NOVEL PSMA-SPECIFIC BINDING PROTEINS
20180318451 · 2018-11-08
Assignee
Inventors
- Arne Skerra (Freising, DE)
- Antonia Richter (Freising, DE)
- Volker Morath (Freising, DE)
- Cyril Barinka (Praha, CZ)
- Jakub Ptacek (Prague, CZ)
Cpc classification
C07K2319/036
CHEMISTRY; METALLURGY
C07K14/705
CHEMISTRY; METALLURGY
A61K38/177
HUMAN NECESSITIES
C07K2319/33
CHEMISTRY; METALLURGY
C07K2319/61
CHEMISTRY; METALLURGY
C07K19/00
CHEMISTRY; METALLURGY
C07K2318/20
CHEMISTRY; METALLURGY
C07K14/4748
CHEMISTRY; METALLURGY
C07K2319/10
CHEMISTRY; METALLURGY
International classification
C07K19/00
CHEMISTRY; METALLURGY
C07K14/705
CHEMISTRY; METALLURGY
Abstract
The present invention relates to a prostate-specific membrane antigen (PSMA)-specific binding protein, wherein the PSMA-specific binding protein is a lipocalin 2 (Lcn2)-derived binding protein and binds to PSMA with a K.sub.D of 10 nM or lower. The present invention also relates to a nucleic acid molecule encoding the PSMA-specific binding protein of the invention, a vector comprising said nucleic acid molecule of the invention and a host cell transformed with the vector. Furthermore, the invention relates to a method of producing the PSMA-specific binding protein of the invention, the method comprising culturing the host cell of the invention under suitable conditions and isolating the PSMA-specific binding protein produced. The present invention further relates to a protein conjugate comprising the PSMA-specific binding protein of the invention, or the PSMA-specific binding protein produced by the method of the invention. In addition, the present invention relates to a pharmaceutical or diagnostic composition; to the PSMA-specific binding protein of the invention, the nucleic acid molecule of the invention, the vector of the invention, the host cell of the invention or the PSMA-specific binding protein produced by the method of the invention, for use in therapy and/or diagnosis, and in particular for use in the therapy and/or diagnosis of tumors, Crohn's disease and/or neurological diseases.
Claims
1. A prostate-specific membrane antigen (PSMA)-specific binding protein, wherein the PSMA-specific binding protein is a lipocalin 2 (Lcn2)-derived binding protein and binds to PSMA with a K.sub.D of 10 nM or lower.
2. The PSMA-specific binding protein of claim 1, wherein the PSMA-specific binding protein comprises or consists of frame regions and loop regions as represented in formula I:
Frame 1-Loop 1-Frame 2-Loop 2-Frame 3-Loop 3-Frame 4-Loop 4-Frame 5(formula I), wherein the frame regions consist of the following amino acid sequences: Frame 1 consists of an amino acid sequence consisting of the sequence of formula II:
x.sub.1-(H/Q)-x.sub.2(formula II); Frame 2 consists of an amino acid sequence consisting of the sequence of formula III:
S-x.sub.3-(K/N)-x.sub.4-N-x.sub.5(formula III); Frame 3 consists of an amino acid sequence consisting of the sequence of formula IV:
Y-x.sub.6-T-x.sub.7-A-x.sub.8-(S/C)-(Q/R)-x.sub.9-(F/Y)-x.sub.10(formula IV); Frame 4 consists of an amino acid sequence consisting of the sequence of formula V:
G-x.sub.11-(N/S)-x.sub.12(formula V); Frame 5 consists of an amino acid sequence consisting of the sequence of formula VI:
x.sub.13-I-x.sub.14-(E/K)-x.sub.15(formula VI); wherein x.sub.1 to x.sub.15 consist of the following amino acid sequences or are a variant thereof: x.sub.1 consists of the amino acid sequence QDSTSDLIPAPPLSKVPLQQNFQDNQF (SEQ ID NO:8) or an N-terminal deletion fragment thereof; and x.sub.2 consists of the amino acid sequence GKWYVVGLA (SEQ ID NO: 9); x.sub.3 consists of the amino acid sequence ATIYEL (SEQ ID NO: 10); x.sub.4 consists of the amino acid sequence EDKSYNVT (SEQ ID NO: 11); x.sub.5 consists of the amino acid V; x.sub.6 consists of the amino acid Y; x.sub.7 consists of the amino acid I; x.sub.8 consists of the amino acid sequence TFVPG (SEQ ID NO:12); x.sub.9 consists of the amino acid sequence PGE; x.sub.10 consists of the amino acid sequence TL; x.sub.11 consists of the amino acid sequence LVRVVSTNY (SEQ ID NO:13); x.sub.12 consists of the amino acid sequence QHAMVFFK (SEQ ID NO:14); x.sub.13 consists of the amino acid F; x.sub.14 consists of the amino acid sequence ITLYGRTKELTS (SEQ ID NO:15); and x.sub.15 consists of the amino acid sequence LKENFIRFSKSLGLPENHIVFPVPIDQCIDG (SEQ ID NO:16) or a C-terminal deletion fragment thereof; and wherein the loop regions consist of the following amino acid sequence, or an amino acid sequence having at least 90% sequence identity thereto: Loop 1 consists of the amino acid sequence consisting of the sequence of formula VII:
y.sub.1-M/V-y.sub.2-Y-y.sub.3(formula VII); Loop 2 consists of the amino acid sequence consisting of the sequence of formula VIII:
R-(F/Y)-Y-L-(N/K)-y.sub.4(formula VIII); Loop 3 consists of the amino acid sequence consisting of the sequence of formula IX:
y.sub.5-y.sub.6-G-y.sub.7-(K/D)-y.sub.8(formula IX); Loop 4 consists of the amino acid sequence consisting of the sequence of formula X:
E-y.sub.9-Q-y.sub.10-W(formula X); wherein y.sub.1 consists of the amino acid sequence GN; y.sub.2 consists of the amino acid sequence ILREDKDP (SEQ ID NO:17); y.sub.3 consists of the amino acid sequence KM; y.sub.4 consists of the amino acid sequence KC; y.sub.5 consists of the amino acid G; y.sub.6 consists of the amino acid sequence IKS; y.sub.7 consists of the amino acid sequence PG; y.sub.8 consists of the amino acid sequence TS; y.sub.9 consists of the amino acid V; y.sub.10 consists of the amino acid sequence QNRE (SEQ ID NO:18).
3. The PSMA-specific binding protein of claim 2, wherein Loop 1 consists of the amino acid sequence GNVILREDKDPYKM (SEQ ID NO:19) or GNMILREDKDPYKM (SEQ ID NO:20); Loop 2 consists of the amino acid sequence RFYLNKC (SEQ ID NO:21), RFYLKKC (SEQ ID NO:22), RYYLNKC (SEQ ID NO:23) or RYYLKKC (SEQ ID NO:24); Loop 3 consists of the amino acid sequence GTIKSGPGKTS (SEQ ID NO:25) or GTIKSGPGDTS (SEQ ID NO:26); and/or Loop 4 consists of the amino acid sequence EVQQNREW (SEQ ID NO:27).
4. The PSMA-specific binding protein of claim 2, wherein if one or more of x.sub.1 to x.sub.15 is/are a variant of the specifically recited amino acid sequence(s), the total amount of variation is 12 or less amino acids.
5. The PSMA-specific binding protein of claim 2, wherein Frame 1 consists of the amino acid sequence QDSTSDLIPAPPLSKVPLQQNFQDNQFH GKWYVVGLA (SEQ ID NO:28) or QDSTSDLIPAPPLSKVPLQQNFQDNQFQ GKWYVVGLA (SEQ ID NO:29); Frame 2 consists of the amino acid sequence SATIYELKEDKSYNVTNV (SEQ ID NO:30) or SATIYELNEDKSYNVTNV (SEQ ID NO:31); Frame 3 consists of the amino acid sequence YYTIATFVPGSRPGEFTL (SEQ ID NO:32), YYTIATFVPGSQPGEFTL (SEQ ID NO:33), YYTIATFVPGSQPGEYTL (SEQ ID NO:34), YYTIATFVPGSRPGEYTL (SEQ ID NO:35), YYTIATFVPGCRPGEFTL (SEQ ID NO:36), YYTIATFVPGCQPGEFTL (SEQ ID NO:37), YYTIATFVPGCQPGEYTL (SEQ ID NO:38), or YYTIATFVPGCRPGEYTL (SEQ ID NO:39); Frame 4 consists of the amino acid sequence GLVRVVSTNYSQHAMVFFK (SEQ ID NO:40) or GLVRVVSTNYNQHAMVFFK (SEQ ID NO:41); and/or Frame 5 consists of the amino acid sequence FIITLYGRTKELTSKLKENFIRFSKSLGLPENHIV FPVPIDQCIDG (SEQ ID NO:42) or FIITLYGRTKELTSELKENFIRFSKSLGLPENHIV FPVPIDQCIDG (SEQ ID NO:43).
6. The PSMA-specific binding protein of claim 1, wherein the PSMA-specific binding protein comprises or consists of an amino acid sequence selected from the group consisting of the amino acid sequences of SEQ ID NOs:1 to 6.
7. The PSMA-specific binding protein of claim 6, wherein the PSMA-specific binding protein comprises or consists of an amino acid sequence selected from the group consisting of the amino acid sequences represented in SEQ ID NO:3 and SEQ ID NO:4.
8. A nucleic acid molecule encoding the PSMA-specific binding protein of claim 1.
9. A vector comprising the nucleic acid molecule of claim 8.
10. A host cell transformed with the vector of claim 9.
11. A method for the production of a PSMA-specific binding protein, the method comprising culturing the host cell of claim 10 under suitable conditions and isolating the PSMA-specific binding protein produced.
12. A protein conjugate comprising the PSMA-specific binding protein of claim 1.
13. A pharmaceutical or diagnostic composition comprising at least one of (i) a PSMA-specific binding protein of claim 1; (ii) a nucleic acid molecule encoding the PSMA-specific binding protein of claim 1; (iii) a vector encoding a nucleic acid molecule encoding the PSMA-specific binding protein of claim 1; (iv) a host cell transformed with a vector encoding a nucleic acid molecule encoding the PSMA-specific binding protein of claim 1; or (v) a PSMA-specific binding protein produced by culturing a host cell transformed with a vector encoding a nucleic acid molecule encoding PSMA-specific binding protein of claim 1 under suitable conditions and isolating PSMA-specific binding protein produced.
14. (canceled)
15. A method for therapy and/or diagnosis of tumors, Crohn's disease and/or neurological diseases, comprising administration of a composition of claim 13, wherein the method for therapy comprises administration of a therapeutically effective amount of a pharmaceutical composition of claim 13, and the method for diagnosis comprises administration of a composition of claim 13 and measuring binding to PSMA.
16. The method of claim 15, wherein the PSMA-specific binding protein is a protein conjugate comprising the PSMA-specific binding protein.
17. The method of claim 15, wherein the method for diagnosis further comprises imaging.
18. A composition of claim 13, wherein the PSMA-specific binding protein is a protein conjugate comprising the PSMA-specific binding protein.
Description
[0182] The invention is illustrated with the following figures which show:
[0183]
[0184]
[0185]
[0186]
[0187]
[0188]
[0189]
[0190] The following examples illustrate the invention:
EXAMPLE 1: GENERAL METHODS
[0191] Expression and purification of human PSMA variants Three variants of human PSMA featuring different N-terminal tags were used (
Wild-Type rhPSMA:
[0192] Cloning, expression and purification of the extracellular part of human PSMA (rhPSMA; denoted rhGCPII in the original paper, residues 44-750) were carried out as described..sup.23 The protein was purified using ion-exchange chromatography (Q and SP Sepharose FF), affinity chromatography on Lentil-Lectin Sepharose, and size-exclusion chromatography (SEC) on a Superdex 16/60 HR200 column with 20 mM Tris/HCl, 150 mM NaCl, pH 8.0 as mobile phase (all resins/columns from GE Healthcare Bio-Sciences). Purified rhPSMA was concentrated to 1 mg/mL and kept at 80 C. until further use.
Avi-PSMA:
[0193] The extracellular part of human PSMA comprising an N-terminal Avi-tag (Avi-PSMA) was prepared as previously described..sup.24 Briefly, the recombinant protein was expressed in Schneider S2 cells stably transfected with E. coli biotin protein ligase localized to the endoplasmic reticulum. After coexpression of the fusion protein, single-step purification was carried out using a resin with an immobilized Streptavidin mutant (Streptavidin Mutein Matrix, Roche, 03708152001) with biotin elution. SEC as above yielded the final preparation with >95% purity. Avi-PSMA was aliquoted, shock-frozen in liquid nitrogen and stored at 80 C. until further use.
SF-PSMA:
[0194] A Strep-FLAG-TEV sequence (
[0195] For partial deglycosylation, SF-PSMA (10 g) was mixed with both 1-2,3 Mannosidase (64 U) and 1-6 Mannosidase (80 U; both from New England Biolabs) in a volume of 50 L. The deglycosylation reaction was carried out at 37 C. for 4 h and monitored by SDS-PAGE.
Selection of Anticalins Against PSMA Via Phage Display
[0196] A previously published Lcn2 library (Gebauer, M. et al. [2013] J. Mol. Biol. 425:780-802) served as a starting point for the selection of PSMA-specific Anticalins. In this library, twenty specified amino acid positions within the structurally variable loops and adjoining regions around the natural ligand pocket were randomized to generate a genetic library amenable for phage display selection of lipocalin variants with prescribed binding activities. This Anticalin library was encoded on the pNGAL108 plasmid in frame with the N-terminal OmpA signal peptide and the C-terminal Strep-tag II, followed by the pill minor coat protein of M13 bacteriophage (Gebauer, M. & Skerra, A. [2012] Meth. Enzymol. 503:157-188).
[0197] The successful selection of PSMA-specific lipocalin variants from the nave library was carried out by on-bead panning essentially following a published procedure (Gebauer, M. & Skerra, A. [2012] Meth. Enzymol. 503:157-188). To this end, 100 nM SF-PSMA was first incubated with 10.sup.11 phages of the library in TBS+2% (w/v) BSA in a total volume of 500 L for 1 h at room temperature. SF-PSMA/phage complexes were then captured during 10 min using 25 L of Anti-FLAG M2 magnetic beads (Sigma-Aldrich, M8823). Following magnetic separation, unbound phages were discarded and the beads were washed ten times with TBS containing 0.1% v/v Tween 20 (TBS/T; 0.5 mL per a wash cycle). Finally, bound phagemid/SF-PSMA complexes were released from the resin by competitive elution with an excess of the FLAG peptide (300 L of 200 g/mL; Sigma-Aldrich, F3290) in TBS/T. Amplification of eluted phagemids was performed as described..sup.21 A total of four panning cycles were carried out in this way using 10.sup.9-10.sup.11 phages from the preceding panning round as an input (exact number of phages determined from titer). The phasmid DNA of the enriched population from the last cycle was isolated with the QIAgen Plasmid Midiprep Kit (QIAgen, 12143) and subjected to subcloning on the plasmid pNGAL98 for soluble expression and ELISA screening (see below).
[0198] For affinity maturation via phage display, the panning procedure was modified as follows: instead of SF-PSMA, Avi-PSMA was incubated with the blocked phagemid library in solution and Avi-PSMA/phagemid complexes were captured via Streptavidin magnetic beads (50 L; Roche, 11641778001; rounds 1 and 3) or Neutravidin-coated Sera-Mag Speed beads (50 L; Thermo Scientific, 78152104011150, rounds 2 and 4) in an alternating manner. 10 nM Avi-PSMA target was used for the first two rounds whereas the concentration was decreased to 1 nM in rounds 3 and 4. Bead-bound phages were washed under more stringent conditions with first TBS/T containing 0.1 mM D-desthiobiotin as well as 100 nM rhPSMA for 30 min (to select for slow k.sub.off), followed by nine washing steps with TBS/T+desthiobiotin for 1 min. Bound phages were finally released by acidic elution with 350 L of 0.1 M glycine/HCl pH 2.2, for 10 min and immediately neutralized by addition of 55 L 0.5 M Tris base (pH 10.5).
[0199] Affinity maturation via phage display A second generation Anticalin library was generated by error prone PCR based on the Anticalin A3 template obtained from the original anti-PSMA selection campaign using the GeneMorph II random mutagenesis kit (Agilent Technologies, 200550). First, the Anticalin gene was amplified from the pNGAL98 expression vector by Taq DNA polymerase using the primers 5-AGA CAG CTA TCG CGA TTG CA (SEQ ID NO:52) and 5-CGC AGT AGC GGT AAA CG (SEQ ID NO:53). The amplified gene was purified from an agarose gel with the QIAquick Gel Extraction Kit (QIAgen, 28704) and used as a template for the error-prone PCR, which was carried out according to the manufacturer's protocol. Shortly, 1 ng of the template together with the primers BstXI-for (5-cag gac aac caa ttc cat ggg) (SEQ ID NO:54) and BstXI-rev (5-gga ggc cca gag att tgg) (SEQ ID NO:55) that flank the central region of the Anticalin gene, comprising all four previously randomized loops, were used to introduce an optimal number of 4-6 nucleotide mutations per gene during a total of 30 reaction cycles. The resulting PCR product was purified from agarose gel and ligated with the phage display vector pNGAL108 using BstXI restriction sites, followed by electroporation of E. coli XL1-Blue cells as described (Gebauer, M. & Skerra, A. [2012] Meth. Enzymol. 503:157-188). The complexity of the resulting sublibrary was assessed by plating a dilution series of transformed cells and revealed typically about 10.sup.8-10.sup.9 individual clones. Finally, phage particles were produced and used for the panning rounds as described above.
Identification of PSMA-Specific Anticalin Candidates by High-Throughput ELISA
[0200] Enriched lipocalin variants from phage display were subjected to ELISA screening after subcloning of the central BstXI gene cassette on pNGAL98, which also encodes the N-terminal OmpA signal sequence directing the expressed protein into the bacterial periplasm and a C-terminal Strep-tag II for purification (Schmidt, T. G. & Skerra, A. [2007] Nat. Protoc. 2:1528-1535). After transformation of E. coli TG1-F- (Kim, H. J. et al. [2009] J. Am. Chem. Soc. 131:3565-3576) with the ligation mixture, randomly picked colonies were inoculated in a 96-well plate filled with 100 L of Terrific broth (TB) media supplemented with 100 g/mL ampicillin per well. Anticalin expression was induced at an optical density of OD.sub.550=0.3-0.5 by addition of 20 L TB/Amp containing 1.2 g/mL anhydrotetracycline (aTc; ACROS Organics, 233131000) overnight at 20 C. The periplasmic extract was prepared as previously described.sup.21 and applied to 96-well MaxiSorp plates (Nunc, 442404) coated with rhPSMA (5 g/mL in TBS) and blocked with BSA. Ovalbumin (10 g/mL in TBS) served as non-related control protein in parallel. After 1 h incubation at room temperature, plates were washed three times with PBS/T and bound lipocalin variants were detected by means of their C-terminal Strep-tag II using StrepTactin conjugated to alkaline phosphatase (IBA, 2-1503-001), diluted 1:5,000 in PBS, for 1 h. Signals were developed by hydrolysis of 0.5 mg/mL p-nitrophenyl phosphate in 0.1 M NaCl, 5 mM MgCl.sub.2, 0.1 M Tris/HCl, pH 8.8, and monitored via absorbance measurement at 405 nm with an Infinite 200 PRO microplate reader (Tecan).
Affinity Maturation Via Bacterial Surface Display
[0201] First, a library based on the Lcn2 variant A3A5 was constructed via error-prone PCR as described above. The resulting PCR product was digested with BstXI, purified and ligated with the plasmid pNGAL146 (Gebauer, M. & Skerra, A. [2012] Meth. Enzymol. 503:157-188), which encodes a fusion protein between the lipocalin and the -domain of the bacterial autotransporter EspP. The resulting Anticalin library was used for transformation of electrocompetent E. coli JK321 cells (Jose, J. et al. [1996] Gene 178:107-110), followed by plating on LB/Amp agar.
[0202] For EspP-mediated bacterial surface display, cell cultivation, target incubation, staining and fluorescence-activated cell sorting (FACS) were carried out as described before (Binder, U. et al. [2010] J. Mol. Biol. 400:783-802). In brief, colonies were scraped from the agar plate, suspended in 50 mL of LB/Amp and shaken for 1 h at 37 C. This culture was used to inoculate a 50 mL LB/Amp overnight culture at 30 C. which in turn was used the next day to inoculate 50 mL LB/Amp at 30 C. with a starting OD.sub.550=0.15. Gene expression was induced at OD.sub.550=0.5 with 10 ng/mL aTc for 2.5 h. Cells from 100-200 L of this culture were spun down in an Eppendorf tube for 3 min at 4 C., washed once in PBS with 3% w/v BSA (PBS/BSA) and resuspended in 1000 L PBS/BSA supplemented with 2.5 or 1 nM Avi-PSMA (see below). After 1 h incubation under gentle shaking at 4 C. the cells were washed and incubated in the presence of 100 nM purified A3A5 Anticalin as competing PSMA ligand. After that, cells were washed once and remaining bound PSMA was stained by subsequent incubation with PBS/BSA containing 25 g/mL streptavidin/phycoerythrin (SA/PE; BD Biosciences, 554061) and 3 M Dy634-labelled A3C5 Fab fragment directed against a peptide tag as part of the Anticalin-autotransporter fusion protein (Binder, U. et al. [2010] J. Mol. Biol. 400:783-802). Following 30 min of incubation on ice the cells were finally washed once with PBS and then applied to a FACSAria Cell-Sorting System (BD Biosciences).
[0203] For fluorescence detection of PE, a 488 nm laser diode and a 530/30 band pass filter was used, while Dy634 was detected using a HeNe laser (633 nm) and a 660/20 band pass filter. In each of the four selection rounds the fraction comprising the 0.3-0.5% most fluorescent cells were sorted and subsequently cultivated for the next cycle. Stringency of the selection was gradually increased by lowering the concentration of Avi-PSMA (2.5 nM in round 1 and 2; 1 nM in round 3 and 4) and increasing the duration of the competitive dissociation step from 3 h in round 1 to 30 h in round 4. Finally, single clones were analyzed by DNA sequencing of the BstXI gene cassette as well as individual cultivation, staining and single-clone FACS analysis. For further analysis of promising candidates, the BstXI gene cassette was subcloned on pNGAL98.
Anticalin Expression and Purification
[0204] Anticalin candidates were produced via periplasmic secretion in E. coli using the vector pNGAL98 in shaker flasks according to a standard procedure (Gebauer, M. & Skerra, A. [2012] Meth. Enzymol. 503:157-188). Transformed E. coli TG1-F.sup. were cultured in LB medium supplemented with 100 mg/L ampicillin at 22 C. and 180 rpm until exponential growth was reached. Then, expression was induced for 3 h by addition of aTc to a final concentration of 200 g/L. Bacteria were harvested by centrifugation and the periplasmic extract was prepared by a mild osmotic shock and subsequent removal of spheroplasts by centrifugation. The recombinant Anticalins were purified by means of StrepTactin affinity chromatography (Schmidt, T. G. & Skerra, A. [2007] Nat. Protoc. 2:1528-1535), followed by size-exclusion chromatography on a Superdex 16/60 HR75 column equilibrated in PBS.
Anticalin Affinity Measurement by ELISA
[0205] 50 L of rhPSMA (5 g/mL in TBS) was directly adsorbed onto the surface of a MaxiSorp 96-well plate overnight at 4 C. Similarly, ovalbumin-coated wells (10 g/mL in PBS) were used as a negative control. After blocking with 250 L of 2% w/v BSA for 1 h at room temperature, 50 L from a serial Anticalin dilution in PBS was added to each well and incubated for 1 h. The plates were washed three times and bound Anticalins were detected with StrepTactin-AP as described further above. The data were analyzed using Prism 5 software (GraphPad) and absorption values (A) were fitted according to the formula A=A.sub.max.Math.[L.sub.tot]/(K.sub.D+[L.sub.tot]) with the concentration of the applied lipocalin variant [L.sub.tot] and the dissociation constant K.sub.D.
BIAcore Real-Time Affinity Measurements
[0206] Surface plasmon resonance (SPR) spectroscopy was performed on a BIAcore 2000 instrument (BIAcore) following published procedures (Gebauer, M. et al. [2013] J. Mol. Biol. 425:780-802; De Crescenzo, G. et al. [2008] J. Mol. Recognit. 21:256-266). rhPSMA (1 nM in 10 mM Na-acetate pH 5.0) was immobilized on a CM5 sensor chip (BIAcore) using an amine coupling kit (GE Healthcare, BR100050), resulting in around 500 resonance units (RU). The purified Anticalins were diluted in HEPES buffered saline (HBS; 10 mM HEPES/NaOH, 150 mM NaCl, pH 7.4) with 0.005% v/v Tween 20 to concentrations from 64-2 nM. The instrument was operated using the same running buffer at a flow rate of 25 L/min. Complex formation was monitored by injection of 100 L of the Anticalin solution and dissociation was observed for 100 min. Regeneration of the sensor chip was achieved by up to four injections of 10 L glycine/HCl, pH 2.0. The sensorgrams were corrected by double subtraction of the corresponding signals measured for the in-line control blank channel and an averaged baseline determined from three buffer blank injections.sup.31. Kinetic parameters were determined by data fitting using a 1:1 Langmuir binding model with BIAevaluation software version 4.1 (BIAcore).
Cell Lines
[0207] The PSMA-positive LNCaP and PSMA-negative PC-3 prostate carcinoma cell lines were grown in RPMI-1640 medium (Sigma-Aldrich, cat. no. R5886) supplemented with 10% v/v fetal bovine serum (FBS). The HEK293T/17 cell line was purchased from the American Type Culture Collection (CRL-11268) and grown in Dulbecco's modified Eagle's medium in the presence of 10% v/v fetal bovine serum under a humidified 5% v/v CO.sub.2 atmosphere at 37 C. HEK293T/17 cells overexpressing PSMA were generated by jetPRIME-mediated transfection (Polyplus-transfection, 114-07) using the vector pcDNA4/V5-His A (Invitrogen) carrying the nucleotide sequence for full-length human PSMA (FOLH1; NCBI Reference sequence: NM_004476.1). The PSMA-expressing clone was obtained by repeated cloning of a single cell under the selection pressure of Zeocin (25 g/mL; InvivoGen, ant-zn-1).
Western Blotting and Immunodetection
[0208] PSMA-overexpressing cells were washed with PBS, collected by centrifugation and lysed in 50 mM Tris/HCl pH 6.8, 2% w/v SDS, 10% v/v glycerol. The total protein concentration in the cell lysate was estimated using the BCA protein assay (Pierce Biotechnology, 23228 and 23224) and 20 g of protein per lane were loaded on a 10% SDS-PAGE gel. After electrophoresis, proteins were transferred onto a PVDF membrane (Millipore Corporation, 1PFL00010) and PSMA was detected by subsequent incubation with the GCP04 primary antibody.sup.32 and an anti-mouse secondary antibody conjugated to horseradish peroxidase (Bio-Rad, 172-1011), followed by signal development with Luminata Forte chemiluminescence substrate (Millipore Corporation, WBLUF0500). Signals were recorded with an ImageQuant LAS 4000 imager (GE Healthcare) and processed with Adobe Photoshop software.
Immunofluorescence Microscopy
[0209] PSMA-positive and -negative cells grown on cover slides coated with gelatin (0.1% w/v) were washed twice with PBS, fixed with 4% w/v paraformaldehyde in PBS for 15 min, permeabilized by treatment with PBS containing 0.1% v/v Triton X-100 for 15 min, and incubated in the blocking solution (5% w/v non-fat dried milk/PBS) for 30 min at room temperature (RT). Cells were then incubated with 0.5 M Anticalin in 5% w/v non-fat dried milk/PBS for 45 min at RT followed by incubation with a Strep-tag II specific monoclonal antibody StrepMAB-Immo (2 g/mL in PBS/0.05% Tween-20; IBA, 2-1517) for 1 h at RT. An anti-mouse secondary antibody conjugated to Alexa Fluor 488 (5 g/mL in PBS/0.05% Tween-20; Life Technologies, A11029) served as detection reagent and was applied for 1 h at RT. All incubation steps were interspersed by extensive washing with PBS/0.05% Tween-20. Processed slides were treated with 4,6-diamidino-2-phenylindole (DAPI; 1 g/mL; Sigma, D9542) for 5 min, mounted in VectaShield medium (Vector Laboratories, H-1000), and imaged with a TCS SP5 confocal microscope equipped with a 63 immersion oil objective (Leica Microsystems,). Images were processed using Adobe Photoshop software.
Flow Cytometry
[0210] Cells were detached by PBS supplemented with 0.25% w/v Trypsin and 0.02% w/v EDTA, washed, centrifuged, resuspended in PBS containing 2% w/v BSA and incubated with 1 M of purified Anticalin for 30 min at 4 C. in a total volume of 20 L. Next, the cell suspension was incubated with the StrepMAB-Immo antibody (6.7 g/mL) for 30 min at 4 C. in a total volume of 40 L. Finally, cells were incubated with an anti-mouse secondary antibody conjugated to Alexa Fluor 647 (4 g/mL; Life Technologies, A21236) for 30 min at 4 C. in a total volume of 50 L. All incubations and interspersing washing steps were performed in PBS/2% BSA. To label dead cells, Hoechst 33258 was added to the samples immediately before flow cytometry analysis. Cells were analyzed using a LSRII flow cytometer (BD Biosciences) and data were processed using FlowJo software (FlowJo LLC). Only viable cells (negative for Hoechst staining) were analyzed.
EXAMPLE 2: PREPARATION OF PSMA VARIANTS AS TARGET PROTEINS FOR SELECTION EXPERIMENTS AND BIOCHEMICAL ASSAYS
[0211] Three different versions of the extracellular region of human PSMA (residues 44-750; UniProt ID: Q04609) were constructed and denoted rhPSMA, Avi-PSMA, and SF-PSMA. These versions differ in their respective N-termini (
[0212] The extracellular region of human PSMA comprises 10 potential N-glycosylation sites per monomer, all carrying an oligosaccharide chain in vivo. Depending on the expression host and/or tissue source, glycans can account for up to 30% of the total molecular weight of the protein (Holmes, E. H. et al. [1996] Prostate Suppl. 7:25-29; Barinka, C. et al. [2004] Protein Sci. 13:1627-1635). Our mass-spectrometric analysis indicated that the PSMA ectodomain overexpressed in insect cells carried N-linked sugars with a combined mass of approximately 9.4 kDa (i.e. 12% of the polypeptide mass; data not shown). Such a high degree of N-glycosylation could hamper the in vitro selection of binding proteins by masking/obstructing potential surface epitopes. However, it was shown that the complete removal of N-linked sugars, e.g. by PNGase F treatment or by cultivating PSMA-expressing cells in the presence of tunicamycin, leads to inactive, partially misfolded protein preparations (Barinka, C. et al. [2004] Protein Sci. 13:1627-1635; Barinka, C. et al. [2002] J. Neurochem. 80:477-487). To increase the accessible protein surface area of PSMA that may be targeted during Anticalin selection, while still maintaining its three-dimensional fold (as well as enzymatic activity), a combined treatment with 1-2,3 mannosidase and 1-6 mannosidase was thus used to only partially deglycosylate the purified SF-PSMA. This endoglycosidase processing yielded a PSMA preparation that migrated faster in SDS-PAGE, confirming the partial removal of N-linked sugars (
EXAMPLE 3: SELECTION OF PSMA-SPECIFIC ANTICALINS
[0213] A Lcn2-based random library (Gebauer, M. et al. [2013] J. Mol. Biol. 425:780-802) cloned on the vector pNGAL108 was used for phagemid display selection against PSMA (
[0214] Consequently, the panning procedure was modified to increase the selectivity of elution conditions for specifically formed target/phagemid complexes by the utilization of the FLAG-tagged SF-PSMA in conjunction with anti-FLAG M2 magnetic beads and competitive elution with the FLAG peptide. Additionally, the partially deglycosylated SF-PSMA (see above) was used to increase the accessibility of epitopes on the recombinant target protein. To this end, fully glycosylated and partially deglycosylated SF-PSMA were applied in a second selection campaign in two parallel panning setups. 100 nM of each SF-PSMA variant was incubated with the naive Lcn2 library and SF-PSMA/phagemid complexes were captured via the N-terminal FLAG epitope on anti-FLAG M2 magnetic beads. After intense washing, bound phagemid particles (together with the bound target protein) were competitively eluted with a 200 g/mL solution of the FLAG peptide. Eluted phagemids were amplified in E. coli XL1-Blue cells and used for three successive panning cycles under the same conditions. After the fourth selection round, the pool of enriched phagemids was amplified and phasmid DNA was isolated. The BstXI-flanked central lipocalin gene cassette encoding the mutagenized binding site was subcloned on the expression vector pNGAL98 (Gebauer, M. & Skerra, A. [2012] Meth. Enzymol. 503:157-188) which allowed the production of soluble Anticalin in the periplasm of E. coli TG1-F.sup..
[0215] Individual colonies were used for micro-scale expression in a 96-well plate and crude E. coli lysates from these cultures were screened in an ELISA for Anticalins having PSMA-binding activity. To this end, MaxiSorp plates coated with glycosylated rhPSMA were used as a target, whereas ovalbumin-coated wells were used as negative control to assess non-specific binding. Bound Anticalins were detected via the C-terminal Strep-tag II. While the first phage display selection campaign, conducted with the fully glycosylated Avi-PSMA produced in insect cells, did not yield any useful Anticalin candidates, the second attempt with the two SF-PSMA preparations was clearly successful. In total, of 172 clones that were screened 39 (approximately 23%; 32 from the selection against partially-deglycosylated SF-GCPII, 7 from the selection against fully glycosylated SF-GCPII) gave rise to a positive signal in the ELISA.
[0216] Sequencing of these clones revealed 6 unique Anticalin candidates, of which two (denoted A2 (SEQ ID NOs:69 and 74) and A3 (SEQ ID NOs:1 and 44)) were selected against the partially deglycosylated target and four (G4 (SEQ ID NOs:68 and 73), G6 (SEQ ID NOs:67 and 72), H3 (SEQ ID NOs:66 and 71), and H5 (SEQ ID NOs:65 and 70)) were selected against the fully glycosylated target. These variants were individually produced in 5 L shake flask cultures and purified from the periplasmic cell fraction of E. coli via the C-terminal Strep-tag II and SEC. The average yield of these engineered lipocalins was in the range of 0.3-0.8 mg/L. Purity and oligomerization status were assayed by SDS-PAGE and analytical SEC, respectively, indicating that all selected variants were homogenous and monomeric with an apparent molecular weight of approximately 21 kDa, as expected (
EXAMPLE 4: BIOCHEMICAL CHARACTERIZATION AND AFFINITY MATURATION OF ANTICALINS
[0217] Specific binding activities of selected Anticalins toward rhPSMA as well as apparent affinity constants were initially determined by ELISA in 96-well Maxisorp plates coated with the recombinant wild-type PSMA protein. Anticalins were applied in a dilution series and detected via the C-terminal Strep-tag II. Five of the six analyzed Anticalin candidates specifically recognized PSMA with apparent dissociation constants (K.sub.0 values) ranging from 6 to 42 nM, for A3 and H3, respectively (
[0218] The most promising variant, A3, which showed highest affinity, highest signal amplitude and low non-specific binding, was chosen for an in vitro affinity maturation using error-prone PCR (see Example 1). First, the PCR was optimized with regard to the number of amplification cycles and template amount, aiming at the introduction of 3 to 6 nucleotide mutations per Anticalin gene cassette. Then, the mutated PCR fragment was subcloned via two unique and mutually non-compatible BstXI sites on the plasmid pNGAL108, which is suitable for the production of lipocalin variants in fusion with the phage minor coat protein pIII. Transformation of electrocompetent XL1-Blue cells yielded a phagemid library with a complexity of 10.sup.8-10.sup.9 clones and phagemid particles were produced according to published procedures (Gebauer, M. et al. [2013] J. Mol. Biol. 425:780-802).
[0219] During the panning procedure, a modified setup with higher stringency was used to select for improved PSMA affinity as well as slower dissociation. To this end, a lower target concentration of 10 nM (for the first two rounds) and 1 nM (rounds 3 and 4) of Avi-PSMA was immobilized on paramagnetic beads coated with either streptavidin (rounds 1 and 3) or neutravidin (rounds 2 and 4). In this experiment the biotin-binding reagents were systematically altered to avoid selection of cognate binders. To further increase the selection pressure and avoid rebinding of dissociated phagemids, 100 nM rhPSMA was added as competitor to the first washing solution and incubated with the beads for 30 min at room temperature. After several additional washing steps with buffer, remaining bound phagemids were eluted using 100 mM glycine/HCl, pH 2.2. These phagemids were amplified, screened in an ELISA as described above, and sequenced. In total, 12 of 92 clones screened by the ELISA exhibited significantly higher signals in comparison with the original A3 clone. Among those, DNA sequencing revealed eight new clones. These were expressed at the shake flask scale, purified and their affinities for rhPSMA were determined by ELISA (
[0220] To test further mutations, bacterial surface display mediated by the E. coli autotransporter EspP was applied, a technique previously developed for the affinity maturation of Anticalins (Binder, U. et al. [2010] J. Mol. Biol. 400:783-802). To this end, the central coding region for A3A5 was subjected to another error-prone PCR as described above and subcloned on a vector that allows secretion of a fusion with the -barrel domain of EspP and insertion into the outer membrane as well as presentation on the surface of the Gram-negative bacterium. Following incubation with Avi-PSMA and washing, cells with bound target protein were stained with a streptavidin/phycoerythrin conjugate and enriched by fluorescence activated cell sorting (FACS). In this case, a long incubation step in the presence of an excess of the purified soluble A3A5 Anticalin, prior to washing and sorting, was used for competition and selection on slow dissociation. After four FACS cycles, two mutated Anticalin candidates were identified that showed clearly enhanced signals in single clone FACS analysis for PSMA binding: A3A5.1 and A3A5.7 (cf.
EXAMPLE 5: REAL-TIME AFFINITY MEASUREMENTS AND ANTICALIN-MEDIATED DETECTION OF CELLULAR PSMA
[0221] To precisely determine kinetic and thermodynamic binding constants of the PSMA-specific Anticalin A3 and its variants, surface plasmon resonance (SPR) real-time analyses was performed on a BIAcore 2000 instrument. To this end, rhPSMA was chemically coupled to the carboxymethyl dextran matrix of a sensorchip using amine chemistry and a concentrations series of each Anticalin was applied. As result, the initial Anticalin A3 exhibited a K.sub.D value of 4.8 nM whereas the first mutant resulting from affinity maturation, A3A5, was two-fold improved to 2.5 nM (Table 1). These results closely match the affinities of 5.8 and 2.1 nM, respectively that were previously determined by ELISA. Further enhanced affinities were detected by SPR for A3A5.1 and A3A5.7, with K.sub.ID values of 660 and 540 M, respectively. R9
TABLE-US-00004 TABLE 1 k.sub.on, k.sub.off and K.sub.D values of the different PSMA-specific binding proteins Lipocalin variant k.sub.on [10.sup.5 M.sup.1 .Math. s.sup.1] k.sub.off [10.sup.4 s.sup.1] K.sub.D SE [nM] A3 1.2 5.8 4.8 0.010 A3A5 0.71 1.7 2.5 0.0067 A3A5.1 2.1 1.4 0.66 0.0007 A3A5.7 2.7 1.4 0.54 0.0005
[0222] To determine the capability of selected Anticalins to detect PSMA in its native cellular context both transfected HEK293T cells and human prostate carcinoma cell lines were employed. HEK293T stably transfected with a plasmid encoding full length wild-type PSMA were generated using jetPRIME transfection and Zeocin selection. In addition, the PSMA-positive and PSMA-negative prostate cancer cell lines LNCaP and PC-3, respectively, were employed. The presence/absence of human PSMA in these cell lines was confirmed by Western blotting using the mAb GCP04 that specifically recognizes PSMA (
[0223] For immunofluorescence microscopy, the different cell lines were fixed with paraformaldehyde on glass coverslips and permeabilized. Following a blocking step, cells were probed with the Anticalin A3A5, which was detected by a murine antibody (StrepMAB-Immo) recognizing the Strep-tag II and an Alexa Fluor 488-labeled anti-mouse secondary antibody. In this manner, PSMA was stained via the Anticalin both on the plasma membrane and in the cytoplasmic region of permeabilized PSMA-positive cells, but not in the case of PSMA-negative cells. Also, when wild-type Lcn2 was used instead of the Anticalin A3A5, no fluorescent staining was detected. The intensity of the signal observed with the Anticalin for the different PSMA-positive cells was proportional to the PSMA protein level as estimated by Western blotting (
[0224] Finally, flow cytometric analysis was used to assess binding of the Anticalin A3A5 to human PSMA expressed on the surface of live HEK293T/PSMA and LNCaP cells. Anticalin binding was again detected via indirect staining by a sandwich of StrepMAB-Immo and a secondary antibody labeled with Alexa Fluor 647. As seen from the flow cytometry histograms (
EXAMPLE 6: COMBINATION OF SEQUENCE VARIATIONS BETWEEN A3A5, A3A5.1 AND A3A5.7
[0225] Several combinations of mutations occurring in the PSMA-specific Lcn2 variants A3A5.1 (carrying 5 new mutations) and A3A5.7 (carrying 4 new mutations) were prepared in order to investigate the relevance of the mutations that were found during affinity maturation for improved PSMA binding with the aim to create a combined Anticalin variant suitable for further protein engineering studies. A first combination, containing solely the mutations located in the loop regions of the Anticalins, was carried out by introducing the following mutations into the sequence of A3A5 (see SEQ ID NO:2): (i) a Y at position 71 as also present in A3A5.1, (ii) an N at position 74 as also present in A3A5.7, (iii) a D at position 103 as also present in A3A5.1. This triple substitution variant, termed A3A5.8, was obtained by gene synthesis, cloned and subsequently expressed (as described in Example 1). A K.sub.D value of 1.4 nM was determined in BIAcore measurements (Table 2), which was almost 2-fold improved over the A3A5 variant but did not reach the subnanomolar affinity range as found for the variants A3A5.1 and A3A5.7. A further combination variant was constructed based on A3A5.8 by replacing the E at position 147 (as in A3A5) with a K as present in A3A5.1 as well as A3A5.7 using QuikChange mutagenesis with appropriate primers, resulting in the variant A3A5.9. Although this mutation is not situated in the Anticalin loops, its location within the structurally important -helix that packs against the -barrel may influence the protein structure in a way to increase PSMA binding. After soluble protein production and purification, the BIAcore measurements revealed a K.sub.D value of 740 M (Table 2), which is close to the high affinity of the variants A3A5.1 and A3A5.7 (cf. Table 1) while lacking the four amino acid exchanges at the bottom of the -barrel which are far away from the binding site in the loop region and less likely to be involved in PSMA binding by the Anticalin.
[0226] Generally, the introduction of these combinations of amino acid substitutions showed that variants maintain their binding properties toward PMSA when loops are modified with other mutations as exemplarily shown here for the variants A3A5.8 and A3A5.9.
TABLE-US-00005 TABLE 2 k.sub.on, k.sub.off and K.sub.D values of combinations of mutations in PSMA-specific binding proteins Lipocalin variant k.sub.on [10.sup.5 M.sup.1 .Math. s.sup.1] k.sub.off [10.sup.4 s.sup.1] K.sub.D SE [nM] A3A5.8 1.1 1.5 1.4 0.0011 A3A5.9 2.2 1.6 0.74 0.0009