SYNTHETIC HYBRID RECEPTOR AND GENETIC CIRCUIT IN BACTERIA TO DETECT ENTERIC PATHOGENIC MICROORGANISMS

20180328923 ยท 2018-11-15

Assignee

Inventors

Cpc classification

International classification

Abstract

Provided herein are microorganisms engineered with hybrid receptors and genetic circuits. Also provided are hybrid receptors having a CqsS polypeptide and a heterologous histidine kinase domain of a two-component system. Methods for using engineered microorganisms to sense and destroy pathogens (e.g., Vibrio cholerae) are also provided.

Claims

1. An engineered microorganism comprising a hybrid receptor comprising at least the binding portion of a CqsS polypeptide and a heterologous histidine kinase domain of a two-component system; and a genetic circuit responsive to the heterologous histidine kinase.

2. The engineered microorganism of claim 1, wherein the heterologous histidine kinase domain is from NisK or SpaK.

3. The engineered microorganism of claim 2, wherein the heterologous histidine kinase domain comprises a glutamic acid to glycine mutation at position 225 relative to full length NisK (SEQ ID NO: 5).

4. The engineered microorganism of any one of claims 1-3, wherein the hybrid receptor comprises amino acids 221-447 of NisK (SEQ ID NO: 15) or amino acids 221-447 of NisK having an E225G mutation (SEQ ID NO: 3).

5. The engineered microorganism of any one of claims 1-4, wherein the hybrid receptor comprises the amino acid sequence of SEQ ID NO: 2.

6. The engineered microorganism of any one of claims 1-5, wherein the hybrid receptor comprises the amino acid sequence of SEQ ID NO: 1.

7. The engineered microorganism of any one of claims 1-5, wherein the hybrid receptor consists of the amino acid sequence of SEQ ID NO: 1.

8. The engineered microorganism of any one of claims 1-7, wherein the genetic circuit comprises a first promoter that is operably linked to a nucleic acid sequence encoding the hybrid receptor and a second promoter that is responsive to the heterologous histidine kinase domain and is operably linked to a nucleic acid sequence encoding an output molecule.

9. The engineered microorganism of claim 8, wherein the first promoter is inducible.

10. The engineered microorganism of claim 8, wherein the first promoter is constitutive.

11. The engineered microorganism of claim 8, wherein the first promoter is a nisR promoter.

12. The engineered microorganism of any one of claims 8-11, wherein the second promoter is a nisA promoter.

13. The engineered microorganism of any one of claims 1-7, wherein the genetic circuit comprises a first promoter that is operably linked to a nucleic acid sequence encoding the hybrid receptor, a second promoter that is operably linked to a nucleic acid sequence encoding a repressor molecule, and a third promoter that is operably linked to a nucleic acid sequence encoding an output molecule; wherein the second promoter is responsive to the heterologous histidine kinase domain, and wherein the third promoter is responsive to the repressor molecule, and wherein the repressor molecule binds to the third promoter and represses transcription of the output molecule.

14. The engineered microorganism of claim 13, wherein the first promoter is inducible.

15. The engineered microorganism of claim 13, wherein the first promoter is constitutive.

16. The engineered microorganism of claim 13, wherein the first promoter is a nisR promoter.

17. The engineered microorganism of any one of claims 13-16, wherein the second promoter is a nisA promoter.

18. The engineered microorganism of any one of claims 13-17, wherein the third promoter is a xyltet2 promoter.

19. The engineered microorganism of any one of claims 8-18, wherein the output molecule is an antimicrobial peptide, a, lysing polypeptide, a reporter polypeptide or a nucleic acid.

20. The engineered microorganism of any one of claims 1-19, wherein the output molecule is mCherry, or -lactamase.

21. The engineered microorganism of claim 20, wherein the mCherry comprises the amino acid sequence as set forth in SEQ ID NO: 26, and wherein the -lactamase comprises the amino acid sequence as set forth in SEQ ID NO: 30.

22. A method of detecting and/or treating a cholera infection, comprising administering to a subject having or at risk of having a cholera infection the engineered microorganism of any of claims 1-21.

23. The method of claim 22, wherein the subject having or at risk of having a cholera infection is a subject in an area of cholera outbreak.

24. The method of claim 22 or claim 23, further comprising administering to the subject an antibiotic agent effective for killing Vibrio cholerae when the engineered microorganism expresses a detectable output molecule.

25. A method of detecting a cholera infection, comprising (i) obtaining a biological sample from a subject having or at risk of having a cholera infection, and (ii) contacting the biological sample with the engineered microorganism of any of claims 1-21, thereby creating a reaction mixture.

26. The method of claim 25, wherein the biological sample is a fecal sample.

27. The method of claim 25 or 26, further comprising (iii) contacting the reaction mixture of (ii) with a substrate.

28. The method of claim 27, wherein the substrate is a colorimetric substrate.

29. The method of claim 27 or 28, wherein the substrate is nitrocefin.

30. The method of any one of claims 27 to 29, further comprising (iv), detecting a color change of the reaction mixture of (iii).

31. The method of claim 30, wherein the detecting comprises spectrophotometry.

32. A method of detecting and treating a cholera infection in a subject, comprising (a) performing the method of any one of claims 25 to 31, (b) determining if the subject a cholera infection based on (a), and (c) performing the method of any one of claims 22 to 24 if it is determined in (b) that the subject has a cholera infection.

33. A hybrid receptor comprising at least the binding portion of a CqsS polypeptide and a heterologous histidine kinase domain of a two-component system.

34. The hybrid receptor of claim 33 wherein the heterologous histidine kinase domain is from NisK or SpaK.

35. The hybrid receptor of claim 34, wherein the histidine kinase domain comprises a glutamic acid to glycine mutation at position 225 relative to full length NisK (SEQ ID NO: 5).

36. The hybrid receptor of any one of claims 33-35, wherein the hybrid receptor comprises amino acids 221-447 of NisK (SEQ ID NO: 15) or amino acids 221-447 of NisK having an E225G mutation (SEQ ID NO: 3).

37. The hybrid receptor of any one of claims 33-36, wherein the hybrid receptor comprises the amino acid sequence of SEQ ID NO: 2.

38. The hybrid receptor of any one of claims 33-37, wherein the hybrid receptor comprises the amino acid sequence of SEQ ID NO: 1.

39. The hybrid receptor of any one of claims 33-37, wherein the hybrid receptor consists of the amino acid sequence SEQ ID NO: 1.

40. The hybrid receptor of any one of claims 33-37, wherein the hybrid receptor comprises an amino acid sequence selected from the group consisting of (SEQ ID NOs: 6-13).

41. The hybrid receptor of any one of claims 33-37, wherein the hybrid receptor comprises an amino acid sequence selected from the group consisting of (SEQ ID NOs: 16-25).

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0015] The accompanying drawings are not intended to be drawn to scale. For purposes of clarity, not every component may be labeled in every drawing.

[0016] FIG. 1 is a schematic of the genetically engineered (thus, non-naturally occurring) probiotic bacteria Lactococcus lactis that is designed to sense and kill the cholera pathogen, Vibrio cholerae.

[0017] FIG. 2 is a schematic of the primary amino acid sequence of the hybrid CqsS-NisK receptor. The N-terminal region of CqsS (left, amino acids 1-177 of native CqsS) is fused to the C-terminal region of NisK (right, amino acids 221-447 of native NisK) to create the hybrid receptor. The hybrid receptor contains a mutation in the NisK region (E1826), which increases its responsiveness to CAI-1.

[0018] FIGS. 3A-3B are schematics of the CAI-I detection circuits. FIG. 3A shows that the recognition of CAI-1 by the hybrid receptor causes repression of the nisA promoter, resulting in decreased expression of the output module that is operably linked to the nisA promoter. FIG. 3B shows the Signal Inverter design, where detection of CAI-1 by the hybrid receptor represses TetR expression from the nisA promoter, thereby allowing increased expression of the output module controlled by the TetR-repressible xyltet2 promoter.

[0019] FIG. 4 shows the time response of the output gene expression in absolute measurements (left) and fold change (right). L. lactis contains pHCR2, which is the signal inverter circuit containing mCherry as the output module, and is grown in co-culture with either E. coli or Vibrio cholerae as indicated. Vibrio cholerae cqsA is a control strain that is unable to synthesize CAI-I and should therefore not activate the hybrid receptor. All data were collected by flow cytometry and represent the meanS.D. of three biological replicates.

[0020] FIG. 5 shows 10 different hybrid receptor fusion strategies. Amino acid sequences at the junctions are shown in detail. Amino acid numbers at each junction indicate their locations in the original CqsS and NisK sequences respectively. The sequences are as follows: Hyb1 (SEQ ID NOs: 32 and 33), Hyb2 (SEQ ID NOs: 34 and 35), Hyb3 (SEQ ID NO: 36), Hyb4 (SEQ ID NO: 37), Hyb5 (SEQ ID NOs: 38 and 39), Hyb6 (SEQ ID NOs: 40 and 39), Hyb1 (SEQ ID NOs: 34 and 41), Hyb8 (SEQ ID NOs: 36 and 41), Hyb9 (SEQ ID NO: 42), and Hyb10 (SEQ ID NOs: 43 and 41)

[0021] FIG. 6 shows the activity of different hybrid receptor variants, all with the specific E182G mutation, in CAI-1 induction assays in the presence of Vibrio cholerae wild-type, Vibrio cholerae cqsA, or E. coli. In each group of three bars, the left bar represents data obtained with L. lactis, the middle bar represents data obtained with L. lactis+V. cholerae w.t., and the right bar represents data obtained with L. lactis+V. cholerae cqsA.

[0022] FIG. 7 shows a schematic of the amino acid mutation variants of the hybrid receptors at the Hyb4 junction. The sequences, from top to bottom, correspond to SEQ ID NOs: 44-51, and 37.

[0023] FIG. 8 shows the CAI-1 induction activity of different Hyb4 variants in the presence of Vibrio cholerae wild-type, Vibrio cholerae cqsA, or E. coli. In each group of three bars, the left bar represents data obtained with L. lactis, the middle bar represents data obtained with L. lactis+V. cholerae w.t., and the right bar represents data obtained with L. lactis+V. cholerae cqsA.

[0024] FIG. 9 is a schematic representation of pHTR plasmid map.

[0025] FIGS. 10A-10B are exemplary data demonstrating that L. lactis detects wild-type V. cholerae via CAI-1 molecules. FIG. 10A shows exemplary output results of -lactamase assay using L. lactis that expresses -lactamase in response to binding the CqsA polypeptide of V. cholerae (L.(pHTR)). FIG. 10B shows exemplary spectrophotometer readings of a -lactamase assay over the course of 30 minutes using the -lactamase assay shown in FIG. 10A.

[0026] FIG. 11 is an exemplary schematic showing an engineered probiotic bacteria (e.g., Lactococcus lactis) are able to detect the presence of a pathogenic bacteria (e.g., Vibrio cholerae) and initiate both diagnostic and therapeutic functions.

DETAILED DESCRIPTION OF DISCLOSURE

[0027] Provided herein are engineered and thus non-naturally occurring microorganisms and hybrid receptors, and methods for detecting and/or killing pathogenic microbes using such microorganisms and receptors.

Engineered Microorganisms

[0028] Some aspects of the present disclosure are directed to engineered microorganisms having a hybrid receptor and a genetic circuit responsive to the hybrid receptor. An engineered microorganism, as used herein, refers to a microorganism that does not occur in nature. Engineered microorganisms of the present disclosure, in some embodiments, contain one or more exogenous nucleic acids (i.e., nucleic acids that the microorganism would not normally contain) or nucleic acids that do not occur in nature (e.g., an engineered nucleic acid encoding a heterologous histidine kinase of a two-component system). Accordingly, an engineered microorganism can be a microorganism that has been designed, produced, prepared, synthesized, manufactured and/or manipulated by a human.

[0029] In some embodiments, an engineered microorganism contains an engineered nucleic acid. A nucleic acid is at least two nucleotides covalently linked together, which in some instances may contain phosphodiester bonds (e.g., a phosphodiester backbone). An engineered nucleic acid, as used herein, is a nucleic acid that does not occur in nature. It should be understood, however, that while an engineered nucleic acid as a whole is not naturally-occurring, it may include nucleotide sequences that occur in nature. In some embodiments, an engineered nucleic acid comprises nucleotide sequences from different organisms (e.g., from different species). For example, in some embodiments, an engineered nucleic acid includes a bacterial nucleotide sequence, a murine nucleotide sequence, a human nucleotide sequence, and/or a viral nucleotide sequence. Engineered nucleic acids include recombinant nucleic acids and synthetic nucleic acids. A recombinant nucleic acid is a molecule that is constructed by joining nucleic acids (e.g., isolated nucleic acids, synthetic nucleic acids or a combination thereof) and, in some embodiments, can replicate in a living cell. A synthetic nucleic acid is a molecule that is amplified in vitro or chemically synthesized (e.g., using a nucleic acid automated synthesizer). A synthetic nucleic acid includes nucleic acids that are chemically modified, or otherwise modified, but can base pair with naturally-occurring nucleic acid molecules. Recombinant and synthetic nucleic acids also include nucleic acids that result from the replication of either of the foregoing.

[0030] In some embodiments, an engineered microorganism contains one or more mutations in the genome of the microorganism. In some embodiments, an engineered microorganism contains an exogenous independently-replicating nucleic acid (e.g., an engineered nucleic acid present on an episomal vector). In some embodiments, an engineered microorganism is produced by introducing a foreign or exogenous nucleic acid into a cell. A nucleic acid may be introduced into a cell by conventional methods, such as, for example, electroporation (see, e.g., Heiser W. C. Transcription Factor Protocols: Methods in Molecular Biology 2000; 130: 117-134), chemical (e.g., calcium phosphate or lipid) transfection (see, e.g., Lewis W. H., et al., Somatic Cell Genet. 1980 May; 6(3): 333-47; Chen C., et al., Mol Cell Biol. 1987 August; 7(8): 2745-2752), fusion with bacterial protoplasts containing recombinant plasmids (see, e.g., Schaffner W. Proc Natl Acad Sci USA. 1980 April; 77(4): 2163-7), transduction, conjugation, or microinjection of purified DNA directly into the nucleus of the cell (see, e.g., Capecchi M. R. Cell. 1980 November; 22(2 Pt 2): 479-88).

[0031] In some embodiments, the engineered microorganisms of the present disclosure are prokaryotes (e.g., bacterial cells). In some embodiments, the engineered microorganisms are bacterial cells. Bacterial cells of the present disclosure include bacterial subdivisions of Eubacteria and Archaebacteria. Eubacteria can be further subdivided into gram-positive and gram-negative Eubacteria, which depend upon a difference in cell wall structure. Also included herein are those classified based on gross morphology alone (e.g., cocci, bacilli). In some embodiments, the bacterial cells are Gram-negative cells, and in some embodiments, the bacterial cells are Gram-positive cells. Examples of bacterial cells of the present disclosure include, without limitation, cells from Lactobacillus spp., Lactococcus spp., Bacillus spp., Enterobacter spp., Yersinia spp., Escherichia spp., Klebsiella spp., Acinetobacter spp., Bordetella spp., Neisseria spp., Aeromonas spp., Franciesella spp., Corynebacterium spp., Citrobacter spp., Chlamydia spp., Hemophilus spp., Brucella spp., Mycobacterium spp., Legionella spp., Rhodococcus spp., Pseudomonas spp., Helicobacter spp., Salmonella spp., Vibrio spp., Erysipelothrix spp., Salmonella spp., Streptomyces spp., Bacteroides spp., Prevotella spp., Clostridium spp., or Bifidobacterium spp.

[0032] In some embodiments, the engineered microorganisms are non-pathogenic bacteria that are derived from a normal internal ecosystem such as bacterial flora. In some embodiments, the engineered microorganisms are non-pathogenic bacteria that are derived from a normal internal ecosystem of the gastrointestinal tract. Non-limiting examples of non-pathogenic bacteria that are part of the normal flora in the gastrointestinal tract include bacteria from the genera Bacteroides, Clostridium, Fusobacterium, Eubacterium, Ruminococcus, Peptococcus, Peptostreptococcus, Bifidobacterium, Escherichia and Lactobacillus.

[0033] In some embodiments, bacterial cells of the disclosure are anaerobic bacterial cells (e.g., cells that do not require oxygen for growth). Anaerobic bacterial cells include facultative anaerobic cells such as, for example, Escherichia coli, Shewanella oneidensis and Listeria monocytogenes. Anaerobic bacterial cells also include obligate anaerobic cells such as, for example, Bacteroides and Clostridium species. In humans, for example, anaerobic bacterial cells are most commonly found in the gastrointestinal tract.

[0034] In some embodiments, the engineered microorganisms are lactic acid bacteria (LAB). Lactic acid bacteria, as used herein, refer to Gram-positive, non-spore forming cocci, coccobacilli or rods with low GC content (i.e., a DNA base composition of less than 53 mol % G+C). Lactic acid bacteria generally are non-respiratory and lack catalase. Typically, lactic acid bacteria ferment glucose primarily to lactic acid, or to lactic acid, CO2 and ethanol. In some embodiments, the lactic acid bacteria are, without limitation, Lactococcus lactis, Lactobacillus acidophilus, Lactobacillus gasseri, Leuconostoc lactis, Lactobacillus brevis, Lactobacillus plantarum, Lactobacillus casei, Lactobacillus gasseri, Lactobacillus helveticus, Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus pneumoniae, or Streptococcus zooepidemicus.

[0035] In some embodiments, the engineered microorganisms are bacteria in which the Lactococcus lactis histidine kinase NisK is functional, or can function. A histidine kinase (e.g., NisK) is considered functional in a bacteria if activation of the histidine kinase (e.g., via ligand binding and phosphorylation) causes a change in transcriptional activity of the bacteria (e.g., via phosphorylation and activation of a response regulator). Such bacteria include, but are not limited to, Lactococcus lactis, Enterococcus faecalis, Staphylococcus simulans, Bacillus subtilis, Lactobacillus brevis, Lactobacillus helveticus, Lactobacillus plantarum, Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus pneumoniae and Streptococcus zooepidemicus.

Hybrid Receptors

[0036] Aspects of the disclosure relate to engineered microorganisms having a cell surface hybrid receptor comprising at least the binding portion of a CqsS polypeptide and a heterologous histidine kinase of a two-component system. A hybrid receptor, as used herein, refers to a non-naturally occurring protein-based receptor that comprises amino acid sequences from two or more receptors. In some embodiments, the hybrid receptor comprises amino acid sequences that are derived from different organisms. Protein sequences that are derived from different organisms are referred to herein as heterologous sequences.

[0037] The terms protein, peptide, and polypeptide are used interchangeably herein and refer to a polymer of amino acid residues linked together by peptide (amide) bonds. The terms refer to a protein, peptide, or polypeptide of any size, structure, or function. Typically, a protein, peptide, or polypeptide will be at least three amino acids long. A protein, peptide, or polypeptide may refer to an individual protein or a collection of proteins.

[0038] In some embodiments, the hybrid receptor contains at least the binding portion of a CqsS polypeptide. A CqsS polypeptide, as used herein, refers to a histidine kinase from a Vibrio species (e.g., Vibrio cholerae, Vibrio harveyi and Vibrio parahaemolyticus) that acts as the receptor for a CAI-1 autoinducer. In Vibrio cholerae, CAI-1 is (S)-3-hydroxytridecan-4-one (C10-CAI-1), which is produced by the CqsA synthase. Typically, bacteria (e.g., Vibrio cholerae) coordinate group behaviors by producing, detecting, and collectively responding to extracellular signaling molecules called autoinducers (e.g., CAI-1). This process is called quorum sensing. Quorum sensing involves detection (e.g., by a CqsS polypeptide) of the density-dependent accumulation of autoinducers that elicit population-wide changes in gene expression. Exemplary CqsS polypeptides are known in the art and have been described previously. For example CqsS polypeptides, without limitation, have been described in Ng W. L., et al., Signal production and detection specificity in Vibrio CqsA/CqsS quorum-sensing systems, Mol Microbiol, 2011 March; 79(6):1407-17 and in Xiaobo K., et al., CqsA-CqsS quorum-sensing signal-receptor specificity in Photobacterium angustum, Mol Microbiol, 2014 February; 91(4): 821-833, the contents of each of which are hereby incorporated by reference. In some embodiments, the CqsS polypeptide is from Vibrio cholerae. In some embodiments, the CqsS polypeptide comprises SEQ ID NO: 4. In some embodiments, the CqsS polypeptide consists of SEQ ID NO: 4. In some embodiments, the CqsS polypeptide consists essentially of SEQ ID NO: 4.

[0039] In some embodiments, the hybrid receptor comprises the binding portion of a CqsS polypeptide. As used herein, the binding portion of a CqsS polypeptide refers to a portion of a CqsS polypeptide that is capable of binding an autoinducer (e.g., CAI-1). Thus, in some embodiments, the binding portion of a CqsS polypeptide refers to a portion of a CqsS polypeptide that is capable of binding to a CAI-1-like molecule. Exemplary CAI-1-like molecules include, but are not limited to, C8-CAI-1, Ea-C8-CAI-1 and Ea-C10-CAI-1, which have been described previously (Ng W. L., et al., Signal production and detection specificity in Vibrio CqsA/CqsS quorum-sensing systems, Mol Microbiol, 2011 March; 79(6):1407-17; and Xiaobo K., et al., CqsA-CqsS quorum-sensing signal-receptor specificity in Photobacterium angustum, Mol Microbiol, 2014 February; 91(4): 821-833). In some embodiments, the binding portion of a CqsS polypeptide refers to a portion of a CqsS polypeptide that is capable of binding to (S)-3-hydroxytridecan-4-one (i.e., C10-CAI-1).

[0040] In some embodiments, the binding portion of a CqsS polypeptide comprises a full length CqsS polypeptide, for example the CqsS polypeptide of SEQ ID NO: 4. In some embodiments, the binding portion of a CqsS polypeptide is an N-terminal portion of a CqsS polypeptide. In some embodiments, the binding portion of a CqsS polypeptide includes at least the first 100 amino acids (aa), at least the first 110 aa, at least the first 120 aa, at least the first 130 aa, at least the first 140 aa, at least the first 150 aa, at least the first 160 aa, at least the first 170 aa, at least the first 180 aa, at least the first 190 aa, at least the first 200 aa, at least the first 210 aa, at least the first 220 aa, at least the first 230 aa, at least the first 240 aa, at least the first 250 aa, at least the first 260 aa, at least the first 270 aa, at least the first 280 aa, at least the first 290 aa, or at least the first 300 aa of a CqsS polypeptide or of SEQ ID NO: 4, from the N-terminus. In some embodiments, the binding portion of a CqsS polypeptide includes at least the first 15%, at least the first 20%, at least the first 25%, at least the first 30%, at least the first 35%, at least the first 40%, at least the first 45%, at least the first 50%, at least the first 55%, at least the first 60%, at least the first 65%, or at least the first 70% from the N-terminus of a full length CqsS polypeptide or of SEQ ID NO: 4. In some embodiments, the binding portion of a CqsS polypeptide includes amino acids 1-177 of a CqsS polypeptide or of SEQ ID NO: 2.

[0041] In some embodiments, the hybrid receptor of the present disclosure comprises a heterologous histidine kinase domain of a two-component system. A heterologous histidine kinase domain of a two-component system or a heterologous two-component histidine kinase domain, as used herein, refers to a histidine kinase domain from a two-component system that is cloned or derived from an organism other than a Vibrio species. In some embodiments, the histidine kinase domain from a two-component system is cloned or derived from an organism other than Vibrio cholerae. Two-component regulatory systems serve as a basic stimulus-response coupling mechanism to allow organisms to sense and respond to changes in many different environmental conditions. See e.g., Stock A. M., et al., Two-component signal transduction, Annu. Rev. Biochem., 2000, 69 (1): 183-215, the contents of which are hereby incorporated by reference. Typically two-component systems include a membrane-hound histidine kinase that senses a specific environmental stimulus (e.g., CAI-I) and a corresponding response regulator that mediates the cellular response (e.g., through differential expression of target genes). Histidine kinases of two-component systems are known in the art and can be identified and classified by virtue of their conserved cytoplasmic kinase domains. For example, a number of histidine kinases of two-component systems have been described in Mascher T., et al., Stimulus Perception in Bacterial Signal-Transducing Histidine Kinases, Microbiol Mol Biol Rev., 2006 December; 70(4): 910-938, the contents of which are hereby incorporated by reference. It should be appreciated that the histidine kinases disclosed in the cited reference and the instant specification are not meant to be limiting and additional histidine kinases of two-component systems fall within the scope of this disclosure. In some embodiments, the histidine kinase domain of a two-component system is derived from a two-component histidine kinases, such as but not limited to, NisK, SpaK, EnvZ, CheA, NtrB, PhoQ, TorS, VirA, LuxQ, VarS, KdpD, YycF, CpxA and RcsC.

[0042] In some embodiments, the heterologous histidine kinase domain comprises the kinase domain of a two-component histidine kinase. In some embodiments, the heterologous histidine kinase domain of a two-component system comprises a histidine kinase domain from the histidine kinase NisK (SEQ ID NO: 5), or the histidine kinase SpaK (SEQ ID NO: 14). In some embodiments, the heterologous histidine kinase domain comprises a C-terminal portion of a two-component histidine kinase. In some embodiments, heterologous histidine kinase domain includes at least the last 150 aa, at least the last 160 aa, at least the last 170 aa, at least the last 180 aa, at least the last 190 aa, at least the last 200 aa, at least the last 210 aa, at least the last 220 aa, at least the last 230 aa, at least the last 240 aa, at least the last 250 aa, at least the last 260 aa, at least the last 270 aa, at least the last 280 aa, at least the last 290 aa, at least the last 300 aa, at least the last 320 aa, at least the last 340 aa, at least the last 360 aa, or at least the last 380 aa of a two-component histidine kinase, or of SEQ ID NO: 5, or of SEQ ID NO: 13, where the last amino acid is the C-terminal amino acid. In some embodiments, the heterologous histidine kinase domain includes at least the last 15%, at least the last 20%, at least the last 25%, at least the last 30%, at least the last 35%, at least the last 40%, at least the last 45%, at least the last 50%, at least the last 55%, at least the last 60%, at least the last 65%, or at least the last 70% of a full length two-component histidine kinase, or of SEQ ID NO: 5, or of SEQ ID NO: 13. In some embodiments, the heterologous histidine kinase domain comprises amino acids 221-447 of NisK (e.g., SEQ ID NO: 15). In some embodiments, the heterologous histidine kinase domain comprises a glutamic acid to glycine mutation. In some embodiments, the heterologous histidine kinase domain comprises amino acids 221-447 of NisK, wherein there is a glycine at position 225, rather than a glutamic acid (e.g., SEQ ID NO: 3).

[0043] In some embodiments, the hybrid receptor of the present disclosure comprises at least the binding portion of a CqsS polypeptide and a heterologous histidine kinase domain of a two-component system. In some embodiments, the hybrid receptor comprises SEQ ID NO: 2 and either SEQ ID NO: 3 or SEQ ID NO: 15. In some embodiments, the hybrid receptor comprises any one of SEQ ID NOs: 1, 6-13 and 16-26. In some embodiments, the hybrid receptor consists of any one of SEQ ID NOs: 1, 6-13 and 16-26. In some embodiments, the hybrid receptor consists essentially of any one of SEQ ID NOs: 1, 6-13 and 16-26.

[0044] The invention contemplates variants of any of the hybrid receptor amino acid sequences, any of the heterologous histidine kinase amino acid sequences, or any of the CqsS polypeptide amino acid sequences described herein. As used herein, a variant of a hybrid receptor amino acid sequence, a heterologous histidine kinase amino acid sequence or a CqsS polypeptide amino acid sequence is an amino acid sequence that is not identical to, but shares a degree of homology with the hybrid receptor amino acid sequence, the heterologous histidine kinase amino acid sequence or the CqsS polypeptide amino acid sequences respectfully described herein. As used herein, the term homology refers to the overall relatedness between proteins. In some embodiments, proteins are considered to be homologous to one another if their amino acid sequences are at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical. Accordingly, proteins that are homologous to any of the hybrid receptor amino acid sequences, heterologous histidine kinase amino acid sequences or CqsS polypeptide amino acid sequences, described herein, are also within the scope of this disclosure.

Genetic Circuits

[0045] In some embodiments, the engineered microorganisms of the present disclosure comprise genetic circuits responsive to any of the heterologous histidine kinases described herein. A genetic circuit, as used herein, refers to a functional cluster of genes or nucleic acids that impact each other's expression through inducible transcription factors or cis-regulatory elements. A genetic circuit is responsive to a heterologous histidine kinase if the histidine kinase modulates the expression of at least one nucleic acid or gene of the genetic circuit. Typically, activation or repression of transcription of a nucleic acid or gene occurs via signal transduction following activation of a heterologous histidine kinase in response to binding a ligand (e.g., CAI-1). For example, phosphorylation of a heterologous histidine kinase (e.g., in response to binding a ligand such as CAI-1) may activate or repress transcription of a nucleic acid or gene of the genetic circuit. Without wishing to be bound by any theory, signal transduction may occur through the transfer of phosphoryl groups from adenosine triphosphate (ATP) to a specific histidine residue in the heterologous histidine kinases (e.g., by an autophosphorylation reaction). Molecules referred to as response regulators may then be phosphorylated on an aspartate residue. Phosphorylation of the response regulators can cause a change in the conformation of the response regulators, typically activating an attached output domain, which then may lead to the activation or repression of expression of target genes or nucleic acids. Accordingly, in some embodiments, a gene circuit comprises a gene that is transcriptionally activated when the hybrid receptor is bound by a ligand (e.g., CAI-1). In some embodiments, a gene circuit comprises a gene that is transcriptionally repressed when a heterologous histidine kinase is bound by a ligand (e.g., CAI-1).

[0046] In some embodiments the genetic circuit comprises a first promoter that is operably linked to a nucleic acid sequence encoding the hybrid receptor and a second promoter that is responsive to the heterologous histidine kinase and is operably linked to a nucleic acid sequence encoding an output molecule. As one non-limiting example, in response to binding the hybrid receptor, CAI-1 inhibits (or activates) transcription of an output molecule (see e.g., FIG. 3B). It should be appreciated that the genetic circuits, described herein, may comprise one or more nucleic acids which may or may not be linked.

[0047] The genetic circuits of the present disclosure may comprise one or more promoters operably linked to a nucleotide sequence encoding, for example, a hybrid receptor or output molecule. A promoter refers to a control region of a nucleic acid sequence at which initiation and rate of transcription of the remainder of a nucleic acid sequence are controlled. A promoter may also contain sub-regions to which regulatory proteins and molecules may bind, such as RNA polymerase and other transcription factors. Promoters may be constitutive, inducible, activatable, repressible, or any combination thereof. In some embodiments, the genetic circuit comprises at least 1 at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, at least 20, at least 30 or at least 50 promoters. In some embodiments one or more of the promoters may be a nisA promoter, a nisR promoter and/or a xyltet2 promoter. In some embodiments one or more of the promoters comprises SEQ ID NOs: 27, 28, and/or 29. In some embodiments one or more of the promoters consists of SEQ ID NOs: 27, 28, and/or 29. In some embodiments one or more of the promoters consists essentially of SEQ ID NOs: 27, 28, and/or 29.

[0048] A promoter drives expression or transcription of the nucleic acid sequence to which it is operatively linked. In some embodiments, the promoter is operably linked to a nucleic acid encoding a hybrid receptor or an output molecule. A promoter is considered to be operably linked when it is in a correct functional location and orientation in relation to the nucleic acid sequence it regulates, thereby resulting in the ability of the promoter to drive transcription initiation or expression of that sequence.

[0049] A promoter may be one naturally associated with a gene or sequence, as may be obtained by isolating the 5 non-coding sequences located upstream of the coding segment of a given gene or sequence (e.g., an endogenous promoter).

[0050] In some embodiments, a coding nucleic acid sequence may be positioned under the control of a recombinant or heterologous promoter, which refers to a promoter that is not normally associated with the coding sequence in its natural environment. Such promoters may include promoters of other genes; promoters isolated from another cell type; and synthetic promoters or enhancers that are not naturally occurring such as, for example, those that contain different elements of different transcriptional regulatory regions and/or mutations that alter expression through methods of genetic engineering that are known in the art. In addition to producing nucleic acid sequences of promoters and enhancers synthetically, sequences may be produced using recombinant cloning and/or nucleic acid amplification technology, including polymerase chain reaction (PCR) (see U.S. Pat. No. 4,683,202 and U.S. Pat. No. 5,928,906).

[0051] In some embodiments, the promoters described herein are constitutive promoters, which are promoters that are constitutively active in the cell (i.e., not regulated in response to specific stimuli). Constitutive promoters (e.g., constitutive bacterial promoters) are known in the art and include, without limitation, P32, P57, P59, Pxyl, PclpB, PrepU and PlepA.

[0052] In some embodiments, the promoters described herein are inducible promoters, which are promoters that are active or inactive in response to a particular stimulus, condition, or an inducer signal. An inducer signal may be endogenous or a normally exogenous condition (e.g., light), compound (e.g., chemical or non-chemical compound) or protein that contacts an inducible promoter in such a way as to activate transcriptional activity from the inducible promoter. Thus, a signal that regulates transcription of a nucleic acid refers to an inducer signal that acts on an inducible promoter. A signal that regulates transcription may activate or inactivate transcription, depending on the regulatory system used. Activation of transcription may involve direct activation of or indirect activation of a promoter as may occur by inactivation of a repressor molecule that prevents transcription from the promoter. A repressor molecule is any molecule that can bind to a promoter and prevent transcription of a gene or nucleic acid sequence to which the promoter is operably linked. Conversely, deactivation of transcription may involve direct action on a promoter to prevent transcription or indirect action on a promoter by activating a repressor that then acts on the promoter.

[0053] The administration or removal of an inducer signal results in a switch between activation and inactivation of the transcription of the operably linked nucleic acid sequence. Thus, the active state of a promoter operably linked to a nucleic acid sequence refers to the state in which the promoter is actively regulating transcription of the nucleic acid sequence (i.e., the linked nucleic acid sequence is expressed). Conversely, the inactive state of a promoter operably linked to a nucleic acid sequence refers to the state when the promoter is not actively regulating transcription of the nucleic acid sequence (i.e., the linked nucleic acid sequence is not expressed).

[0054] An inducible promoter of the present disclosure may be induced by (or repressed by) one or more physiological condition(s), such as changes in light, pH, temperature, radiation, osmotic pressure, saline gradients, cell surface binding, and the concentration of one or more extrinsic or intrinsic inducing agent(s). An extrinsic inducer signal may comprise, without limitation, amino acids and amino acid analogs, saccharides and polysaccharides, nucleic acids, protein transcriptional activators and repressors, cytokines, toxins, petroleum-based compounds, metal containing compounds, salts, ions, enzyme substrate analogs, hormones or combinations thereof.

[0055] Inducible promoters of the present disclosure include any inducible promoter described herein or known to one of ordinary skill in the art. Examples of inducible promoters include, without limitation, chemically/biochemically-regulated and physically-regulated promoters such as alcohol-regulated promoters, tetracycline-regulated promoters (e.g., anhydrotetracycline (ATc)-responsive promoters and other tetracycline-responsive promoter systems, which include a tetracycline repressor protein (tetR), a tetracycline operator sequence (tetO) and a tetracycline transactivator fusion protein (tTA)), steroid-regulated promoters (e.g., promoters based on the rat glucocorticoid receptor, human estrogen receptor, moth ecdysone receptors, and promoters from the steroid/retinoid/thyroid receptor superfamily), metal-regulated promoters (e.g., promoters derived from metallothionein (proteins that bind and sequester metal ions) genes from yeast, mouse and human), pathogenesis-regulated promoters (e.g., induced by salicylic acid, ethylene or benzothiadiazole (BTH)), temperature/heat-inducible promoters (e.g., heat shock promoters), and light-regulated promoters (e.g., light responsive promoters from plant cells).

[0056] Other inducible promoter systems are known in the art and may be used in accordance with the present disclosure.

[0057] In some embodiments, inducible promoters of the present disclosure function in prokaryotic cells (e.g., bacterial cells). Examples of inducible promoters for use in prokaryotic cells include, without limitation, bacteriophage promoters (e.g. Pls icon, T3, T7, SP6, PL) and bacterial promoters (e.g., Pbad, PmgrB, Ptrc2, Plac/ara, Ptac, Pm), or hybrids thereof (e.g. PLlacO, PLtetO). Examples of bacterial promoters for use in accordance with the present disclosure include, without limitation, positively regulated E. coli promoters such as positively regulated 70 promoters (e.g., inducible pBad/araC promoter, Lux cassette right promoter, modified lamdba Prm promote, plac Or2-62 (positive), pBad/AraC with extra REN sites, pBad, P(Las) TetO, P(Las) CIO, P(Rh1), Pu, FecA, pRE, cadC, hns, pLas, pLux), GS promoters (e.g., Pdps), 632 promoters (e.g., heat shock) and 54 promoters (e.g., glnAp2); negatively regulated E. coli promoters such as negatively regulated 70 promoters (e.g., Promoter (PRM+), modified lamdba Prm promoter, TetR-TetR-4C P(Las) TetO, P(Las) CIO, P(Lac) IQ, RecA_DlexO_DLacO1, dapAp, FecA, Pspac-hy, pcI, plux-cI, plux-lac, CinR, CinL, glucose controlled, modified Pr, modified Prm+, FecA, Pcya, rec A (SOS), Rec A (SOS), EmrR_regulated, BetI_regulated, pLac_lux, pTet_Lac, pLac/Mnt, pTet/Mnt, LsrA/cI, pLux/cI, LacI, LacIQ, pLacIQ1, pLas/cI, pLas/Lux, pLux/Las, pRecA with LexA binding site, reverse BBa_R0011, pLacI/ara-1, pLaclq, rrnB P1, cadC, hns, PfhuA, pBad/araC, nhaA, OmpF, RcnR), GS promoters (e.g., Lutz-Bujard LacO with alternative sigma factor 38), 32 promoters (e.g., Lutz-Bujard LacO with alternative sigma factor 32), and 54 promoters (e.g., glnAp2); negatively regulated B. subtilis promoters such as repressible B. subtilis GA promoters (e.g., Gram-positive IPTG-inducible, Xyl, hyper-spank) and B promoters. Other inducible microbial promoters may be used in accordance with the present disclosure.

[0058] In some embodiments, the genetic circuit includes a first promoter that is operably linked to a nucleic acid sequence encoding a hybrid receptor, a second promoter that is operably linked to a nucleic acid sequence encoding a repressor molecule, and a third promoter that is operably linked to a nucleic acid sequence encoding an output molecule. In some embodiments, the second promoter is responsive to the heterologous histidine kinase. In some embodiments the third promoter is responsive to the repressor molecule. In some embodiments the repressor molecule binds to the third promoter and represses transcription. As one non-limiting example, in response to binding CAI-1, a hybrid receptor inhibits transcription of a tetR repressor molecule, which activates the transcription of an output molecule (see e.g., FIG. 3B).

[0059] The term output molecule, as used herein refers to a nucleic acid or protein that is expressed in response to the state of the hybrid receptor. In some embodiments, the output molecule is expressed when the hybrid receptor is bound to a ligand CAI-1). In some embodiments, the output molecule is expressed when the hybrid receptor is not bound to a ligand.

[0060] In some embodiments, the output molecule is an antimicrobial peptide, a lysing polypeptide, a reporter polypeptide or a nucleic acid. In some embodiments, the output molecule is an antimicrobial peptide. In some embodiments, the antimicrobial peptide is a bacteriocin such as a class I bacteriocin (e.g., small peptide inhibitors that include nisin and other lantibiotics), a class II bacteriocin (e.g., small heat-stable proteins such as pediocin-like bacteriocins, two-peptide bacteriocins, cyclic bacteriocins, single-peptide bacteriocins, and non-pediocin like bacteriocins), a class III bacteriocin (e.g., large heat-labile protein bacteriocins such as the bacteriolysin lysostaphin and membrane potential disrupting bacteriocins), or a class IV bacteriocin (e.g., complex bacteriocins containing lipid or carbohydrate moieties). In some embodiments, the output molecule is a bacteriocin that is specific for Vibrio cholerae. In some embodiments, the bacteriocin is selected from the group consisting of Morricin 269, Kurstacin 287, Kenyacin 404, Entomocin 420 and Tol-worthcin 524. In some embodiments, the cell produces a secreted factor by cell suicide. In certain embodiments, the secreted factor is a chemokine-derived antimicrobial peptide (CDAP). In some embodiments, the lysin is produced together with an immunity protein that protects the cell that secretes the lysin from being destroyed by the lysin. In some embodiments, the lysin lyses the cell to release the lysin molecules from the cell. It should be appreciated that the antimicrobial peptides, described herein, are not meant to be limiting and that additional antimicrobial peptides are within the scope of this disclosure.

[0061] In some embodiments, the output molecule is a lysing polypeptide. In some embodiments, the lysing polypeptide can be any of the lysing antimicrobial peptides described herein. In some embodiments, the lysing peptide is lysozyme, holin, or endolysin. It should be appreciated that the lysing polypeptides, described herein, are not meant to be limiting and that additional lysing polypeptides are within the scope of this disclosure.

[0062] In some embodiments, the output molecule is a reporter polypeptide. In some embodiments, the reporter polypeptide is a fluorescent polypeptide. Fluorescent polypeptides include, without limitation cyan fluorescent protein (e.g., AmCyanl), green fluorescent protein (e.g., EGFP, AcGFP1, and ZsGreen1), yellow fluorescent protein (e.g., ZsYellow1 and mBananna), orange fluorescent protein (e.g., mOrange and mOrange2), red fluorescent protein (e.g., DsRed, tdTomato, mStrawberry and mCherry), and far-red fluorescent protein (e.g., HcRed1, mRaspberry and mPlum). In some embodiments, the reporter polypeptide is mCherry. In some embodiments the reporter polypeptide comprises SEQ ID NO: 26.

[0063] In some embodiments, the reporter polypeptide is a peptide that acts on, e.g., cleaves, a substrate, e.g., a colorimetric substrate, which may be detected visually or via a spectrophotometer when the colorimetric substrate is cleaved by the peptide. In some embodiments, the reporter polypeptide is -galactosidase, which can cleave X-gal, a colorless analog of lactose that forms 5-bromo-4-chloro-indoxyl upon cleavage, which then spontaneously dimerizes and oxidizes to form a bright blue insoluble pigment 5,5-dibromo-4,4-dichloro-indigo. In some embodiments, the reporter polypeptide is alkaline phosphatase, which can cleave a 5-Bromo-4-Chloro-3-Indolyl Phosphate (BCIP) substrate to produce insoluble NBT that is blue to purple in color. In some embodiments, the reporter polypeptide is -lactamase, which can cleave the substrate nitrocefin, which changes from a yellowish color to a reddish color upon cleavage. In some embodiments, the -lactamase comprises the amino acid sequence as set forth in SEQ ID NO: 30. In some embodiments, the -lactamase is expressed from a nucleic acid comprising the nucleic acid sequence as set forth in SEQ ID NO: 31. It should be appreciated that any of the reporter peptides, described herein, are not meant to be limiting and that additional reporter peptides are within the scope of this disclosure.

[0064] In some embodiments, the reporter polypeptide is an antibiotic resistance protein. In some embodiments, the antibiotic resistance protein confers the ability of an engineered microorganism to grow in the presence of an antibiotic such as, but not limited to, chloramphenicol, kanamycin, gentamicin, rifampin, trimethoprim, or tetracycline. Such antibiotic resistance proteins are known in the art and are within the scope of this disclosure. The antibiotics, disclosed herein, represent both naturally occurring and synthetic drugs that target different processes within the microbial cell, including synthesis of RNA (rifampin), synthesis of proteins (chloramphenicol, kanamycin, gentamicin, and tetracycline), and synthesis of folate (trimethoprim).

[0065] In some embodiments, the output molecule is a nucleic acid. In some embodiments the output molecule is a ribonucleic acid (RNA). In some embodiments the RNA output molecule is part of a molecular reporting system, such as a reporting system described in Gredell J. A., Protein and RNA engineering to customize microbial molecular reporting, Biotechnol J. 2012 April; 7(4):477-99; the contents of which are hereby incorporated by reference. Additional nucleic acid output molecules are within the scope of this disclosure.

[0066] Also provided herein are vectors comprising any of the engineered nucleic acids described herein. In some embodiments vectors comprise any of the hybrid receptors described herein. In some embodiments, vectors comprise any of the genes, nucleic acids, and/or promoters of any of the genetic circuits described herein. In some embodiments, vectors comprise any of the output molecules described herein. A vector is a nucleic acid (e.g., DNA) used as a vehicle to artificially carry genetic material (e.g., an engineered nucleic acid) into a cell where, for example, the nucleic acid can be replicated and/or expressed. In some embodiments, a vector is an episomal vector (see, e.g., Van Craenenbroeck K. et al. Eur. J. Biochem. 267, 5665, 2000, incorporated by reference herein). A non-limiting example of a vector is a plasmid. Plasmids are double-stranded generally circular DNA sequences that are capable of automatically replicating in a host cell. Plasmids typically contain an origin of replication that allows for semi-independent replication of the plasmid in the host and also the transgene insert. Plasmids may have more features, including, for example, a multiple cloning site, which includes nucleotide overhangs for insertion of a nucleic acid insert, and multiple restriction enzyme consensus sites to either side of the insert. Another non-limiting example of a vector is a viral vector.

Applications

[0067] Aspects of the disclosure relate to methods for detecting and/or treating an infection of a Vibrio species. In some embodiments, the methods are for detecting and/or treating a Vibrio cholerae infection. In some embodiments, the methods of the present disclosure include administering to a subject having, or at risk of having, a Vibrio cholerae infection (i.e., cholera) any of the engineered microorganisms disclosed herein. The term subject, as used herein, refers to an individual organism, for example, an individual mammal. In some embodiments, the subject is a human. In some embodiments, the subject is a non-human mammal. In some embodiments, the subject is a non-human primate. In some embodiments, the subject is a rodent. In some embodiments, the subject is a sheep, a goat, a cattle, a cat, or a dog. In some embodiments, the subject is a vertebrate, an amphibian, a reptile, a fish, an insect, a fly, or a nematode. In some embodiments, the subject is a research animal. In some embodiments, the subject is genetically engineered, e.g., a genetically engineered non-human subject. The subject may be of either sex and at any stage of development. In some embodiments, the subject is not a normal subject or healthy volunteer.

[0068] In some embodiments, the engineered microorganisms are administered to the subject until one or more symptoms are reduced or cleared. In some embodiments, the engineered microorganisms are administered until the subject is free of the Vibrio species or until none of the Vibrio species is detected in the subject. In some embodiments, the engineered microorganisms are administered until the subject is free of Vibrio cholerae or until no Vibrio cholerae is detected in the subject. In some embodiments, the engineered microorganisms are administered to the subject until a reduction of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 99%, or at least 100% of the Vibrio cholerae in a subject is achieved as compared to the level of Vibrio cholerae detected in the patient prior to administration of any of the engineered microorganisms, described herein.

[0069] In some embodiments, the engineered microorganisms of the present disclosure are administered to a subject to treat cholera. The terms treatment, treat, and treating, refer to a clinical intervention aimed to reverse, alleviate, delay the onset of, or inhibit the progress of a disease or disorder (e.g., cholera), or one or more symptoms thereof. In some embodiments, treatment may be administered after one or more symptoms have developed and/or after a disease has been diagnosed. In other embodiments, treatment may be administered in the absence of symptoms, e.g., to prevent or delay onset of a symptom or inhibit onset or progression of a disease. For example, treatment may be administered to a susceptible individual prior to the onset of symptoms (e.g., in light of a pathogen outbreak). Treatment may also be continued after symptoms have resolved, for example, to prevent or delay their recurrence.

[0070] Accordingly, also within the scope of the disclosure are pharmaceutical compositions comprising any of the engineered microorganisms disclosed herein. The term pharmaceutical composition, as used herein, refers to a composition that can be administrated to a subject in the context of treatment of a disease or disorder (e.g., cholera). In some embodiments, a pharmaceutical composition comprises any of the engineered microorganisms described herein, and a pharmaceutically acceptable excipient.

[0071] In some embodiments the subject having or at risk of having a Vibrio cholerae infection is in an area of cholera outbreak. An area of cholera outbreak, as used herein, refers to a location in proximity to one or more subjects having cholera or a Vibrio cholerae infection. In some embodiments, an area of cholera outbreak is an area of up to 0.1 miles, up to 0.5 miles, up to 1 mile, up to 2 miles, up to 5 miles, up to 10 miles, up to 20 miles, up to 40 miles, up to 80 miles, or up to 100 miles from one or more subjects having cholera or a Vibrio cholerae infection. In some embodiments, an area of cholera outbreak is an area that has at least 1, at least 2, at least 3, at least 4, at least 5, at least 10, at least 20, at least 50, at least 100, at least 200, at least 500, at least 1000, or at least 5000 subjects having cholera or a Vibrio cholerae infection.

[0072] In some embodiments, the methods described herein further include administering to a subject an antibiotic that is effective for killing the Vibrio species when the engineered bacterium expresses a detectable output molecule. In some embodiments, the methods described herein further include administering to a subject an antibiotic that is effective for killing Vibrio cholerae when the engineered bacterium expresses a detectable output molecule. In some embodiments, the antibiotic agent is, without limitation, tetracycline, doxycycline, erythromycin, orfloxacin, trimethoprim-sulfamethoxazole (TMP-SMX), furazolidone, sulfaguanidine, or ciprofloxacin. It should be appreciated, however, that additional antibiotic agents are also within the scope of this disclosure.

[0073] In some embodiments, the hybrid receptor and engineered circuits may be used to create engineered probiotic bacteria that inhabits the human intestine and serve to detect and eliminate a Vibrio species infection or Vibrio cholerae infection (i.e., cholera). Vibrio cholerae infections often occur in predictable seasonal and regional outbreaks, so vulnerable populations may be given the engineered bacteria containing the circuit as a prophylaxis. Alternatively, when a cholera outbreak occurs, the engineered bacteria may be given to family members and vulnerable people in the population to prevent any further spread of the disease.

[0074] In some embodiments, methods for detecting a Vibrio species pathogen are disclosed. In some embodiments, methods for detecting a Vibrio cholerae pathogen are disclosed. In some embodiments, methods for detecting a Vibrio cholerae pathogen in a subject may include administering any of the engineered microorganisms, described herein, to the subject and obtaining and/or isolating the engineered microorganisms from the subject. For example, from a biological sample (e.g., a stool sample) of the subject. The level of an output molecule expressed in the engineered microorganisms may be detected or measured to determine whether the subject has Vibrio cholerae. Alternatively, the engineered microorganisms may be used in a cell-free diagnostic system to detect the presence of CAI-1 produced by Vibrio cholerae. For example any of the engineered microorganisms of the present disclosure may be contacted with a sample (e.g., a stool sample or a blood sample) in the presence or absence of cells to determine whether the sample contains Vibrio cholerae.

[0075] In some embodiments, methods for detecting a cholera infection in a subject comprise obtaining a biological sample from a subject. As used herein, a biological sample may be used generally to refer to any biological material which may be obtained from a subject. For example, the biological sample may be whole blood, plasma, tissue (e.g., normal tissue or tumor tissue), urine, feces, or cells. The biological sample typically is a fluid sample. Solid tissues may be made into fluid samples using routine methods in the art.

[0076] Some aspects of the disclosure provide methods for detecting a cholera infection in a subject using an in vitro detection assay. In some embodiments, the in vitro detection assay is a colorimetric assay. As used herein, a colorimetric assay refers to an assay that includes one or more reagents (e.g., colorimetric substrates) that undergo a measurable color change in the presence of an analyte, such as an output molecule that cleaves a colorimetric substrate to produce a color change. As used herein, a colorimetric substrate refers to a molecule that undergoes a measurable color change in the presence of an analyte, such as an enzyme that cleaves the colorimetric substrate. For example, a colorimetric assay may include testing for the presence of -lactamase by contacting the -lactamase with a nitrocefin substrate (e.g., a colorimetric substrate), which is cleaved by -lactamase to produce a reddish colored product. In some embodiments, the colorimetric substrate is nitrocefin, X-gal, or BCIP, which may be cleaved by -lactamase, -galactosidase, and alkaline phosphatase, respectively. Colorimetric assays and substrates are widely used in biochemistry to test for the presence of enzymes, compounds, antibodies, hormones in addition to other analytes. Accordingly, a skilled artisan would recognize additional colorimetric assays and substrates that may be used in accordance with the disclosure and those colorimetric assays and substrates provided herein are not meant to be limiting.

[0077] In some embodiments, the methods for detecting a cholera infection using an in vitro colorimetric assay include detecting a color change. Detecting a color change in an in vitro colorimetric assay can be done using any suitable method. For example, in some embodiments, detecting a color change is done visually, e.g., by an person that observes a color change in a colorimetric assay. In some embodiments, detecting a color change is done using spectrophotometry, which is a method commonly used to measure (e.g., quantitatively) the reflection or transmission properties of a sample (e.g. a fluid sample containing a colorimetric substrate), which may be used to determine an amount of a substance, for example a colorimetric substrate in a sample. In some embodiments, spectrophotometry is used to quantify a level of a colorimetric substrate that has been cleaved, for example, in a colorimetric assay.

[0078] It should be appreciated that a color change observed in a colorimetric assay may be used to determine whether or not a subject has a cholera infection. In some embodiments, a subject is determined to have a cholera infection if a color change is observed when a colorimetric assay is performed using a biological sample from the subject. In some embodiments, a color change of a colorimetric assay using a biological sample from a subject is compared to a color change of a colorimetric assay using a control sample, for example a positive or negative control. In some embodiments, the negative control sample is a biological sample from a subject that does not have a cholera infection. In some embodiments, the negative control sample is a sample that does not comprise a V. cholerae pathogen. In some embodiments, the negative control sample is a sample that does not comprise CAI-1. In some embodiments, the negative control sample is a sample that does not comprise ATc. In some embodiments, the positive control sample is a biological sample from a subject that has a cholera infection. In some embodiments, the positive control sample is a sample that comprises a V. cholerae pathogen. In some embodiments, the positive control sample is a sample that comprises CAI-1. In some embodiments, the positive control sample is a sample that comprises ATc.

[0079] In some embodiments, a subject is determined to have a cholera infection if a color change observed in a colorimetric assay using a biological sample from the subject is greater than a color change observed in a colorimetric assay using a control sample (e.g., a negative control sample). In some embodiments, a subject is determined to have a cholera infection if a color change observed in a colorimetric assay using a biological sample from the subject is at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% greater than a color change observed in a colorimetric assay using a control sample (e.g., a negative control sample). It should be appreciated, however, that determining whether a subject has a cholera infection using any of the methods provided herein may depend on a number of factors including, but not limited to, the sensitivity of the assay, the severity of the infection, the particular colorimetric assay used, and/or the type of biological sample obtained from the subject.

EXAMPLES

Example 1: Engineering of Lactococcus lactis to Detect and Kill Vibrio cholerae

[0080] The purpose of this technology is to engineer the two-component system of the probiotic bacteria Lactococcus lactis to detect and kill the cholera pathogen Vibrio cholerae. L. lactis is a member of the lactic-acid bacteria family and labeled generally recognized as safe (GRAS) by the FDA. Because it can reside in the human intestine with no harm to the body, L. lactis can be an ideal candidate for intestinal pathogen sensing and killing. Cholera is an infectious disease that can cause severe diarrhea. There are three to five million cholera cases every year, resulting in I 00,000-120,000 deaths, mostly in developing countries.sup.[l]. The engineered L. lactis will promise a safe, efficient and low-cost treatment for the serious infectious disease cholera.

[0081] A hybrid cell surface receptor that allows L. lactis to detect the Vibrio cholerae quorum-sensing molecule CAI-1 has been developed.sup.[2]. To enable CAI-1 detection, the Vibrio cholerae CqsS receptor which has evolved to specifically recognize CAI-1 was used. CqsS is a two component histidine kinase receptor that converts small molecule binding into a phosphorylation signal that is passed from its histidine kinase domain to its aspartate receiver partner, resulting in altered transcription. To incorporate the CqsS receptor into L. lactis, the receptor region of CqsS was fused to the signal transduction region of NisK, a well characterized histidine kinase receptor in L. lactis.sup.[3] (FIG. 2). When this hybrid receptor binds to CAI-1 molecules secreted by Vibrio cholerae, it deactivates phosphorylation signaling though the NisK histidine kinase domain, resulting in dephosphorylation of NisR and reduced transcription from the nisA promoter in L. lactis. This hybrid receptor also contains a single amino acid change in the NisK region of the protein (E182G) which is important for signal transduction. The full protein sequence of the hybrid receptor (SEQ ID NO: 1) is listed below.

[0082] To make a functional CqsS-NisK hybrid, several CqsS-NisK fusions were made using homology in the cytoplasmic region following the last predicted transmembrane region in CqsS and NisK to find an appropriate fusion point between the two proteins. Ten hybrid designs, labeled Hyb1-Hyb10, were chosen for further study (FIG. 5). It has been shown that the protein expression level of NisK and NisR is important for their activity, as high NisR expression causes NisK-independent activation of gene expression, so a randomized RBS library for each of the 10 hybrid CqsS-NisK gene fusions was generated to test a range of expression levels for each hybrid. Approximately 100 RBS library members of each hybrid CqsS-NisK fusion were tested for CAI-1 dependent expression of mCherry which was placed under control of the nisA promoter regulated by NisR.

[0083] The strongest CAI-1 dependent phenotype was seen in a single clone from the Hyb4 library, and full sequence analysis of this clone showed that it contained an unexpected point mutation in the codon coding for amino acid 182, changing it from a glutamate to a glycine (E182G).

[0084] To determine if this single amino acid change was required for CAI-1 dependent repression of mCherry expression, the point mutation in the Hyb4 clone was reverted to glutamate and it was found that the clone almost completely lost the ability to respond to CAI-1 expression. In addition, the glutamate to glycine point mutation was cloned into the other hybrids to test if this point mutation would allow the other hybrids to respond to CAI-1. As shown in FIG. 6, Hyb8 and Hyb9 showed some CAI-1 response, suggesting that the point mutation provides some benefit to these hybrids, but Hyb4 showed the strongest CAI-1 dependent response. Data for Hyb3, Hyb1 and Hyb10 are not shown because of the instability of their encoding genes during cloning.

[0085] To enable transcriptional activation of an output module, a transcription invertor was integrated into the circuit so that CAI-1 detection by the hybrid receptor results in increased target gene expression (FIG. 3B). In this circuit design, the TetR repressor was placed under control of the nisA promoter and then placed the output module under control of the TetR-repressible xyltet2 promoter which is derived from the Bacillus subtilis xylA promoter.sup.[4] and contains tetO operator sites.

[0086] To further optimize the functionality in Hyb4 containing the E182G mutation, targeted point mutations were made in the amino acids that form the junction between CqsS and NisK to look for Hyb4 variants with an increased response to CAI -1 (FIG. 3A). As shown in FIG. 8, Hyb4 variants with the amino acid substitutions tested in alanine 178 (A178) retained some ability to respond to CAI-1, but none showed a stronger response than the original Hyb4. Amino acid substitutions in S177 showed differential responses to CAI-1, with S177A and S177T showing similar response to Hyb4 and S177K showing markedly weaker response. This is perhaps not surprising since the introduction of a large side chain with a positive charge (S177K) is more likely to disrupt the structure than relatively minor amino acid changes such as S177T. Deletion of A176 or S177 had a strong detrimental effect on Hyb4 to respond to CAI-1.

[0087] As shown in FIG. 4, inclusion of this signal inverter circuit in L. lactis allows the bacteria to specifically detect Vibrio cholerae, producing a nearly 60-fold activation of the target gene expression in the presence of CAI-1 (FIG. 4). In this case, the output module is mCherry, but in other iterations the output module may be antimicrobial agents such as antimicrobial peptides (AMPs) or bacteriophage that can target Vibrio cholerae for killing. Other output module iterations include protein fusions of phage tail proteins that specifically bind Vibrio cholerae and AMPs that will kill or inhibit the bacteria. Colorimetric output modules such as LacZ (e.g., -galactosidase) and -lactamase may also be used to enable visual detection of circuit activation with the naked eye or by instrumentation.

[0088] In the absence of CAI-1, Hyb4 causes strong phosphorylation of NisR, resulting in strong mCherry expression from the nisA promoter. In the presence of CAI-1, reduced phosphorylation of NisR causes reduced mCherry expression. This is the same mode of action of CqsS, which autophosphorylates in the absence of CAI-1, and it is the opposite of what is normally seen for NisK where phosphorylation is low in the absence of nisin and is induced upon nisin binding. It appears that in Hyb4, CqsS receptor domain causes autophosphorylation of NisK as it does in its native CqsS context, and CAI-1 binding causes a conformational change that reduces or blocks phosphorylation.

[0089] This is a unique hybrid two component system. The creation of a hybrid histidine kinase receptor using a receptor domain from a histidine kinase receptor that autophosphorylates in the absence of the small molecule and a histidine kinase domain from a histidine kinase receptor that autophosphorylates in the presence of the small molecule is novel.

[0090] In other iterations, the hybrid receptor may be placed in other genetic constructs or in other bacteria such as Lactobacilli species including Lactobacillus acidophilus and Lactobacillus gasseri. The CqsS-NisK construct is likely to work in other bacteria where NisRK has been shown to function, including lactic acid bacteria (LAB) such as Leuconostoc lactis, Lactobacillus brevis, Lactobacillus plantarum, Lactobacillus casei, Lactobacillus gasseri, Lactobacillus helveticus, Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus pneumoniae, and Streptococcus zooepidemicus. NisRK is also functional in other bacteria including Enterococcus faecalis, Staphylococcus simulans and Bacillus subtilis, suggesting that our CqsS-NisK fusion protein would also be functional.

[0091] Other histidine kinase proteins could be used in place of NisK to couple the CqsS CAI-1 receptor domain with phosphorylation dependent signaling, including other well studied two component systems such as the SpaRK two-component system in Bacillus subtilis. Two component systems are found in nearly all sequenced bacteria and contain well defined histidine kinase domains that may be used to identify an appropriate site to fuse the receptor domain from CqsS to the histidine kinase domain to enable CAI-1-dependent phosphorylation or dephosphorylation.

Example 2: Engineering of Lactococcus lactis to Detect Vibrio cholerae Using a Colorimetric Based Assay

[0092] The present example describes an engineered Lactococcus lactis (L. lactis) microorganism that can be used to detect (e.g., in vitro) a V. choerae microorganism in a colorimetric assay. L. lactis was engineered to produce -lactamase in response to detecting CAI-1 secreted by V. cholerae, which turns a yellow substrate (nitrocefin) red when V. cholerae is detected. -lactamase is a robust enzyme with a high catalytic efficacy and a small size that makes it easy to diffuse. Wild-type (w.t.) L. lactis were transformed with pHTR plasmid, a schematic of which is shown in FIG. 9. The pHTR plasmid is a derivation of the pHCR2 plasmid, with the mCherry gene replaced by -lactamase gene. L. lactis transformed with pHTR express -lactamase in response to detecting CAI-1 secreted by V. cholerae. The pHTR construct has -lactamase repressed by TetR, where anhydrotetracycline (ATc) is an inducer that can be used to release TetR from binding the xyltet promoter and thus activate the expression of the -lactamase gene. Accordingly, adding ATc to L. lactis harboring the pHTR plasmid can be used as a positive control for -lactamase expression, for example in the absence of CAI-1 secreted by V. cholerae.

[0093] To test the diagnostic functionality of L. lactis (pHTR) to detect V. cholerae, L. lactis transfected with pHTR, L.(pHTR), were co-cultured with wild-type V. cholerae, V. w.t., in media. After 8 hours of co-culture, L.(pHTR) cells were fully induced to produce and secrete abundant -lactamase. The whole culture was sampled to test with nitrocefin substrate (0.1 M final concentration), which changes color from yellow to red in the presence of -lactamase. Within 10 minutes, the cultures that have CAI-1 present turned red and were distinguishable from the yellow color of CAI-1 negative cultures. See third row from the top of FIG. 10A, showing the color change over the course of 60 minutes, and the spectrophotometer readings in FIG. 10B, which represent the color change over the course of 30 minutes. Controls where wild-type L. lactis L. (w.t.) or L. lactis expressing pHTR L.(pHTR) are cultured alone (L. only), or in the presence of V. cholerae that do not express CAI-1 (L-FV.cqsA) did not change the yellow color of the nitrocefin substrate to red. See top two rows of FIG. 10A, and the spectrophotometer readings in FIG. 10B. As a positive control, L.(w.t.) and L.(pHTR) were cultured in the presence of anhydrotetracycline (L. w/ATc). See bottom row of FIG. 10A, and the spectrophotometer readings in FIG. 10B. The L.(pHTR) cells, but not the L.(w.t.) cells were capable of changing the nitrocefin substrate in the media from yellow to red in the presence of ATc.

[0094] Accordingly, this example demonstrates that engineered microorganisms provided herein, for example L. lactis, can be used to detect the presence of other microorganisms, such as pathogenic V. cholerae, for example using an in vitro colorimetric assay. A schematic representation demonstrating how engineered probiotic bacteria, e.g., Lactococcus lactis are able to detect the presence of pathogenic bacteria, e.g., Vibrio cholerae and initiate diagnostic and/or therapeutic functions is shown in FIG. 11.

TABLE-US-00001 HybridReceptorProteinSequence (SEQIDNO:1) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGL RCAAAVLFGGLVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDW STIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPTT LIEWQYIPIFLFTYVFGNLCFFRNQISAERHGKHDLSFQVAALSHDVKTP LTVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLLND ENDYKAIISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTLAL SRALINIFVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQAKK NAGKLFFTEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQKGGAEVIL KIKK AminoAcids1-177ofCqsSandofaHybridReceptor (SEQIDNO:2) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGL RCAAAVLFGGLVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDW STIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPTT LIEWQYIPIFLFTYVFGNLCFFRNQIS AminoAcids178-404ofaHybridReceptor (SEQIDNO:3) AERHGKHDLSFQVAALSHDVKTPLTVLKGNIELLEMTEVNEQQADFIESM KNSLTVFDKYFNTMISYTKLLNDENDYKAIISLEDFLIDLSVELEELSTT YQVDYQLVKKTDLTTFYGNTLALSRALINIFVNACQYAKEGEKIVSLSIY DDEKYLYFEIWNNGHPFSEQAKKNAGKLFFTEDTGRSGKHYGIGLSFAQG VALKHQGNLILSNPQKGGAEVILKIKK CqsSofVibriocholerae(gi|669353531|gb| KFD83389.1|CAI-1autoinducersensorkinase/ phosphatase) (SEQIDNO:4) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGL RCAAAVLFGGLVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDW STIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPTT LIEWQYIPIFLFTYVFGNLCFFRNQISHETKVSIAKTFGAGIAHEMRNPL SALKTSIDVVRTMIPKPQTAAHTDYSLDAQELDLLHQILNEADDVIYSGN NAIDLLLTSIDENRVSPASFKKHSVVDVIEKAVKTFPYKNAADQHSVELE VHQPFDFFGSDTLLTYALFNLLKNAFYYQKEHFSVRISIEQTIEYNLIRV RDNGVGIAPEMLEDIFRDFYTFGKNGSYGLGLPFCRKVMTAFGGTIRCAS QQGQWTEFVLSFPRYDSDTVNEIKTELLKTKSLIYIGSNQAIVRELNQLA VEDEFGFTAISAQQAVRRQDYEFEFDLILLDLDDATAQGELLPKLEGTLS FAEGCIGYVYDPGKTYAVNINRYLRIQPISIHSILRKPRKIIERLLFEQE SLSMNRNVIPLQKSRHERRILVVDDNQSIRTFTAILLEQQGYEVVQANDG SEVLKHMESQNIDLVLMDIEMPNVGGLEATRLIRDSEHEYKNIPIIGYTG DNSPKTLALVQTSGMNDFIVKPADRDVLLNKVAAWV NisKofLactococcuslactis(gi|504383310|ref| WP_014570412.1|nisinbiosynthesissensorprotein) (SEQIDNO:5) MGKKYSMRRRIWQAVIEIIIGTCLLILLLLGLTFFLRQIGQISGSETIRL SLDSDNLTISDIERDMKHYPYDYIIFDNDTSKILGGHYVKSDVPSFVASK QSSHNITEGEITYTYSSNKHFSVVLRQNSMPEFTNHTLRSISYNQFTYLF FFLGEIILIIFSVYHLIREFSKNFQAVQKIALKMGEITTFPEQEESKIIE FDQVLNNLYSKSKELAFLIEAERHEKHDLSFQVAALSHDVKTPLTVLKGN IELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLLNDENDYKAT ISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTLALSRALINI FVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQAKKNAGKLFF TEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQKGGAEVILKIKK Hyb4a (SEQIDNO:6) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGL RCAAAVLFGGLVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDW STIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPTT LIEWQYIPIFLFTYVFGNLCFFRNQIGAERHGKHDLSFQVAALSHDVKTP LTVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLLND ENDYKAIISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTLAL SRALINIFVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQAKK NAGKLFFTEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQKGGAEVIL KIKK Hyb4b (SEQIDNO:7) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGL RCAAAVLFGGLVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDW STIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPTT LIEWQYIPIFLFTYVFGNLCFERNQIAAERHGKHDLSFQVAALSHDVKTP LTVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLLND ENDYKAIISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTLAL SRALINIFVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQAKK NAGKLFFTEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQKGGAEVIL KIKK Hyb4c (SEQIDNO:8) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGL RCAAAVLFGGLVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDW STIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPTT LIEWQYIPIFLFTYVFGNLCFFRNQITAERHGKHDLSFQVAALSHDVKTP LTVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLLND ENDYKAIISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTLAL SRALINIFVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQAKK NAGKLFFTEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQKGGAEVIL KIKK Hyb4d (SEQIDNO:9) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGL RCAAAVLFGGLVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDW STIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPTT LIEWQYIPIFLFTYVFGNLCFFRNQIKAERHGKHDLSFQVAALSHDVKTP LTVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLLND ENDYKAIISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTLAL SRALINIFVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQAKK NAGKLFFTEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQKGGAEVIL KIKK Hyb4e (SEQIDNO:10) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGL RCAAAVLFGGLVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDW STIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPTT LIEWQYIPIFLFTYVFGNLCFFRNQISGERHGKHDLSFQVAALSHDVKTP LTVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLLND ENDYKAIISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTLAL SRALINIFVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQAKK NAGKLFFTEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQKGGAEVIL KIKK Hyb4f (SEQIDNO:11) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGL RCAAAVLFGGLVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDW STIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPTT LIEWQYIPIFLFTYVFGNLCFFRNQISDERHGKHDLSFQVAALSHDVKTP LTVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLLND ENDYKAIISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTLAL SRALINIFVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQAKK NAGKLEFTEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQKGGAEVIL KIKK Hyb4g (SEQIDNO:12) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGL RCAAAVLEGGLVERDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDW STIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPTT LIEWQYIPIFLFTYVFGNLCFERNQISKERHGKHDLSFQVAALSHDVKTP LTVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLLND ENDYKAIISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTLAL SRALINIFVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQAKK NAGKLEFTEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQKGGAEVIL KIKK Hyb4h (SEQIDNO:13) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGL RCAAAVLFGGLVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDW STIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPTT LIEWQYIPIFLFTYVFGNLCFFRNQISERHGKHDLSFQVAALSHDVKTPL TVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLLNDE NDYKATISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTLALS RALINIFVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQAKKN AGKLEFTEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQKGGAEVILK IKK Spak(gi|489312641|ref|WP_003220038.1|MULTI- SPECIES:histidinekinase[Bacillus]) (SEQIDNO:14) MGIGFKGRKTLLRELVKYMVTLCISLVVLALLYIFINTIAMNTGFSHPAN YNEREAEKLAPKLETIDKVTADMIPDTMSYAILNKETKQKTAGTIKEKDL QLVKKKIEKKPYVNYKQKGYLVIERNNEYCVLQYSLRADFSSPLLRKYLP NYELTSICILIILLIIVISIITTYFANRLRKHFETLNVITRYIKEQNLQF TPEFTHIKEFDDVIDSLIEMRDALQSSLEAQWRLEKNKKEQIGALAHDIK IPITIIKGNAELLSLSMQNEEQAEYTKYILGAGNQIEQYIYQUHLSKTED ALTIHLEKASVDELTETLVKDISAYKGNKNINISFKKENLMKEAKIDWQL LHRALLNILTNAVDYTPEGGTVSVHAECDSEIFYFFVKDTGNGESEMGLK KATELFYMDDKSRHSKGHYGMGLTFAKNAVNLHNGELTLGNTIAGGAEVR VKIPLRNE NisKAminoAcids221-447 (SEQIDNO:15) AERHEKHDLSFQVAALSHDVKTPLTVLKGNIELLEMTEVNEQQADFIESM KNSLTVFDKYFNTMISYTKLLNDENDYKATISLEDFLIDLSVELEELSTT YQVDYQLVKKTDLTTFYGNTLALSRALINIFVNACQYAKEGEKIVSLSIY DDEKYLYFEIWNNGHPFSEQAKKNAGKLFFTEDTGRSGKHYGIGLSFAQG VALKHQGNLILSNPQKGGAEVILKIKK Hyb1 (SEQIDNO:16) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGL RCAAAVLFGGLVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDW STIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPTT LIEWQYIPIFLFTYVFGNLCFFRFLIEAERHEKHDLSFQVAALSHDVKTP LTVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLLND ENDYKATISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTLAL SRALINIFVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQAKK NAGKLFFTEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQKGGAEVIL KIKK Hyb2 (SEQIDNO:17) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGL RCAAAVLFGGLVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDW STIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPTT LIEWQYIPIFLFTYVFGNLCFFRNLIEAERHEKHDLSFQVAALSHDVKTP LTVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLLND ENDYKATISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTLAL SRALINIFVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQAKK NAGKLFFTEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQKGGAEVIL KIKK Hyb3 (SEQIDNO:18) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGL RCAAAVLFGGLVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDW STIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPTT LIEWQYIPIFLFTYVFGNLCFFRNQIEAERHEKHDLSFQVAALSHDVKTP LTVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLLND ENDYKATISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTLAL SRALINIFVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQAKK NAGKLFFTEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQKGGAEVIL KIKK Hyb4 (SEQIDNO:19) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGL RCAAAVLFGGLVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDW STIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPTT LIEWQYIPIFLFTYVFGNLCFFRNQISAERHEKHDLSFQVAALSHDVKTP LTVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLLND ENDYKATISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTLAL SRALINIFVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQAKK NAGKLFFTEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQKGGAEVIL KIKK Hyb5 (SEQIDNO:20) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGL RCAAAVLFGGLVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDW STIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPTT LIEWQYIPIFLFTYVFGNLCFFRNQIREFSKNFQAVQKIALKMGEITTFP EQEESKIIEFDQVLNNLYSKSKELAFLIEAERHEKHDLSFQVAALSHDVK TPLTVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLL NDENDYKATISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTL ALSRALINIFVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQA KKNAGKLFFTEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQKGGAEV ILKIKK Hyb6 (SEQIDNO:21) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGL RCAAAVLFGGLVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDW STIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPTT LIEWQYIPIFLFTYVFGNLCFFRNQIREFSKNFQAVQKIALKMGEITTFP EQEESKIIEFDQVLNNLYSKSKELAFLIEAERHEKHDLSFQVAALSHDVK TPLTVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLL NDENDYKATISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTL ALSRALINIFVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQA KKNAGKLFFTEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQKGGAEV ILKIKK Hyb7 (SEQIDNO:22) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGL RCAAAVLFGGLVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDW STIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPTT LIEWQYIPIFLFTYVFGNLCFFRNLIREFSKNFQAVQKIALKMGEITTFP EQEESKIIEFDQVLNNLYSKSKELAFLIEAERHEKHDLSFQVAALSHDVK TPLTVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLL NDENDYKATISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTL ALSRALINIFVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQA KKNAGKLFFTEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQKGGAEV ILKIKK Hyb8 (SEQIDNO:23) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGL RCAAAVLFGGLVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDW STIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPTT LIEWQYIPIFLFTYVFGNLCFFRNQLIREFSKNFQAVQKIALKMGEITTF PEQEESKIIEFDQVLNNLYSKSKELAFLIEAERHEKHDLSFQVAALSHDV KTPLTVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKL LNDENDYKATISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNT LALSRALINIFVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQ AKKNAGKLFFTEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQKGGAE VILKIKK Hyb9 (SEQIDNO:24) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFIWEYWFPQSYENLGL RCAAAVLFGGLVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMNDW STIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPTT LIEWQYIPIFLFTYVFGNLCFFHLIREFSKNFQAVQKIALKMGEITTFPE QEESKIIEFDQVLNNLYSKSKELAFLIEAERHEKHDLSFQVAALSHDVKT PLTVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLLN DENDYKATISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTLA LSRALINIFVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQAK KNAGKLFFTEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQKGGAEVI LKIKK Hyb10 (SEQIDNO:25) MIVSMDVIKRVYQYAEPNLSLVGWMGMLGFPAYYFINVEYWFPQSYENLG LRCAAAVLFGGLVFRDSMPKKWQRYMPGYFLFTIGFCLPFFFAFMMLMND WSTIWAMSFMASIFLHILLVHDTRVMALQALFSVLVAYLAVYGLTDFHPT TLIEWQYIPIFLFTYVFGNLCFFRNQISHLIREFSKNFQAVQKIALKMGE ITTFPEQEESKIIEFDQVLNNLYSKSKELAFLIEAERHEKHDLSFQVAAL SHDVKTPLTVLKGNIELLEMTEVNEQQADFIESMKNSLTVEDKYENTMIS YTKLLNDENDYKATISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTF YGNTLALSRALINIFVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHP FSEQAKKNAGKLFFTEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQK GGAEVILKIKK mCherryAminoAcidSequence (SEQIDNO:26) MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAK LKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWER VMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEA SSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNV NIKLDITSHNEDYTIVEQYERAEGRHSTGGMETDELYK nisApromoter (SEQIDNO:27) AGTCTTATAACTATACTGACAATAGAAACATTAACAAATCTAAAACAGTC TTAATTCTATCTTGAGAAAGTATTGGTAATAATATTATTGTCGATAACGC GAGCATAATAAACGGCTCTGATTAAATTCTGAAGTTTGTTAGATACAATG ATTTCGTTCGAAGGAACTACAAAATA nisRpromoter (SEQIDNO:28) CCGGCTTTAGGTATAGTGTGTATCTCAATCCTTGGTATATTGAAAAGAAA GACTAAAAATTGATAGATTATATTTCTTCAGAATGAATGGTATAATGAAG TAATGAGTACTAAACAATCG xyltet2promoter (SEQIDNO:29) AAAACTAAAAAAAATATTGACACTCTATCATTGATAGAGTATAATTAAAA TAAGCTCCCTATCAGTGATAGAGAGAGAAAACGTATAAATTAGGGATAAA CTATGGAACTTATGAAATAGATTGAAATGGTTTATCTGTTACCCCGTATC AAAATTT -lactamaseAminoAcidSequence (SEQIDNO:30) MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLN SGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDL VEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFL HNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLA SRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPD GKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW -lactamaseNucleicAcidSequence (SEQIDNO:31) ATGAGCATTCAACATTTTAGAGTTGCCTTAATTCCTTTCTTCGCGGCTTT TTGCTTGCCGGTTTTCGCTCATCCAGAAACTTTGGTAAAGGTTAAAGACG CAGAAGACCAGTTGGGTGCACGAGTCGGGTATATTGAATTGGATCTTAAC AGTGGCAAGATATTGGAGAGTTTCAGACCGGAAGAGCGATTCCCGATGAT GTCTACCTTCAAGGTCCTTTTGTGTGGAGCTGTTTTGAGCCGAGTTGACG CGGGTCAAGAACAGCTTGGAAGACGAATACATTACTCACAAAACGATTTA GTCGAGTACAGCCCAGTGACAGAAAAACATCTTACCGATGGTATGACGGT CCGAGAATTGTGTAGCGCGGCAATAACCATGAGTGACAATACGGCTGCCA ATCTTCTTTTGACGACCATCGGAGGACCTAAAGAACTTACCGCATTTTTA CATAATATGGGGGACCATGTTACTAGATTGGATCGTTGGGAACCTGAGCT TAACGAAGCTATTCCAAACGACGAAAGAGATACCACAATGCCGGCGGCCA TGGCGACCACTTTACGTAAGCTTTTAACTGGTGAACTTTTGACTTTGGCC AGCCGACAGCAGCTTATTGATTGGATGGAAGCGGACAAAGTAGCAGGGCC GTTATTACGATCTGCGTTACCGGCAGGATGGTTTATAGCCGACAAAAGCG GTGCTGGTGAACGAGGCAGCAGAGGTATAATTGCGGCTTTAGGACCGGAC GGCAAACCAAGTAGAATCGTAGTCATATACACCACGGGGAGTCAGGCCAC CATGGATGAACGTAATCGTCAAATCGCGGAAATTGGAGCTTCATTGATAA AGCACTGG

REFERENCES

[0095] 1. Cholera. World Health Organization. http://www.who.int/mediacentre/factsheets/fs107/en/Retrieved Oct. 19, 2014. [0096] 2. Higgins, D. A., et al., The major Vibrio cholerae autoinducer and its role in virulence factor production. Nature, 2007. 450(7171): p. 883-6. [0097] 3. Mierau, I. and M. Kleerebezern, 10 years of the nisin-controlled gene expression system (NICE) in Lactococcus lactis. Appl Microbiol Biotechnol, 2005. 68(6): p. 705-17. [0098] 4. Geissendrfer, M., and W. Hillen. 1990. Regulated expression of heterologous genes in Bacillus subtilis using the Tn10 encoded tet regulatory elements. Appl. Microbiol. Biotechnol. 33:657-663.

EQUIVALENTS

[0099] While several inventive embodiments have been described and illustrated herein, those of ordinary skill in the art will readily envision a variety of other means and/or structures for performing the function and/or obtaining the results and/or one or more of the advantages described herein, and each of such variations and/or modifications is deemed to be within the scope of the inventive embodiments described herein. In addition, any combination of two or more such features, systems, articles, materials, kits, and/or methods, if such features, systems, articles, materials, kits, and/or methods are not mutually inconsistent, is included within the inventive scope of the present disclosure.

[0100] All definitions, as defined and used herein, should be understood to control over dictionary definitions, definitions in documents incorporated by reference, and/or ordinary meanings of the defined terms.

[0101] All references, patents and patent applications disclosed herein are incorporated by reference with respect to the subject matter for which each is cited, which in some cases may encompass the entirety of the document.

[0102] The indefinite articles a and an, as used herein in the specification and in the claims, unless clearly indicated to the contrary, should be understood to mean at least one.

[0103] As used herein in the specification and in the claims, the phrase at least one, in reference to a list of one or more elements, should be understood to mean at least one element selected from any one or more of the elements in the list of elements, but not necessarily including at least one of each and every element specifically listed within the list of elements and not excluding any combinations of elements in the list of elements. This definition also allows that elements may optionally be present other than the elements specifically identified within the list of elements to which the phrase at least one refers, whether related or unrelated to those elements specifically identified.

[0104] It should also be understood that, unless clearly indicated to the contrary, in any methods claimed herein that include more than one step or act, the order of the steps or acts of the method is not necessarily limited to the order in which the steps or acts of the method are recited.

[0105] In the claims, as well as in the specification above, all transitional phrases such as comprising, including, carrying, having, containing, involving, holding, composed of, and the like are to be understood to be open-ended, i.e., to mean including but not limited to. Only the transitional phrases consisting of and consisting essentially of shall be closed or semi-closed transitional phrases, respectively, as set forth in the United States Patent Office Manual of Patent Examining Procedures, Section 2111.03.