Anti-collagen antibodies for treatment and diagnosis
10125190 ยท 2018-11-13
Assignee
Inventors
- Laura Gualandi (Zurich, CH)
- Rajesh Kamath (Southborough, MA, US)
- Annette Schwartz Sterman (Princeton, MA, US)
Cpc classification
A61K47/6851
HUMAN NECESSITIES
C07K2317/33
CHEMISTRY; METALLURGY
A61K39/3955
HUMAN NECESSITIES
G01N33/564
PHYSICS
A61K47/6843
HUMAN NECESSITIES
A61K49/0004
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
A61K39/395
HUMAN NECESSITIES
Abstract
The invention relates to the diagnosis and treatment of diseases, including cancer and inflammatory disorders. The invention provides, and involves the use of, antibodies that bind collagen.
Claims
1. An antibody molecule that binds collagen, wherein the antibody molecule comprises a VH domain comprising a framework and a set of complementarity determining regions HCDR1, HCDR2 and HCDR3, and a VL domain comprising a framework and a set of complementarity determining regions LCDR1, LCDR2 and LCDR3, wherein: HCDR3 has the amino acid sequence shown in SEQ ID NO: 5; LCDR3 has the amino acid sequence shown in SEQ ID NO: 8; HCDR1 has the amino acid sequence shown in SEQ ID NO: 3, HCDR2 has the amino acid sequence shown in SEQ ID NO: 4, LCDR1 has the amino acid sequence shown in SEQ ID NO: 6, and LCDR2 has the amino acid sequence shown in SEQ ID NO: 7.
2. The antibody molecule according to claim 1, wherein the VH domain has the amino acid sequence shown in SEQ ID NO: 1, and the VL domain has the amino acid sequence shown in SEQ ID NO: 2.
3. An antibody molecule that binds collagen, wherein the antibody molecule comprises a VH domain comprising a framework and a set of complementarity determining regions HCDR1, HCDR2 and HCDR3, and a VL domain comprising a framework and a set of complementarity determining regions LCDR1, LCDR2 and LCDR3, wherein: HCDR3 has the amino acid sequence shown in SEQ ID NO: 13; LCDR3 has the amino acid sequence shown in SEQ ID NO: 16; HCDR1 has the amino acid sequence shown in SEQ ID NO: 11, HCDR2 has the amino acid sequence shown in SEQ ID NO: 12, LCDR1 has the amino acid sequence shown in SEQ ID NO: 14, and LCDR2 has the amino acid sequence shown in SEQ ID NO: 15.
4. The antibody molecule according to claim 3, wherein the VH domain has the amino acid sequence shown in SEQ ID NO: 9, and the VL domain has the amino acid sequence shown in SEQ ID NO: 10.
5. The antibody molecule according to claim 1, wherein the antibody molecule is or comprises a single chain Fv (scFv), is a small immunoprotein (SIP), is a diabody, or is an IgG molecule.
6. A conjugate comprising an antibody molecule according to claim 1 and a biocidal molecule, a cytotoxic molecule, an anti-inflammatory agent or a radioisotope.
7. The conjugate according to claim 6, wherein the biocidal molecule, or cytotoxic molecule, or anti-inflammatory agent is a cytokine.
8. The conjugate according to claim 1, wherein the conjugate is a fusion protein comprising the antibody molecule and a biocidal molecule, cytotoxic molecule, anti-inflammatory agent, or cytokine.
9. A conjugate comprising an antibody molecule according to claim 1 and a detectable label.
10. The antibody molecule according to claim 3, wherein the antibody molecule is or comprises a single chain Fv (scFv), is a small immunoprotein (SIP), is a diabody, or is an IgG molecule.
11. A conjugate comprising an antibody molecule according to claim 3 and a biocidal molecule, a cytotoxic molecule, an anti-inflammatory agent or a radioisotope.
12. A conjugate comprising an antibody molecule according to claim 3 and a detectable label.
13. A method of delivering a biocidal molecule, a cytotoxic molecule, an anti-inflammatory agent or a radioisotope to sites of osteoarthritis in a patient comprising administering to the patient a conjugate according to claim 6.
14. The method according to claim 13, wherein the molecule is an anti-inflammatory agent.
15. A method of delivering a biocidal molecule, a cytotoxic molecule, an anti-inflammatory agent or a radioisotope to sites of osteoarthritis in a patient comprising administering to the patient a conjugate according to claim 11.
Description
BRIEF DESCRIPTION OF THE FIGURES
(1)
(2)
(3)
(4)
(5)
DETAILED DESCRIPTION
(6) The invention includes the combination of the aspects and preferred features described except where such a combination is clearly impermissible or expressly avoided.
(7) The present invention relates to an antibody which binds collagen.
(8) Antibody Molecule
(9) The term antibody molecule describes an immunoglobulin whether natural or partly or wholly synthetically produced. The term also covers any polypeptide or protein having a binding domain which is, or is substantially homologous to, an antibody binding domain. Examples of antibodies are the immunoglobulin isotypes and their isotypic subclasses; fragments which comprise an antigen binding domain such single chain diabodies. The antibody molecule or fragment thereof may be human or humanised. It is possible to take monoclonal and other antibodies and use techniques of recombinant DNA technology to produce other antibodies or chimeric molecules which retain the specificity of the original antibody. Such techniques may involve introducing DNA encoding the immunoglobulin variable region, or the CDRs of an antibody to the constant regions, or constant regions plus framework regions, of a different immunoglobulin. See, for instance, EP-A-184187, GB 2188638A or EP-A-239400. A hybridoma or other cell producing an antibody may be subject to genetic mutation or other changes, which may or may not alter the binding specificity of antibodies produced.
(10) As antibodies can be modified in a number of ways, the term antibody molecule should be construed as covering antibody fragments, derivatives, functional equivalents and homologues of antibodies, including any polypeptide comprising an immunoglobulin binding domain, whether natural or wholly or partially synthetic. Chimeric molecules comprising an immunoglobulin binding domain, or equivalent, fused to another polypeptide are therefore included. Cloning and expression of chimeric antibodies are described in EP-A-0120694 and EP-A-0125023.
(11) The term specific may be used to refer to the situation in which the antibody molecule will not show any significant binding to molecules other than its specific binding partner(s). The term is also applicable where e.g. an antigen-binding site of an antibody molecule is specific for a particular epitope that is carried by a number of antigens, in which case the antibody molecule carrying the antigen-binding site will be able to bind to the various antigens carrying the epitope.
(12) The antibody molecule may be monovalent or bivalent i.e. may have two antigen binding sites. Where the antibody molecule is bivalent, the two antigen binding sites may be identical or different. An antigen binding site describes the part of an antibody which comprises the area which specifically binds to and is complementary to part or all of an antigen. Where an antigen is large, an antibody molecule may only bind to a particular part of the antigen, which part is termed an epitope. An antigen binding site may be provided by one or more antibody variable domains (e.g. a so-called Fd antibody fragment consisting of a VH domain).
(13) Preferably, an antigen binding site comprises an antibody light chain variable region (VL) and an antibody heavy chain variable region (VH).
(14) An antibody molecule of the invention preferably comprises the HCDR3 antibody C11, or antibody F9. The HCDR3 is known to play a role in determining the specificity of an antibody molecule (Segal et al., (1974), PNAS, 71:4298-4302; Amit et al., (1986), Science, 233:747-753; Chothia et al., (1987), J. Mol. Biol., 196:901-917; Chothia et al., (1989), Nature, 342:877-883; Caton et al., (1990), J. Immunol., 144:1965-1968; Sharon et al., (1990a), PNAS, 87:4814-4817; Sharon et al., (1990b), J. Immunol., 144:4863-4869; Kabat et al., (1991b), J. Immunol., 147:1709-1719).
(15) The antibody molecule may further comprise the HCDR1, HCDR2, LCDR1, LCDR2 and/or LCDR3 of antibody antibody C11, or antibody F9.
(16) The antibody may also comprise the VH and/or VL domain of antibody antibody C11, or antibody F9.
(17) An antibody molecule of the invention may have a VH domain having at least 70%, more preferably one of at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100%, sequence identity to the VH domain of antibody antibody C11, or antibody F9.
(18) An antibody molecule of the invention may have a VL domain having at least 70%, more preferably one of at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100%, sequence identity to the VL domain of antibody antibody C11, or antibody F9.
(19) Sequence identity is commonly defined with reference to the algorithm GAP (Wisconsin GCG package, Accelerys Inc, San Diego USA). GAP uses the Needleman and Wunsch algorithm to align two complete sequences that maximizes the number of matches and minimizes the number of gaps. Generally, default parameters are used, with a gap creation penalty=12 and gap extension penalty=4. Use of GAP may be preferred but other algorithms may be used, e.g. BLAST (which uses the method of Altschul et al. (1990) J. Mol. Biol. 215: 405-410), FASTA (which uses the method of Pearson and Lipman (1988) PNAS USA 85: 2444-2448), or the Smith-Waterman algorithm (Smith and Waterman (1981) J. Mol Biol. 147: 195-197), or the TBLASTN program, of Altschul et al. (1990) supra, generally employing default parameters. In particular, the psi-Blast algorithm (Nucl. Acids Res. (1997) 25 3389-3402) may be used.
(20) Variants of these VH and VL domains and CDRs may also be employed in antibody molecules for use in as described herein. Suitable variants can be obtained by means of methods of sequence alteration, or mutation, and screening.
(21) Particular variants for use as described herein may include one or more amino acid sequence alterations (addition, deletion, substitution and/or insertion of an amino acid residue), maybe less than about 20 alterations, less than about 15 alterations, less than about 10 alterations or less than about 5 alterations, 4, 3, 2 or 1.
(22) Alterations may be made in one or more framework regions and/or one or more CDRs. In particular, alterations may be made in HCDR1, HCDR2 and/or HCDR3.
(23) The antibody molecule may be a whole antibody or a fragment thereof, in particular an antigen-binding fragment thereof.
(24) Whole antibodies include IgA, IgD, IgE, IgG or IgM. Preferably, the whole antibody is IgG.
(25) Antigen-binding fragments of whole antibodies include (i) the Fab fragment consisting of VL, VH, CL and CH1 domains; (ii) the Fd fragment consisting of the VH and CH1 domains; (iii) the Fv fragment consisting of the VL and VH domains of a single antibody; (iv) the dAb fragment (Ward et al. (1989) Nature 341, 544-546; McCafferty et al., (1990) Nature, 348, 552-554; Holt et al. (2003) Trends in Biotechnology 21, 484-490), which consists of a VH or a VL domain; (v) isolated CDR regions; (vi) F(ab)2 fragments, a bivalent fragment comprising two linked Fab fragments (vii) single chain Fv molecules (scFv), wherein a VH domain and a VL domain are linked by a peptide linker which allows the two domains to associate to form an antigen binding site (Bird et al. (1988) Science, 242, 423-426; Huston et al. (1988) PNAS USA, 85, 5879-5883); (viii) bispecific single chain Fv dimers (PCT/US92/09965) and (ix) diabodies, multivalent or multispecific fragments constructed by gene fusion (WO2013/014149; WO94/13804; Holliger et al. (1993a), Proc. Natl. Acad. Sci. USA 90 6444-6448). Fv, scFv or diabody molecules may be stabilized by the incorporation of disulphide bridges linking the VH and VL domains (Reiter et al. (1996), Nature Biotech, 14, 1239-1245). Minibodies comprising a scFv joined to a CH3 domain may also be made (Hu et al. (1996), Cancer Res., 56(13):3055-61). Other examples of binding fragments are Fab, which differs from Fab fragments by the addition of a few residues at the carboxyl terminus of the heavy chain CH1 domain, including one or more cysteines from the antibody hinge region, and Fab-SH, which is a Fab fragment in which the cysteine residue(s) of the constant domains bear a free thiol group.
(26) A single chain Fv (scFv) may be comprised within a mini-immunoglobulin or small immunoprotein (SIP), e.g. as described in (Li et al., (1997), Protein Engineering, 10: 731-736). An SIP may comprise an scFv molecule fused to the CH4 domain of the human IgE secretory isoform IgE-S2 (?.sub.S2-CH4; Batista et al., (1996), J. Exp. Med., 184: 2197-205) forming an homo-dimeric mini-immunoglobulin antibody molecule
(27) Preferably the antibody molecule comprises or consists of a single chain Fv, a small immunoprotein, a diabody, or a (whole) IgG molecule.
(28) Conjugates
(29) Conjugates of the invention comprise an antibody molecule of the invention and a therapeutic or diagnostic agent. The therapeutic agent may be a biocidal molecule, a cytotoxic molecule, a radioisotope, a photosensitizer, an enzyme, a hormone, or an anti-inflammatory agent. Preferably, the therapeutic agent is a biocidal molecule, a cytotoxic molecule, a radioisotope, or an anti-inflammatory agent. The biocidal molecule, cytotoxic molecule, or anti-inflammatory agent may be a cytokine.
(30) The diagnostic agent may be radioisotope, e.g. a non-therapeutic radioisotope.
(31) Radioisotopes which may be conjugated to a binding member of the invention include isotopes such as .sup.94mTc, .sup.99mTc, .sup.186Re, .sup.188Re, .sup.203Pb, .sup.67Ga, .sup.68Ga, .sup.47Sc, .sup.111In, .sup.97Ru, .sup.62Cu, .sup.64Cu, .sup.86Y, .sup.88Y, .sup.90Y, .sup.121Sn, .sup.161Tb, .sup.153Sm, .sup.166Ho, .sup.105Rh, .sup.177Lu, .sup.123I, .sup.124I, .sup.125I, .sup.131I, .sup.18F, .sup.211At and .sup.225Ac. Preferably, positron emitters, such as .sup.18F and .sup.124I, or gamma emitters, such as .sup.99mTc, .sup.111In and .sup.123I, are used for diagnostic applications (e.g. for PET), while beta-emitters, such as .sup.131I, .sup.90Y and .sup.177Lu, are preferably used for therapeutic applications. Alpha-emitters, such as .sup.211At and .sup.225Ac may also be used for therapy. In one example, the specific binding member may be conjugated to .sup.177Lu or .sup.90Y.
(32) The specific binding member may be conjugated with the therapeutic agent by means of a peptide bond or linker, i.e. within a fusion polypeptide comprising said molecule and the specific binding member or a polypeptide chain component thereof. Other means for conjugation include chemical conjugation, especially cross-linking using a bifunctional reagent (e.g. employing DOUBLE-REAGENTS? Cross-linking Reagents Selection Guide, Pierce).
(33) Linkers
(34) The antibody molecule and the therapeutic or diagnostic agent may be connected to each other directly, for example through any suitable chemical bond or through a linker, for example a peptide linker.
(35) The peptide linker may be a short (2-20, preferably 2-15, residue stretch of amino acids). Suitable examples of peptide linker sequences are known in the art. One or more different linkers may be used. The linker may be about 5 amino acids in length.
(36) The chemical bond may be, for example, a covalent or ionic bond. Examples of covalent bonds include peptide bonds (amide bonds) and disulphide bonds. For example the antibody molecule and therapeutic or diagnostic agent may be covalently linked. For example by peptide bonds (amide bonds). Thus, the antibody molecule and therapeutic or diagnostic agent may be produced (secreted) as a single chain polypeptide. The individual components that form the antibody molecule or the therapeutic or diagnostic agent may also be connected directly, for example through any suitable chemical bond, or through a linker, for example a peptide linker. Examples of individual components which may be linked within the antibody molecule are CDRs or VH or VL sequences.
(37) Methods of Treatment and Diagnosis
(38) An antibody molecule or conjugate of the invention may be used in a method of treatment of the human or animal body, such as a method of treatment (which may include prophylactic treatment) of a disease or disorder in a patient (typically a human patient) comprising administering the antibody molecule or conjugate to the patient.
(39) Accordingly, such aspects of the invention provide methods of treatment comprising administering an antibody molecule or conjugate of the invention, pharmaceutical compositions comprising such an antibody molecule or conjugate for the treatment of a condition or disease, and a method of making a medicament or pharmaceutical composition comprising formulating the antibody molecule or conjugate of the present invention with a physiologically acceptable carrier or excipient.
(40) An antibody molecule or conjugate as herein described may be used in a method of treating an inflammatory disorder, inhibiting angiogenesis, treating cancer, and/or treating an autoimmune disease in a patient. The method may comprise targeting a therapeutic agent to the neovasculature in vivo. The agent may be any therapeutic agent discussed herein, which is suitable for treatment of the disease or disorder in question.
(41) Also contemplated is a method of treating an inflammatory disorder, inhibiting angiogenesis, treating cancer, and/or treating an autoimmune disease in a patient by targeting a therapeutic agent to the neovasculature in a patient, the method comprising administering a therapeutically effective amount of an antibody molecule or conjugate as herein described to the patient.
(42) An antibody molecule or conjugate as herein described may also be used in a method of imaging, detecting, or diagnosing a disease or disorder in a patient. A method of imaging, detecting, or diagnosing a disease or disorder comprising administering an antibody or conjugate as described herein to a patient is similarly contemplated. The disease or disorder may be an inflammatory disorder, angiogenesis, cancer, and/or an autoimmune disease. The method may comprise targeting a diagnostic agent, such as a detectable label, to the neovasculature in vivo.
(43) Inflammatory disorders include any disease or disorder which is characterised by an inflammatory abnormality. Such disease include, for example, immune system disorders, such as autoimmune diseases, and cancer.
(44) Angiogenesis is a feature of many known diseases and disorders and inhibition of angiogenesis using an antibody or conjugate of the invention may be used to treat such diseases and disorders. Similarly, diseases and disorders characterised by angiogenesis may be imaged, detected, or diagnosed using an antibody or conjugate described herein. Disease characterised by angiogenesis include, for example, rheumatoid arthritis, diabetic retinopathy, age-related muscular degeneration, angiomas, tumours and cancer.
(45) As mentioned above, conditions which may be treated, imaged, detected, or diagnosed using an antibody or conjugate as described herein include cancer, as well as other tumours and neoplastic conditions.
(46) Exemplary cancers include any type of solid or non-solid cancer or malignant lymphoma and especially liver cancer, lymphoma, leukaemia (e.g. acute myeloid leukaemia), sarcomas, skin cancer, bladder cancer, breast cancer, uterine cancer, ovarian cancer, prostate cancer, lung cancer, colorectal cancer, cervical cancer, head and neck cancer, oesophageal cancer, pancreatic cancer, renal cancer, stomach cancer and cerebral cancer. Cancers may be familial or sporadic. Cancers may be metastatic or non-metastatic. The cancer, tumour, or neoplastic condition preferably expresses collagen.
(47) Autoimmune disease which may be treated, imaged, detected, or diagnosed using an antibody or conjugate as described herein include lupus erytematosus, rheumatoid arthritis, and psoriathic arthritis.
(48) A further disease or disorder which may treated, imaged, detected, or diagnosed using an antibody or conjugate described herein is osteoarthritis.
(49) Pharmaceutical Compositions
(50) A further aspect of the present invention relates to a pharmaceutical composition comprising at least one antibody molecule or conjugate of the invention and optionally a pharmaceutically acceptable excipient.
(51) Pharmaceutical compositions of the present invention typically comprise a therapeutically effective amount of an antibody molecule or conjugate according to the invention and optionally auxiliary substances such as pharmaceutically acceptable excipient(s). Said pharmaceutical compositions are prepared in a manner well known in the pharmaceutical art. A carrier or excipient may be a liquid material which can serve as a vehicle or medium for the active ingredient. Suitable carriers or excipients are well known in the art and include, for example, stabilisers, antioxidants, pH-regulating substances, controlled-release excipients. The pharmaceutical composition of the invention may be adapted, for example, for parenteral use and may be administered to the patient in the form of solutions or the like.
(52) Pharmaceutical compositions comprising the antibody molecule or conjugate of the present invention may be administered to a patient. Administration is preferably in a therapeutically effective amount, this being sufficient to show benefit to the patient. Such benefit may be amelioration of at least one symptom. The actual amount administered, and rate and time-course of administration, will depend on the nature and severity of what is being treated. Prescription of treatment, e.g. decisions on dosage etc., is within the responsibility of general practitioners and other medical doctors. Treatments may be repeated at daily, twice-weekly, weekly, or monthly intervals at the discretion of the physician.
(53) A pharmaceutical composition of the invention may be administered to a patient in need of treatment via any suitable route, usually by injection into the bloodstream and/or directly into the site to be treated. The precise dose and its frequency of administration will depend upon a number of factors, the route of treatment, the size and location of the area to be treated.
(54) Pharmaceutical compositions for oral administration may be in tablet, capsule, powder or liquid form. A tablet may comprise a solid carrier such as gelatin or an adjuvant. Liquid pharmaceutical compositions generally comprise a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included
(55) For intravenous injection, or injection at the site of affliction, the pharmaceutical composition will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability. Those of relevant skill in the art are well able to prepare suitable solutions using, for example, isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection. Preservatives, stabilisers, buffers, antioxidants and/or other additives may be included, as required.
(56) A pharmaceutical composition may be administered alone or in combination with other treatments, either simultaneously or sequentially dependent upon the condition to be treated.
(57) Kits
(58) Another aspect of the invention provides a therapeutic kit for use in the treatment of a disease or disorder comprising an antibody molecule or conjugate as described herein. The components of a kit are preferably sterile and in sealed vials or other containers.
(59) A kit may further comprise instructions for use of the components in a method described herein. The components of the kit may be comprised or packaged in a container, for example a bag, box, jar, tin or blister pack.
(60) Further aspects and embodiments of the invention will be apparent to those skilled in the art given the present disclosure including the following experimental exemplification.
(61) All documents mentioned in this specification are incorporated herein by reference in their entirety.
(62) and/or where used herein is to be taken as specific disclosure of each of the two specified features or components with or without the other. For example A and/or B is to be taken as specific disclosure of each of (i) A, (ii) B and (iii) A and B, just as if each is set out individually herein.
(63) Unless context dictates otherwise, the descriptions and definitions of the features set out above are not limited to any particular aspect or embodiment of the invention and apply equally to all aspects and embodiments which are described.
(64) Certain aspects and embodiments of the invention will now be illustrated by way of example and with reference to the figures described above.
EXAMPLES
Example 1Preparation and Characterisation of Two New Antibodies Against Collagen
(65) The C11 and F9 antibodies were isolated in scFv configuration from phage display libraries as described by PCT/EP2009/006487 according to the screening technique described by Silacci et al. (Protein Engineering Design & Selection, 2006, 19, 471-478). For the generation of fully human monoclonal antibodies a commercial preparation of human type II collagen (Yo ProteinsKarolinska Institute Science Park, Cat. No. 210) was used. ScFv antibody fragments were expressed in E. coli TG-1 cells and purified from culture supernatant by affinity chromatography, using protein A resin (Sino Biological Inc.) Purified antibodies were analyzed by size-exclusion chromatographyon superdex 75 HR10/30 columns (Amersham Biosciences), peaks representing monomeric fractions were collected and used for affinity measurements by BIAcore on a low-density coated antigen chip.
(66) Both antibodies C11 and F9 displayed good staining of vascular structures as revealed by immunofluorescence analysis of a number of different tissues and tumour samples (see
(67) Characterisation by ELISA revealed that antibody F9 has a higher specificity for collagen type II than antibody C11, which recognizes both collagen type I and collagen type II as shown in
(68) Binding of antibodies C11 and F9 to collagen type II was also confirmed by Biacore analysis. The results are shown in
(69) Immunofluorescence Analysis:
(70) Double staining for collagen type II and von Willebrand factor (vWF) or CD31, as endothelial markers, was performed on several specimens: human placenta, rat tail, mouse spleen, mouse uterus, mouse stomach, mouse paw from a RA model, xenograft tumor model (SKRC52) and a murine tumor model (F9 teratocarcinoma). The frozen specimens were sectioned at 10 ?m thickness and treated with ice-cold acetone, rehydrated in PBS and blocked with 3% BSA. Affinity-purified scFv fragments (final concentration 5 mg/ml) carrying a myc-tag were added onto the sections followed by biotinylated monoclonal anti-myc antibody 9E10 antibody (5 mg/ml) and the endothelial marker antibody. Bound scFvs were detected with Strepavidin Alexa 594 (Molecular Probes), for the anti-vWF (DAKO) and anti-CD31 (BD Pharmingen) were used respectively goat anti-rabbit IgG Alexa 488 or goat ant-rat IgG Alexa 488. DAPI was used as nuclei staining. ScFv(KSF) anti-hen egg lysozyme was used as an isotype negative control for the staining.
(71) ELISA:
(72) MaxiSorp plates (NUNC) were coated with collagen type II (Yo Proteins), collagen type I (Chondrex) or an unrelated protein (periostin) at 20 ?g/mL final concentration.
(73) ScFv fragments were incubated for 1 hour, and bound antibody was detected with Protein A horse radish peroxidase (HRP) conjugate (GE Healthcare). The assay was developed by a colorimetric reaction using BM-Blue POD soluble substrate (Roche).
(74) Biacore Analysis:
(75) Monomeric fractions of antibodies C11 and F9 were analyzed by surface plasmon resonance (BIAcore, 3000 system). Human type II collagen was covalently coupled to the surface of the CM-3 sensor Chip. Thirty microliters of each sample were injected at the flow rate of 10 ?L/min. The regeneration of the chip was performed with 5 ?L of 10 mM HCl.
Example 2Biodistribution Studies and IHC Analysis Using Anti-Collagen Antibodies
(76) Biodistribution of anti-collagen antibodies C11 and F9 was tested in a rat medial meniscus tear (MMT) model of osteoarthritis (OA). IHC analysis was performed on tissues from the rat MMT model and on cartilage from human tissue.
(77) For the MMT model of OA, weight matched Lewis rats (300-325 g) were subjected to MMT surgery of the knee. The sham surgery was performed by exposing the joint and transecting the medial collateral ligament. In MMT animals the exposed meniscus was then transected at its narrowest point. The joint and skin were then closed with sutures. For the biodistribution studies only, rats were then injected intra-articularly in the knee with the targeting mAb (antibody C11 or F9) on day 17 and knee joints were harvested on day 20. The tibiae and femur, including the knee joint were harvested, dissected free of surrounding tissues and the tibiae were separated from the rest of the joint. The tissue was then fixed in 10% neutral buffered formalin for 3-4 days and decalcified in Cal-Ex II (Fisher Scientific, Waltham, Mass.) for 14 days. Dehydrated samples were embedded in paraffin using routine methods. Coronal sections were cut at 5 ?m thickness.
(78) For IHC analysis of tissues from the biodistribution studies, all slides were treated with Vector streptavidin block for 15 minutes, Vector biotin block for 15 minutes, Dako Dual Endogenous Enzyme block for 10 minutes and Dako protein block for 20 minutes after epitope retrieval. Subsequent to blocking for endogenous enzyme activity and non-specific binding, Rabbit anti-human antibody at 2 ug/mL was incubated on slides for 30 minutes to detect the primary antibody (C11 or F9). Leica anti-rabbit HRP polymer was used to label the secondary antibody (10 minutes) followed by application of Leica Bond DAB Refine (diaminobenzidine) for 2 minutes to stain the reaction. Slides were counterstained with hematoxylin. Three wash steps with Leica wash buffer were performed between each step. The results are shown in
(79) Knee joint cartilage and synovium from human osteoarthritis patients was obtained from Asterand, Detroit, Mich. USA or NDRI, Philadelphia, Pa. USA. For IHC analysis of the human joint tissues, all slides were treated with Vector streptavidin block for 15 minutes, Vector biotin block for 15 minutes, Dako Dual Endogenous Enzyme block for 10 minutes and Dako protein block for 20 minutes after epitope retrieval. Subsequent to blocking for endogenous enzyme activity and non-specific binding, biotinylated C11 antibody at 0.3 ?g/ml or biotinylated F9 antibody at 5.0 ?g/ml (primary antibodies) were added to tissues and incubated for 60 minutes. Vector ABC Elite reagent (streptavidin-HRP) was used for 30 minutes to detect the primary antibody. Leica Bond DAB Refine (diaminobenzidine) was applied for 2 minutes to stain the reaction. Slides were counterstained with hematoxylin. Three wash steps with Leica wash buffer were performed between each step. The results are shown in
(80) For IHC analysis of rat OA knee joint tissues (Rat MMT model on day 21 after surgery to induce OA), the knee joints were harvested, dissected free of surrounding tissues and the tibiae were separated from the rest of the joint. The tissue was then fixed in 10% neutral buffered formalin for 3-4 days and decalcified in Cal-Ex II (Fisher Scientific, Waltham, Mass.) for 14 days. Dehydrated samples were embedded in paraffin using routine methods. Coronal sections were cut at 5 ?m thickness. All slides were treated with Vector streptavidin block for 15 minutes, Vector biotin block for 15 minutes, Dako Dual Endogenous Enzyme block for 10 minutes and Dako protein block for 20 minutes after epitope retrieval. Subsequent to blocking for endogenous enzyme activity and non-specific binding, unlabeled human C11 antibody at 0.0075 ?g/ml or unlabeled human F9 antibody at 0.027 ?g/ml (primary antibodies) were added to the tissues and incubated 60 minutes. Rabbit anti-human antibody at 2 ug/mL was incubated on slides for 30 minutes to detect the primary antibody. Leica anti-rabbit HRP polymer was used to label the secondary antibody (10 minutes) followed by application of Leica Bond DAB Refine (diaminobenzidine) for 2 minutes to stain the reaction. Slides were counterstained with hematoxylin. Three wash steps with Leica wash buffer were performed between each step. The results are shown in
(81) In the rat MMT model of OA, joint damage (cartilage) is localized to the medial side while there is no damage on the lateral side of the joint, as disease is induced by tearing the medial meniscus. The F9 and C11 mAbs, which target type II collagen, showed staining of cartilage on the medial (disease) side of the joint and minimal to no staining on the lateral (non-disease) side of the joint (
(82) Antibody C11 showed staining of chondrocytes and cartilage in both human and rat in IHC studies, as was the case in the bio-distribution studies reported in
(83) In summary, both anti-collagen antibodies, C11 and F9, target epitopes within the type II collagen protein (major protein of the extracellular matrix of cartilage) and have the potential to target therapeutics to osteoarthritic joints. The C11 antibody stained damaged cartilage and subchondral bone (subchondral bone staining was observed only in IHC of human and rat knee joints) with minimal synovium staining while the F9 antibody stained damaged cartilage and synovium in in vivo bio-distribution studies (
SEQUENCE LISTING
(84) The Sequence Listing is submitted as an ASCII text file in the form of the file named Sequence_Listing.txt, which was created on Jan. 24, 2017, and is 7591 bytes, which is incorporated by reference herein.
(85) TABLE-US-00001 AminoacidsequencesofantibodyC11specific forcollagen SEQIDNO:1(C11-VH) EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEQVS AISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK TLAAFDYWGQGTLVTVSS SEQIDNO:2(C11-VL) EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLI YGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQAIGFPQT FGQGTKVEIK SEQIDNO:3(C11-VHCDR1) GFTFSSYAMS SEQIDNO:4(C11-VHCDR2) AISGSGGSTYYADSVKG SEQIDNO:5(C11-VHCDR3) TLAAFDY SEQIDNO:6(C11-VLCDR1) RASQSVSSSYLA SEQIDNO:7(C11-VLCDR2) GASSRAT SEQIDNO:8(C11-VLCDR3) QQAIGFPQT AminoacidsequencesofantibodyF9specific forcollagen SEQIDNO:9(F9-VH) EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVS AISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK AGYSLFDYWGQGTLVTVSS SEQIDNO:10(F9-VL) EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLI YGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQDQGMPLT FGQGTKVEIK SEQIDNO:11(F9-VHCDR1) GFTFSSYAMS SEQIDNO:12(F9-VHCDR2) AISGSGGSTYYADSVKG SEQIDNO:13(F9-VHCDR3) AGYSLFDY SEQIDNO:14(F9-VLCDR1) RASQSVSSSYLA SEQIDNO:15(F9-VLCDR2) GASSRAT SEQIDNO:16(F9-VLCDR3) QQDQGMPLT