by electroporation. The induction levels of antibodies is examined before and after IPTG treatment (0.5 mmol/L) by Western blot analysis or other measurement techniques known in the art.
[0063] Other inducible systems include FK506 dimer, VP16 or p65 using estradiol, RU486, diphenol murislerone, rapamycin, and the ecdysone inducible system.
[0064] Organ/tissue-specific promoter include, for example, the prion protein promoter or the neuron-specific enolase promoter, the CaMKII-alpha promoter, the LAP promoter, the Clara cell 10-kD protein (CC 10) promoter can be used for lung-specific expression, the Mouse mammary tumor virus long terminal repeat, the human keratin 14 (K14) promoter, the bovine keratin 6 (K6) promoter/regulatory region, the Tek or Tie promoter and the whey acidic protein (WAP) promoter or the -lactoglobulin promoter.
[0065] Optionally, the viral display vectors of the present invention contain a selectable marker. In general, any gene encoding a gene product that allows for selection of the cell carrying the display vector can be used as the selectable marker. Such selection systems are well known in the art and include genes that change the sensitivity of a cell to a stimulus such as a nutrient, or an antibiotic. Examples of selectable markers include, but are not limited to, known genes encoding resistance to antibiotics such as the aminoglycoside antibiotics (including, e.g., neomycin, hygromycin, kanamycin, bleomycin, and G418). (See, e.g., Potrykus et al., Mol. Gen. Genet. 199:183-188 (1985). Other selectable markers include the dihydrofolate reductase (DHFR) gene, which confers resistance to methotrexate (See, Thillet et al., J. Biol. Chem. 263:12500-12508 (1988). Other selectable markers are genes that express proteins that directly or indirectly produces light, either constitutively or upon being contacted with a compound. For example, other selectable markers include, green fluorescent protein, red fluorescent protein, yellow fluorescent protein, blue fluorescent protein, ferredoxin IV, LacZ, members of the luciferase family, or members of the aequorin family.
[0066] The selectable marker is linked to the candidate polypeptide by the use of an internal ribosome entry site (IRES) (see Marasco et al., PCT/US96/16531). The presence of an IRES sequence directs the nearly simultaneous production of the fusion protein and the selectable marker, if present. This nearly simultaneous co-expression allows for the selection of cells expressing the fusion protein based on detection of the selectable marker. IRES sequences are known in the art and include those from encephalomyocarditis virus (EMCV) (Ghattas, I. R. et al., Mol. Cell Biol., 11: 5848-5849 (1991)); BiP protein (Macejak and Samow, Nature, 353:91 (1991)); the Antennapedia gene of Drosophila (exons d and e) (Oh et al., Genes & Dev., 6: 1643-1653 (1992)); those in polio virus (Pelletier and Sonenberg, Nature 334:320325 (1988); see also Mountford and Smith, TIG, 11:179-184 (1985)).
[0067] The lentiviral display vector may also contain additional nucleotide sequences, including a portion of the gag gene (gag, which allows the transduction of dividing and non-dividing cells), e.g., about 41 nucleotides at the 5 end of the gag gene bounded by a Cla I site (see, e.g.,
[0068] Numerous modifications can be made to the vectors, which are used to create the particles to further minimize the chance of obtaining wild type revertants. These include deletions of the U3 region of the LTR, tat deletions and matrix (MA) deletions.
[0069] An exemplary lentiviral display vector is shown in schematic form in
[0070] The lentiviral virion (particle) is expressed by a vector system encoding the necessary viral proteins to produce a virion (viral particle). For example, the packaging cell is further transduced with one or more additional vectors encoding all the necessary viral protein to produce the viral particle. Additional vectors include a helper vector containing one or more viral structural genes. Preferably, there is at least one vector containing a nucleic acid sequence encoding the lentiviral pol proteins necessary for reverse transcription and integration, operably linked to a promoter. Preferably, the pol proteins are expressed by multiple vectors. There is also a vector containing a nucleic acid sequence encoding the lentiviral gag proteins necessary for forming a viral capsid operably linked to a promoter. Preferably, this gag nucleic acid sequence is on a separate vector than at least some of the pol nucleic acid sequence, still more preferably it is on a separate vector from all the pol nucleic acid sequences that encode pol proteins.
[0071] The gag, pol and env vector(s) do not contain nucleotides from the lentiviral genome that package lentiviral RNA, referred to as the lentiviral packaging sequence. In HIV this region corresponds to the region between the 5 major splice donor and the gag gene initiation codon (nucleotides 301-319).
[0072] The vector(s) forming the particle preferably do not contain a nucleic acid sequence from the lentiviral genome that expresses an envelope protein. Preferably, a separate vector (i.e., an envelope vector that contains a nucleic acid sequence encoding an envelope protein operably linked to a promoter is used. This env vector also does not contain a lentiviral packaging sequence. The envelope protein is from the lentivirus from which the lentiviral display vector is derived. Alternatively, the envelope protein is not from the lentivirus from which the lentiviral display vector is derived but is derived from a different virus. The resultant viral particle is referred to as a pseudotyped particle.
[0073] As shown in
[0074] As shown in
[0075] Introduction of a viral display vector, an envelope vector and a helper vector into a packaging cell) is useful, i.e., to produce a viral particle containing a nucleic acid encoding the fusion protein of the invention. Alternatively, a portion (or all) of the envelope vector and/or helper vector nucleic sequences can be contained within the viral display vector.
[0076] Suitable packaging include any cells capable of generating a lentiviral particle. Packaging cells include primary cells, embryonic stem cells and cell lines. Preferred packaging cells include for example, BHK, VERO, HT1080, 293, 293T, RD, COS-7, CHO, Jurkat, HUT, SUPT, C8166, MOLT4/clone8, MT-2, MT-4, H9, PM1, CEM, myeloma cells (e.g., SB20 cells) and CEMX174 cells. Such cell lines are available, for example, from the A.T.C.C., Manassas Va.
[0077] Fusion Proteins
[0078] A fusion protein contains a leader peptide, a candidate polypeptide, at least a portion of an immunoglobulin molecule and a transmembrane moiety. Optionally, the fusion protein contains an envelope incorporation signal. The leader peptide, candidate polypeptide, the portion of the immunoglobulin molecule and the transmembrane moiety is operably linked. By operably-linked is intended to mean that the nucleotide sequences of interest are in a manner that allows for expression of the nucleotide sequence (e.g., in a host cell when the vector is introduced into the host cell). Preferably, nucleic acid encoding the leader peptide is operably linked to the nucleic acid encoding the candidate polypeptide that is operably linked to the nucleic acid of the transmembrane moiety.
[0079] As used herein, the term fusion protein includes a polypeptide containing all or a portion of the amino acid sequences of two or more proteins. The terms protein and polypeptide are used interchangeably herein. The term portion includes any region of a polypeptide, such as a fragment (proteolytically or otherwise obtained) or a domain (a region of a polypeptide having an activity, such as, e.g., enzymatic activity or antigen- or DNA-binding) that contains fewer amino acids than the full-length polypeptide. Those skilled in the art will recognize that the terms portion and fragment are also used interchangeably herein.
[0080] Leader Peptide
[0081] A leader peptide includes a peptide that direct a newly synthesized protein in the ribosome to the Golgi complex for transport to the plasma membrane or out of the cell. (See, Nielsen et al., Identification of prokaryotic and eukaryotic signal peptides and prediction of their cleavage sites Protein Engineering, vol. 10 no. 1 pp. 1-6, 1997). Leader polypeptides are also known as signal peptides or signal polypeptides. Leader peptides generally include a string of hydrophobic amino acids. Leader peptides include an immunoglobulin leader sequence, polyhistidine or polyvaline sequences, as well as others known to those skilled in the art. Exemplary leader peptides are provided in Table 1.
[0082] Leader peptides include peptides having three regions: an n-region, which is a positively charged region at the N-terminus of the signal peptide (the left end of the sequence); an h-region having a hydrophobic core, optionally in the middle of the signal peptide; and a c-region, a generally polar region at the C-terminus of the leader sequence with generally small and neutral amino acids at position 1 and 3.
[0083] Leader peptides of the invention include peptides capable of being acted upon by signal peptidase, a specific protease located on the cisternal face of the endoplasmic reticulum. Leader polypeptides of the present invention also include polypeptides identified using the SIGFIND program, which predicts signal peptides at the start of protein sequences and searches open reading frames with a potential signal peptide coded in nucleotide sequences. (See, Finding Signal Peptides in Human Protein Sequences using Recurrent Neural Networks (2002) Reczko et al., In R. Guigo and D. Gusfield (eds.): Algorithms in Bioinformatics, Proceedings of the 2nd Int. Workshop WABI 2002, Rome, Italy, September 16-21, Lecture Notes in Computer Science, Springer, Volume 2452, pp. 60-67).
[0084] The SIGFIND program provides a score (the sig.pep score, which ranges from 0 (no signal peptide) to 9 (maximum score for presence of a signal peptide)) along the sequence that indicates the location and size of the signal peptide. Generally, a decrease in the sig.pep score from higher to lower indicates the approximate position of the signal peptide cleavage site.
TABLE-US-00001 TABLE1 Ig-kappachainleadersequence:Met-Glu-Thr-Asp-Thr-Leu-Leu-Leu-Trp-Val-Leu- Leu-Leu-Trp-Val-ProGlySerThrGlyAsp(SEQIDNO:2) BacteriophageT7gene10leaderprotein:Met-Ala-Ser-Met-Thr-Gly-Gly-Gln-Gln- Met-Gly(SEQIDNO:3) Tandempolyvalineheptadrepeats:(Val-Val-Val-Val-Val-Val).sub.n(SEQIDNO:4) Preproalbumin:Met-Lys-Trp-Val-Thr-Phe-Leu-Leu-Leu-Leu-Phe-Ile-Ser-Gly-Ser-Ala- Phe-Ser(SEQIDNO:5) Pre-IgGlightchain:Met-Asp-Met-Arg-Ala-Pro-Ala-Gln-Ile-Phe-Gly-Phe-Leu-Leu-Leu- Leu-Phe-Pro-Gly-Thr-Arg-Cys(SEQIDNO:6) Prelysozyme:Met-Arg-Ser-Leu-Leu-Ile-Leu-Val-Leu-Cys-Phe-Leu-Pro-Leu-Ala-Ala-Leu- Gly(SEQIDNO:7) Acetylcholinereceptorgammasubunitprecursor:Met-Val-Leu-Thr-Leu-Leu-Leu-Ile- Ile-Cys-Leu-Ala-Leu-Glu-Val-Arg-Ser(SEQIDNO:8) ERsignalpeptide:X.sub.1-Leu-Leu-Leu-Val-Gly-Ile-Leu-Phe-Trp-Ala-X.sub.2(SEQIDNO:9).X.sub.1 maybeanyoneormoreaminoacidsornothing.X.sub.2istheremainderofthepolypeptide.
[0085] Candidate Polypeptide
[0086] A candidate polypeptide is any polypeptide or fragment thereof in which expression on the surface of a viral capsid or mammalian cell is desired. A candidate polypeptide is a native a cell surface polypeptide. Alternatively, a candidate polypeptide is not a native cell surface polypeptide. The candidate polypeptide is an antibody or fragment thereof, a toxin, a hormone, a growth factor, a receptor, or a signaling molecule.
[0087] As used herein, the term antibody or function fragment thereof refers to immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen. Such antibodies include, polyclonal, monoclonal, chimeric, single chain, F.sub.ab, F.sub.ab and F.sub.(ab)2 fragments, and an F.sub.ab expression library.
[0088] By specifically bind or immunoreacts with is meant that the antibody reacts with one or more antigenic determinants of the desired antigen and does not react (i.e., bind) with other polypeptides or binds at much lower affinity (K.sub.d>10.sup.6) with other polypeptides.
[0089] As used herein, the terms immunological binding, and immunological binding properties refer to the non-covalent interactions of the type that occur between an immunoglobulin molecule and an antigen for which the immunoglobulin is specific. The strength, or affinity of immunological binding interactions can be expressed in terms of the dissociation constant (K.sub.d) of the interaction, wherein a smaller K.sub.d represents a greater affinity. Immunological binding properties of selected polypeptides are quantified using methods well known in the art. One such method entails measuring the rates of antigen-binding site/antigen complex formation and dissociation, wherein those rates depend on the concentrations of the complex partners, the affinity of the interaction, and geometric parameters that equally influence the rate in both directions. Thus, both the on rate constant (K.sub.on) and the off rate constant (K.sub.off) can be determined by calculation of the concentrations and the actual rates of association and dissociation. (See Nature 361:186-87 (1993)). The ratio of K.sub.off/K.sub.on enables the cancellation of all parameters not related to affinity, and is equal to the dissociation constant K.sub.d. (See, generally, Davies et al. (1990) Annual Rev Biochem 59:439-473).
[0090] The candidate polypeptide can be obtained from a library. Preferred libraries include human single-chain antibody libraries, natural peptide libraries, and random peptide libraries. Exemplary libraries include the Mehta I and Mehta II phage display libraries. (See, Gennari et al., J. Mol. Biol. 335(1):193-207 (2004)). The Mehta I library contains 15 billion sFv inserts; the Mehta II library contains 12 billion sFv inserts. Natural peptide libraries are known in the art. (See, Matthews et al., J. Immunol. 169(2): 837-46 (2002)). Preferably, a natural peptide library contains peptides from about 25 to about 200 amino acids in length, as this size peptide has been demonstrated to represent native epitopes. (See, Fack et al., J. Immunol. Methods 206:43 (1997); Matthews et al., J. Immunol. 169:837 (2002)). Random peptide libraries are known in the art and are available from BD Biosciences (San Jose, Calif.), New England Biolabs (Beverly, Mass.) and other commercial sources. Library inserts can be amplified and ligated into the viral display vectors of the invention. Alternatively, the inserts can be excised from the host library and ligated into the viral display vectors.
[0091] Immunoglobin Polypeptides
[0092] The fusion polypeptide further includes at least a region of a an immunoglobulin polypeptide. At least a region is meant to include any portion of an immunoglobulin molecule, such as the light chain, heavy chain, F, region, hinge region, CH1 region, CH2 region, CH3 region Fab region, Fv region or any fragment or combination thereof. Preferably, the immunoglobulin polypeptide contains the hinge region, the CH2 region and CH3 region of an IgG molecule (e.g., IgG1).
[0093] Transmembrane Moiety
[0094] A transmembrane moiety (or transmembrane domain) is a plurality of amino acids that is capable of extending across a biological membrane of a cell, such as the plasma membrane or a membrane of an organelle. A transmembrane moiety is a polypeptide capable of inserting into and remaining anchored within the viral capsid surface and/or the plasma membrane of a mammalian cell. When included in the fusion protein of the invention, the transmembrane moiety is capable of localizing the fusion protein to the viral capsid surface and/or to the plasma membrane of a mammalian cell. The transmembrane moiety is a viral transmembrane moiety, such as a lentiviral transmembrane moiety. Lentiviral transmembrane moieties include for example envelope polypeptide from HIV, SIV, CAEV, BIV, BLV, and FIV or a functional fragments thereof.
[0095] The HIV-1 gp160 envelope polypeptide is a polypeptide of about 856 amino acids (See Table 2; SEQ ID NO:1 and GenBank Accession numbers AAO40783, AAA76671, BAA12995, and P03377) that is proteolytically processed into a gp120 and a gp41 polypeptide. The amino acid sequence of an HIV-1 gp160 envelope polypeptide is provided as SEQ ID NO:1 in Table 2. The gp41 polypeptide includes amino acids 512-856 of SEQ ID NO: 1 (See also, GenBank Accession No.: NP_057856). The transmembrane moiety of gp41 is generally located between about amino acids 675-715 of the gp160 polypeptide. Additional, lentiviral envelope proteins are provided by GenBank Accession numbers AAT41729 from SIV, P31627 from CAEV, P19557 from BIV, P03380 from BLV, and NP_040976 envelope from FIV.
TABLE-US-00002 TABLE2 PolypeptidesequenceofHIV-1gp160(SEQIDNO:1) mrvkekyqhlwrwgwrwgtmllgmlmicsateklwvtvyygvpvwkeatt tlfcasdakaydtevhnvwathacvptdpnpqevvlvnvtenfnmwkndm veqmhediislwdqslkpcvkltplcvslkctdlkndtntnsssgrmime kgeikncsfnistsirgkvqkeyaffykldiipidndttsykltscntsv itqacpkvsfepipihycapagfailkcnnktfngtgpctnvstvqcthg irpvvstqlllngslaeeevvirsvnftdnaktiivqlntsveinctrpn nntrkririqrgpgrafvtigkignmrqahcnisrakwnntlkqiasklr eqfgnnktiifkqssggdpeivthsfncggeffycnstqlfnstwfnstw stegsnntegsdtitlpcrikqiinmwqkvgkamyappisgqircssnit gllltrdggnsnneseifrpgggdmrdnwrselykykvvkieplgvaptk akrrvvqrekravgigalflgflgaagstmgaasmtltvqarqllsgivq qqnnllraieaqqhllqltvwgikqlqarilaverylkdqqllgiwgcsg klicttavpwnaswsnksleqiwnhttwmewdreinnytslihslieesq nqqekneqelleldkwaslwnwfnitnwlwyiklfimivgglvglrivfa vlsivnrvrqgysplsfqthlptprgpdrpegieeeggerdrdrsirlvn gslaliwddlrslclfsyhrlrdlllivtrivellgrrgwealkywwnll qywsqelknsavsllnataiavaegtdrvievvqgacrairhiprrirqg lerill
[0096] Alternatively, the transmembrane moiety is a mammalian transmembrane moiety, such as CD28, CD8, or IgM transmembrane moiety or functional fragment.
[0097] As used herein, a functional fragment of a transmembrane moiety includes any portion or fragment of a transmembrane moiety that is sufficient to localize the fusion protein to the surface of the viral particle and/or to the mammalian cell plasma membrane. For example, a transmembrane domain includes the amino acid sequence NRVRQGYS (SEQ ID NO: 14) or GGTETSQVAPA (SEQ ID NO: 15).
[0098] Generally, transmembrane moieties have positively charged amino acids (such as lysine and arginine) at their ends and uncharged amino acids in the center. Transmembrane proteins are capable of having an N-terminal signal sequence that targets these polypeptides to the endoplasmic reticulum. Transmembrane moieties include polypeptide sequences having one or more alpha-helical structures. Usually, an alpha-helical transmembrane domain of 25 or more amino acids in length is sufficient to span the plasma membrane. Alternatively, the transmembrane moiety may include a polypeptide having one or more beta-barrel structures. An exemplary transmembrane moiety includes the transmembrane domain from gylcophorin A (Val-Gln-Leu-Ala-His-His-Phe-Ser-Glu-Pro-Glu-Ile-Thr-Leu-Ile-Ile-Phe-Gly-Val-Met-Ala-Gly-Val-Ile-Gly-Thr-Ile-Leu-Leu-Ile-Ser-Tyr-Gly-Ile; SEQ ID NO: 10). In some embodiments, transmembrane domains include polypeptide sequences having two or more -sheets.
[0099] Transmembrane moieties include polypeptides provided in the TMbase of transmembrane proteins and their membrane-spanning domains. (See, K. Hofmann & W. Stoffel (1993), TMbaseA database of membrane spanning proteins segments. Biol. Chem. Hoppe-Seyler 374,166.) The TMbase database contains information from SwissProt and other database sources. Transmembrane moieties of the present invention include polypeptides identified using the TMpred program, which makes a prediction of membrane-spanning regions and their orientation using an algorithm based on the statistical analysis of the TMbase database of naturally occurring transmembrane proteins. Other programs capable of determining transmembrane domains in a polypeptide include GREASE, TMHMM, and TMAP.
Methods of Displaying a Candidate Polypeptide on a Viral Capsid
[0100] The viral display vector containing the nucleic acid encoding the fusion protein is introduced into a packaging cell. As used herein, the introduction of DNA into a cell is referred to as transduction, sometimes also known as transfection or infection.
[0101] Generally, the display vector is introduced by transfection in combination with one or more unlinked vectors, but one of skill in the art will appreciate that the methods of the invention can employ the use of other methods of introducing a nucleic acid vector into a recipient cell, including, but not limited to, microinjection. Preferred transfection means are calcium phosphate, FUGENE 6 (Roche Diagnostics, Indianapolis, Ind.), and POLYFECT (Qiagen, Valencia, Calif.). The packaging cell is further transfected with a one, an envelope vector and a helper vector. The ratio of display vector:envelope vector:helper vector is about 2:1:2. Alternatively, the ratio of display vector:envelope vector:helper vector is about 1:2:1.
[0102] Following the introduction of the vector(s) into the packaging cell, the packaging cell generates one or more viral particles containing a nucleic acid encoding the fusion protein and the candidate polypeptide on the viral capsid. Optionally, the viral particles produced by the packaging cells are purified and/or concentrated by any means known to those skilled in the art. For example, viral particles expressing a nucleic acid encoding a selectable marker (e.g., eGFP) are then sorted by fluorescence assisted cell sorting (FACS) by detecting the expressed selectable marker. Alternatively, the viral particles are collected by filtration (e.g., filtration through a 0.45 m and/or 0.22 m filter) and pelleted by centrifugation at 100,000g).
[0103] Viral particles having a candidate polypeptide or fragment thereof expressed on their surface can be used to identify those candidate polypeptides that bind to an antigen of interest (e.g., a target antigen). One or more viral particles, containing the fusion protein of the invention are contacted with a target antigen that has been tagged (e.g., a fluorescent tag such as FITC is attached chemically to the antigen). The viral particles are provided in solution. Alternatively, the viral particles are attached to a solid support. A solid support includes for example, a chip, a bead, paper or polystyrene The tagged target antigen contacts and binds the candidate polypeptide, and viral particles having a candidate polypeptide to which the target antigen has bound are selected by FACS or other suitable means known to those skilled in the art. The nucleic acid sequence encoding the candidate polypeptide may be sequenced, either directly or following amplification. In this way, the candidate polypeptide that binds to the target antigen can be identified.
Methods of Displaying a Candidate Polypeptide on the Surface of a Mammalian Cell
[0104] The invention also provides methods for the display of a candidate polypeptide on the surface of mammalian cells, which is useful, for example, to screen libraries containing polypeptides, antibodies or antibody fragments. It has recently been recognized that post-translational modifications such as N-linked and O-linked glycosylation, and sulfation. of polypeptides, e.g., antibodies play an important structural role. Thus, polypeptides produced by the methods of the invention will contain these post-translational modifications, while polypeptides produced in bacteria (e.g., using the method of phage display) will lack these post-translational modifications.
[0105] Candidate polypeptides are displayed on the surface of a mammalian cell by transfecting a packaging cell with the viral display vector containing the nucleic acid encoding the fusion protein as described above. Optionally, the nucleic acid encoding the fusion protein is expressed such that the candidate polypeptide is displayed on the surface of the viral capsid. However, those skilled in the art will recognize that expression of the fusion protein on the surface of the viral capsid is not necessary in order to achieve expression of the fusion protein on the surface of the mammalian cell.
[0106] Viral particles produced by the packaging cell are then contacted with a mammalian display cell, such that the mammalian display cell is infected by the viral particle. The viral particles are contacted with the mammalian cells at a multiplicity of infection (MOI) that will provide on average only 0-1 integrations per cell. For example, the viral particles are contacted with the mammalian cells at a multiplicity of infection of about 1. Generally, the viral vector is stably integrated into the mammalian cell. Alternatively, the integration is transient. The presence of the transmembrane moiety of the fusion polypeptide targets the expressed fusion protein to the surface of the mammalian cell such that the candidate polypeptide is displayed on the plasma membrane. Based upon the MOI, each mammalian cell will have a contain a unique nucleic acid encoding the fusion protein and thus a unique a candidate polypeptide on its surface. For example, if an antibody library used, (e.g., one or both of the Mehta libraries), to create the viral vector it should be possible to obtain 27 billion mammalian cells, each expressing a unique antibody on its cell surface.
[0107] Exemplary mammalian display cells include, BHK, VERO, HT1080, 293, 293T, RD, COS-7, CHO, Jurkat, HUT, SUPT, C8166, MOLT4/clone8, MT-2, MT-4, H9, PM1, CEM, myeloma cells (e.g., SB20 cells), and CEMX174 cell lines. Another exemplary mammalian display cells include the M12g3R (IgM+) B cell line. (See Rider et al., 2003 Science 301:213-15.)
[0108] The mammalian display cell is a cell line that is capable of constitutively mutating nucleic acids that are either stably or transiently transfected into the cell. (Cumbers et al., Nature Biotech 20:1129, (2002); and see editorial review form Presta, Nature Biotech. 20:1096(2002)). For example, the mammalian display cell is a Ramos Burkitt's lymphoma cell line, BL-2 cells, CL-01 cells (Martin et al., Nature 415:802, 2002) or chicken DT40 B-cell lymphoma cells (Sale et al., Nature 412:921, 2001). Alternatively, the mammalian cell to modified to overexpress activation-induced cytosine deaminase (AID) protein (Muramatsu, 2000; Di Noia, 2002; Petersen-Mahrt, 2002; Yoshikawa, 2002 and Gearhart, 2002 for brief editorial review), DNA polymerase iota (Faili, 2002) or other members of the family of TLS polymerases that are components of the immunoglobulin mutasome. The AID protein is required for the maturation of antibodies in mammals and other higher vertebrates, where it promotes somatic hypermutation (SHM), class switch recombination and gene conversion.
[0109] Mutation of the fusion polypeptide by the mammalian display cell results in a candidate polypeptide that has altered, increased or decreased, binding affinity an/or specificity for a target antigen of interest. For example, when the candidate polypeptide is an antibody or fragment thereof, mutation mimics the hypermutaton process of antibodies.
[0110] Optionally, the mammalian cells expressing a candidate polypeptide (i.e. infected cells) are separated (i.e. sorted) form the mammalian cell not expressing a candidate polypeptide. Sorting of infected mammalian cells allows uninfected cells to be removed from the population, which, in turn, reduces the incidence of non-specific binding interactions with labeled antigens. Moreover, when mammalian display cell is capable of mutating the nucleic acid as described above, sorting the cells recapitulates for example, the affinity maturation process of B cells during the in vivo immune response.
[0111] Infected mammalian cells are sorted by detecting a selectable marker such as eGFP. Alternatively, infected mammalian cells are sorted by identifying cells that bind an antigen. For example the cells are contacted with a labeled target antigen at a given concentration. The a labeled target antigen is combined with the mammalian cells in solution or on solid support. Solid supports include for example, a chip, bead, paper, plastic or other solid or semi-solid means. When the target antigen an mammalian cells are present in solution, FACS or other suitable selection means is used to identify the complex between bound antigen and candidate polypeptide to separate the bound complex from unbound tagged target antigens and unbound mammalian cells. In contrast, when the target antigen is on a solid support, column chromatography is used to separate mammalian cells presenting candidate polypeptide or antibody bound to tagged antigen. The antigen is bound to beads (e.g., cellulose or sepharose beads) in a chromatography column and a solution containing the mammalian cells is applied to the column. Unbound mammalian cells are removed from the column by one or more washing steps. The bound mammalian cells are then eluted from the column, such as with a high or low pH solution, a detergent solution, a high salt solution, or with chaotropic agents (e.g., urea and/or guanidine).
[0112] Preferably, the mammalian cells are sorted by both selectable marker expression and antigen binding.
[0113] Optionally, the infected mammalian cells are expanded in culture between sorting steps. The expansion may be clonal or non-clonal in nature. The amount of antigen used in the subsequent sorting steps is reduced. For example, the concentration of target antigen is reduced by 25%, 50%, 75%, 90%, 95%, 99%, 99.9%, 99.99% or 99.999%. Thus, in this way, the methods of the invention are used to identify candidate polypeptides that bind to the target antigen with higher specificity and affinity compared to the mean affinity of the candidate polypeptide prior to affinity selection process.
[0114] The nucleic acid sequence encoding the selected candidate polypeptide is determined. For example, the population of selected mammalian cells are lysed, such as with a detergent, and the nucleic acids encoding the candidate polypeptide are amplified by PCR and cloned into a suitable vector. Optionally, the amplified inserts are cloned into the lentiviral display vector and used to produce new virus particles, as described above. These particles can be used to infect additional mammalian cells, and the candidate polypeptide display method can be repeated one or more times.
[0115] The methods of the invention also allow for the production a soluble candidate polypeptide. Soluble candidate polypeptides are generated by excising the nucleic acid molecule encoding the transmembrane domain of the fusion protein following expression of the fusion protein on the surface of the viral particle or the mammalian cell. For example, these methods are useful for the localization of an antibody-producing cell to a target cell or tissue using the membrane anchored antibody, followed by delivery of a soluble antibody in vivo to specific cell type or tissue, such as a cancer cell. This soluble antibody may be cytotoxic, cytostatic, or induce apoptosis.
[0116] For example, a viral display vector described above may additionally contain two or more signal sites (or signal sequences), e.g., loxP sites, recognized by the Cre recombinase. The Cre-lox reaction functions as follows. P1 bacteriophage cyclization recombination (Cre) recombinase recognizes a pair of loxP binding sites flanking a nucleic acid molecule of interest. Here, the loxP sites can flank the nucleic acid sequence encoding the transmembrane moiety of the fusion protein. Optionally, nucleic acid sequences encoding one or more amino acids flanking the transmembrane moiety (termed spacer amino acids) are provided. Spacer amino acids facilitate proper folding of the fusion protein. LoxP sites are 34 bp long and are composed of an 8 bp core, which determines directionality, flanked by 13 bp of palindromic (complementary) sequences. Sequences flanked by loxP sites are said to be floxed. Cre enzyme brings together the two loxP sites, which carry complementary sequences. Depending on the orientation of the paired loxP sites, different results may be achieved. In the cre-lox system, nucleic acid sequences between two signal sites are deleted or inverted if the signal sites are on the same nucleic acid molecule. The intervening DNA may be excised or circularized, inverted or translocated. Optionally, the viral display vector also contains a nucleic acid sequence encoding cre recombinase. Cre expression can driven by an inducible promoter such as tetracycline/doxycycline. Optionally, loxP sites flank the nucleic acid sequence encoding cre recombinase in addition to flanking the transmembrane moiety of the fusion protein. The nucleic acid sequence encoding cre recombinase is positioned upstream (in a 5 direction) or downstream (in a 3 direction) relative to the loxP sites. The ability to induce cre recombinase expression provides the ability to produce soluble antibodies. The nucleic acid sequence encoding cre recombinase can be situated in a different vector, or has been stably integrated into the genome of the host cell.
[0117] Another example of a site-specific recombinase system is the flp system from yeast. The Flp recombinase is a 45 kD protein endoded by the 2 micron plasmid of the yeast Saccharomyces cerevisiae. A viral display vector described above may additionally contain two or more recombination targets (FRTs), recognized by the FLP recombinase. For example, two FRTs flank the nucleic acid sequence encoding the transmembrane moiety of the fusion protein.
[0118] A modified FLP recombinase with increased recombinase activity has also been described (See, Bucholz et al., Nature Biotech. 16, 657-662 (1998)). A suitable FRT sequence is: GAAGTTCCTATACTTTCTAGAGAATAGGAACTTCGGAATAGGAACTTA (SEQ ID NO: 11). The FLP recombinase bind the FRTs, resulting in excision of the nucleic acid sequence encoding the transmembrane moiety and the production of a soluble antibody.
[0119] For example, a mammalian display cell that expresses an antibody that binds immunospecifically to a tumor specific antigen (TSA) on the surface of a cancer cell is identified using the mammalian cell antibody display methods of the invention. The antibody-producing mammalian cell is provided to a mammalian subject (e.g., a human subject having cancer or otherwise in need thereof), and the antibody on the surface of the mammalian cell homes in to the tumor antigen and binds specifically thereto. Detection and localization of the antibody producing cell is determined by the detection of expression of the detectable protein moiety. Once the antibody producing mammalian cell is co-localized with (and bound to) the cell displaying the tumor antigen, expression of the cre recombinase is induced (such as with chemical means, light, oxygen, or other inductive means) such that the recombinase removes the nucleic acid encoding the transmembrane moiety of the fusion protein. In the absence of the transmembrane domain, the fusion protein will be directed into the ER by the leader peptide and secreted outside the cell as a soluble antibody. These secreted soluble antibodies will then act locally upon the target tumor cell. Optionally, the antibody producing mammalian display cell also contains a nucleic acid encoding a toxin, which is also produced by the mammalian display cell. This toxin may be operably linked to the soluble antibody.
EXAMPLES
Example 1. Creation of Viral Display Vectors and Vector Systems
[0120] A viral display vector (outlined in
[0121] Protein expression analysis of the viral display vectors is performed by transiently transfecting 293T cells using transfection means known to those skilled in the art, such as POLYFECT transfection reagent, then performing Western blot analysis using an antibody specific for gp41. As shown in
[0122] The localization of the fusion proteins to the plasma membrane is confirmed using FACS analysis. For example, goat-anti-human IgG (-chain specific) PE conjugate is useful to detect the cell surface expression of the sFv-IgG-gp41 fusion proteins. Results of a typical FACS analysis are provided in Table 3.
TABLE-US-00003 TABLE 3 Transfection M1 % PE+ M1 Mean F M2 % PE+ M2 Mean F Mock 4.49 15.49 1.25 24.86 transfection HXBC2 + pTat 11.32 15.97 3.92 23.83 (control vector PS11-gp41 37.25 19.85 19.12 27.12 PS11-lox-gp41 28.99 21.64 11.01 37.27 E46-gp41 34.88 18.76 13.65 29.33 E46-lox-gp41 30.53 21.84 11.95 37.12 M1 = gate at 10; M2 = gate at 15
[0123] FACS analysis using fluorescently labeled antigens confirms that the fusion proteins expressed on the cell surface are capable of binding immunospecifically to target antigen. For example, biotinylated TRM peptide (2 mM, MW 4146.7, combined with Extravidin PE (Sigma E-4011)), was used in FACS experiments, the results of which are shown in Table 4. These results demonstrated that the PS11-containing fusion protein expressed on the surface of 293T cells is capable of binding to its target antigen.
TABLE-US-00004 TABLE 4 1 uM 5 uM 25 uM 50 uM % % % % Transfection PE+ MFI PE+ MFI PE+ MFI PE+ MFI Mock 2.32 10.84 2.39 12.34 3.41 17.48 4.20 23.12 PS11-gp41 15.76 13.17 19.82 12.95 20.58 13.62 26.31 14.85 E46-gp41 4.61 10.24 5.06 10.53 6.73 13.08 9.55 15.92 M1 = gate at 7
[0124] The helper vector pCMVR8.2 and an envelope vector are also shown in
[0125] The envelope vector contains the G protein of vesicular stomatitis virus (VSV-G), operably linked to the ieCMV promoter and A.sup.n (a polyadenylation sequence).
Example 2. Antibody Display on Viral Capsids
[0126] A population of viral display vectors containing sFv inserts from a Mehta I/II library are co-transfected with a helper vector and an envelope vector into 293T cells using CaCl.sub.2 or POLYFECT transfection agent. Alternatively, a 293T cell line stably expressing VSV-g is used. To make fusion protein viral particles, 293T cells grown to 80%-100% confluence are transfected on a 10-cm plate with a transfection cocktail containing about 12 g of viral display vector (1.0 g/l), about 12 g of envelope vector (1.0 g/l), about 6 g of helper vector pCMVR8.2 (0.5 g/l), 62 l of 2M CaCl.sub.2 in 2HeBS. Viral particle-containing supernatant (the master viral stock) is collected at about 37, and 61 hours after transfection, filtered and stored at 80 C. Alternatively, the master viral stock is collected at 48, 72 and 96 hours after transfection. When required, viral particle supernatant is concentrated by centrifugation at 17,000 rpm in an SW28 rotor for 2 h. The pellet is resuspended in 1/10 volume media. Viral particles are sorted by fluorescence assisted cell sorting (FACS) by detecting the eGFP. The multiplicity of infection (moi) is determined by infecting 293T cells, followed by flow cytometric quantification of eGFP-positive cells. Incorporation of the fusion protein into viral particles is measured using Western analysis. Viral stocks are concentrated by centrifugation and contacted with SDS-PAGE loading buffer, then separated by PAGE, transferred to membranes and blotted with anti-gp41 or anti-human IgG.
[0127] Specific binding of the fusion protein to target antigen is demonstrated by viral particle capture experiments. Target antigens are coated on multiwell plates, blocked (such as with 1% BSA), and incubated with viral particles prepared as described above. Reverse transcriptase activity, an indication of specific binding of the fusion protein to the target antigen, is determined using .sup.3H and assigned a value (RT value). Results of a series of viral particle capture experiments is provided in Table 5, and demonstrates that lentiviral particles expressing PS11-containing fusion proteins bind specifically to their target antigens. Captured antigens were analyzed by SDS-PAGE and stained, as shown in
TABLE-US-00005 TABLE 5 Hcyclin T1 antigens Control 50 uM 3 ug 3 ug TRM GST-hCyclin Anti-human peptide T1-300 IgG-PE 3 ug GST 1% BSA Virus 1 2 3 4 7 8 9 10 11 12 PS11 10 ul* 10250 16085 1765 1635 1095 1780 1225 920 500 900 PS11 30 ul 25955 32360 3675 5030 1135 95** 1560 1770 360 4620 E46 10 ul* 1195 620 460 570 690 2065 1180 735 260 665 E46 30 ul 1230 1465 590 825 1055 2000 1245 980 555 1300 CMV 10 ul* 175 130 215 145 205 350 315 305 210 265 CMV 30 ul 300 230 125 155 220 240 255 165 120 160 *The total volume is equalized with addition of 20 ul media; **did not have .sup.3H mix
Example 3. Mammalian Cell Antibody Display
[0128] The master viral stock is contacted with a suspension of mammalian display cells overnight at an MOI of about 1. The mammalian cells are sorted by FACS on the basis of binding to an anti-Fc antibody or, alternatively, eGFP content. The sorted mammalian cells are contacted with target antigens that have been tagged. Suitable tags include FITC, streptavidin/biotin, and paramagnetic beads (See
TABLE-US-00006 TABLE 6 CMV- % % APC Sample GFP GFP MFI APC MFI 1. Untransfected cells 1.15 5.4 24.2 32 2. pCDNA3 4 g 0.2 g 98.5 1340 16.3 30 3. pCDNA3-CMV-PS11- 4 g 0.2 g 45 551 90.65 261 Fc-gp41 4. pCDNA3-CMV-GFP 4 g 0.2 g 99.66 3895 16 42 5. pCDNA3-CMV-PS11- 4 g 0.2 g 99.5 1818 98.9 182 Fc-C9-gp41(1-50) #10 6. pCDNA3-CMV-PS11- 4 g 0.2 g 97.7 1057 97.5 1523 Fc-C9-CD8 #7 7. pCDNA3-CMV-PS11- 4 g 0.2 g 50 241 96.8 196 Fc-C9-gp41FL #1 8. pCDNA3-CMV-PS11- 4 g 0.2 g 89.3 932 95.5 1660 Fc-C9-CD28 #3
Harvested transfected cells were analyzed for GFP expression and were stained with an anti-human Ig-APC conjugate to demonstrate Fc cell surface expression.
[0129] Sample 1 contains untransfected cells. Sample 2 contains the pCDNA vector with no insert. Sample 3 contains pCDNA3-CMV-PS11-Fc-gp41 without the C9 tag. Sample 4 contains a GFP control insert. Sample 5 contains a part of the lentiviral gp41 transmembrane region (corresponding to amino acids 1-50 of the TM region). Sample 6 contains the human CD8 transmembrane region. Sample 7 contains a full-length lentiviral gp41 transmembrane region. Sample 8 contains the human CD28 transmembrane region.
[0130] As shown in
[0131] Additional experiments were performed to demonstrate the cell surface expression of fusion proteins on the surface of 293T mammalian display cells. 110.sup.6 293T cells were seeded on 6 well multiwell plates. The cells were co-transfected with a multi-functional vector containing an IRES, as shown in Table 7, using lipofectamine. About 48 hours after transfection, the transfected cells were harvested with 0.5 mM EDTA.
TABLE-US-00007 TABLE 7 CMV- % MFI % Sample DNA GFP pCDNA3 GFP GFP APC 1. Untransfected cells- 9.8 8 24.2 APC stain 2. pSIN-delta gp41- 4 g 0.2 g 99 3895 15.6 CMV-GFP 3. pSIN-mdeltaU3- 4 g 0.2 g 15 22 86.3 CMV-PS11-Fc-gp41- IRES-ZsGreen-clone 3.4 4. pSIN-mdeltaU3- 4 g 0.2 g 12 12 88.2 CMV-PS11-Fc-gp41- IRES-GFP (#3) 5. pSIN-mdeltaU3- 4 g 0.2 g 86.1 139 90.3 CMV-PS11-Fc-gp41- IRES-ZsGreen-clone #5
Harvested transfected cells were analyzed for GFP expression and were stained with an anti-human Ig-APC conjugate to demonstrate Fc cell surface expression.
[0132] Sample 1 contains untransfected cells. Sample 2 contains the pSIN vector expressing GFP under the control of a CMV promoter. Sample 3 contains pSIN-mdeltaU3-CMV-PS11-Fc-gp41-IRES-ZsGreen, where the IRES sequence was obtained from the pSIN-deltaU3-CMV-PS11-Fc-gp41-IRES-GFP vector. Sample 4 contains the pSIN-mdeltaU3-CMV-PS11-Fc-gp41-IRES-GFP, thereby expressing GFP. Sample 5 contains the pSIN-mdeltaU3-CMV-PS11-Fc-gp41-IRES-ZsGreen, where the IRES sequence was obtained from the IRES sequence originated from the HA-ZsGreens vector. In samples 3-5 the transmembrane region is the full length lentiviral gp41 transmembrane domain.
[0133] As shown in
Example 4. Affinity Selection of Human Antibodies
[0134] Selected antigen-bound mammalian cells are separated from unbound mammalian cells and expanded in culture to increase the number of mammalian cells producing a target antigen-specific antibody. The antibody display method of Example 4 is repeated with the concentration of target antigens reduced by 50%, 90%, 95%, 99%, 99.9%, 99.99% or more. For example, a antigen concentration of about 200 ng/ml is used in the first round of selection, and this concentration is reduced to about 1 ng/ml in a second round of selection.
Example 5. Affinity Maturation of Human Antibodies
[0135] It is desirable to identify candidate polypeptides, such as antibodies, that bind to a target antigen with very high specificity and very high binding affinity (low K.sub.d). The present invention provides for the generation of high specificity antibodies by affinity maturation.
[0136] One method of affinity maturation involves the use of display cell lines that have a higher rate of mutation. An example of a mutation prone cell line is a lymphoma cell line, e.g., the Ramos Burkitt's lymphoma cell line. Mammalian cells expressing antibodies from mutated fusion proteins having increased affinity for the target antigen are selected using the display affinity selection methods described above in Example 4.
[0137] Another method of affinity maturation involves the induction of expression of a activation-induced cytosine deaminase (AID) protein in the display cells. Increased AID activity results in higher mutation rates in the candidate polypeptides. The viral display vector shown in
Example 6. Induction of Antibody Expression
[0138] The viral display vector generated in Example 1 is modified by insertion of a tetR inducible element. Two tetO sequence concatamers are fused to the CMV minimal promoter. A tetR sequence is inserted downstream of the nucleic acid encoding the fusion protein of the invention. Thus, production of the fusion protein is regulated by addition of tetracycline.
Example 7. Quantitation of Antibody Cell Surface Expression Using a C9 Tag
[0139] The present invention provides methods for determining the density of antibodies expressed on the surface of displaying mammalian cells. Quantitation of antibody cell surface expression allows for the determination of efficiency of antibody display, as well as the refinement of expression levels, e.g., by altering promoters and/or enhancers in the viral display vector.
[0140] Antibody cell surface expression quantitation is performed using a tag contained in the expressed fusion protein. Alternatively, quantitation is performed using labeled peptides (such as biotinylated peptides) that bind to single chain antibodies. Any tag capable of being detected with an entity that can be measured by any means (e.g., FACS) can be used in the present invention. One exemplary tag is the C9 peptide tag (GGTETSQVAPA, SEQ ID NO: 16). The C9 tag is recognized by the monoclonal antibody 1D4. Any means capable of detecting this antibody, such as FACS, can be used to quantitate expression levels. The C9 tag is located C terminal to the portion of immunoglobulin molecule and N terminal to the transmembrane moiety. In embodiments of the invention the C9 tag is connected to the portion of immunoglobulin molecule by a linker (e.g., a flexible linker such as SGGSS (SEQ ID NO: 17)). The C9 tag is linked to the C terminus of the linker by insertion of an XbaI site at the C terminus of the linker (which encodes the single amino acid arginine (R)). Exemplary viral display vectors containing the C9 linker are provided below in Table 8. The extracellular region of gp41 has 18 residues, the transmembrane region has 24 residues, and the intracellular region has 8 residues (the gp41 tag of SEQ ID NO: 14). Display vector 4 encodes a truncated gp41 polypeptide containing amino acids 1-50, while display vector 6 encodes the full length gp41 polypeptide. The extracellular region of CD8 has 12 residues, the transmembrane region has 21 residues, and the intracellular region has 11 residues (LYCNHRNRRRV; SEQ ID NO: 17). The extracellular region of CD28 has 39 residues, the transmembrane region has 27 residues, and the intracellular region has 13 residues. As a control, a pCDNA3 vector without the nucleic acid sequence encoding the fusion protein was used. scFv-48 is a single chain antibody against human CXCR4.
TABLE-US-00008 TABLE 8 Viral display vector DNA % C9 Tag MFI 1. pCDNA 3 ID4 stain 4 g 1.2 8.3 2. pCDNA3 - ID4 + anti Mouse FITC 4 g 4.5 162 3. pCDNA3-scFv-48-C9-CD28 4 g 96 378 4. pCDNA3-CMV-PS11-Fc-C9-gp41(1-50) #10 4 g 97.7 515 5. pCDNA3-CMV-PS11-Fc-C9-CD8 #7 4 g 97 478 6. pCDNA3-CMV-PS11-Fc-C9-gp41FL #1 4 g 94 695 7. pCDNA3-CMV-PS11-Fc-C9-CD28 #3 4 g 97 470
[0141] A typical antibody cell surface expression quantitation was performed as follows. 293T cells were seeded about 24 hours before transfection on 6 well plates (110.sup.6 cells per well). Viral display vector DNA (4 ug) was transfected using Lipofectamine 2000. About 48 hours after transfection, cells were harvested for FACS analysis, using 0.5 mM EDTA. For antibody detection, a primary -C9 antibody (ID4) was used at a concentration of 2 l per 110.sup.5 cells and a secondary -mouse IgG-FITC labeled antibody was used at a 1:50 dilution. FACS analysis was performed as described above and known in the art. Results of this analysis are shown in
Example 8. Quantitation of Antibody Cell Surface Expression in Constructs Containing Envelope Incorporation Signals
[0142] The present invention provides fusion viral display vectors that contain the gp41 envelope (env) incorporation signal.
TABLE-US-00009 TABLE 9 CMV- % % APC GFP GFP MFI APC MFI 1. Untransfected cells 1.3 29 1.2 170 2. pCDNA3 + APC 4 g 0.1 g 51 522 1.27 246 3. pCDNA3-CMV-GFP + APC 4 g 0.1 g 62 2581 4.2 110 4. pCDNA3-CMV-PS11-Fc-C9- 4 g 0.1 g 56 841 63 233 gp41FL #1 5. pCDNA3-CMV-PS11-Fc-C9-gp41(1-50) 4 g 0.1 g 42 471 76 822 # 5-1 6. pCDNA3-CMV-PS11-Fc-C9-CD8 4 g 0.1 g 42 874 89 3773 # 2-4 7. pCDNA3-CMV-PS11-FC-C9-CD28 4 g 0.1 g 51 1024 94 3738 # 3-4 8. pCDNA3-CMV-PS11-Fc-C9-CD28-gp41 4 g 0.1 g 43 925 94 3846 Tag # 4-5 9. pCDNA3-CMV-PS11-Fc-C9-CD8-gp41 4 g 0.1 g 46 851 91 4177 Tag # 6-5
Example 9. Antibody Cell Surface Expression in Cells Transfected with Lentiviral Vectors
[0143] Viral display constructs (listed in Table 10) containing either truncated (amino acids 1-50) or full-length gp41 TM, CD8 TM or CD28 TM, were introduced into the pSIN lentiviral display vector to confirm the expression of the fusion proteins on the surface of mammalian cells. The lentiviral vectors contain a form of GFP, ZsGreen, to aid in detection, and were transfected into 293T cells as described above. Results are shown in
TABLE-US-00010 TABLE 10 CMV- % MFI % MFI DNA GFP pCDNA3 GFP GFP APC APC 1. pCDNA3 + APC 4 g 0.2 g 51 322 1.27 246 2. pSIN-delta gp41-CMV-GFP 4 g 49 1855 2.5 131 3. pSIN-mdeltaU3-CMV-PS11- 4 g 0.2 g 42 231 35 164 Fc-gp41(1-50)-IRES- ZsGreen-done 2A 4. pSIN-mdeltaU3-CMV- 4 g 0.2 g 33 398 90 3410 PS11-Fc-CD8-IRES- ZsGreen-done 4A 5. pSIN-mdeltaU3-CMV- 4 g 0.2 g 34 309 85 3276 PS11-Fc-CD28-IRES- ZsGreen-done 5A 6. pSIN-mdeltaU3-CMV- 4 g 0.2 g 45 322 54 313 PS11-Fc-gp41(FL)-IRES- ZsGreen-done 5
EQUIVALENTS
[0144] Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, numerous equivalents to the specific procedures described herein. Such equivalents are considered to be within the scope of the present invention and are covered by the following claims. The contents of all references, issued patents, and published patent applications cited throughout this application are hereby incorporated by reference. The appropriate components, processes, and methods of those patents, applications and other documents may be selected for the present invention and embodiments thereof.