COMPOSITIONS AND METHODS FOR IMPROVING VIRAL VECTOR EFFICIENCY
20180318447 ยท 2018-11-08
Inventors
Cpc classification
C12N2740/15041
CHEMISTRY; METALLURGY
C12N2750/14143
CHEMISTRY; METALLURGY
C07K2319/033
CHEMISTRY; METALLURGY
C12N15/87
CHEMISTRY; METALLURGY
A61K48/0016
HUMAN NECESSITIES
A61P7/00
HUMAN NECESSITIES
C12N2750/14141
CHEMISTRY; METALLURGY
A61P43/00
HUMAN NECESSITIES
C12N2740/15043
CHEMISTRY; METALLURGY
C07K2319/10
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
A61K48/00
HUMAN NECESSITIES
C12N15/87
CHEMISTRY; METALLURGY
Abstract
The present invention relates to peptides and compositions for use in improving transduction efficiency of viruses into target cells.
Claims
1. A peptide comprising: (i) a CPP moiety; and (ii) a Beclin-derived peptide moiety having a length of between 14 and 22 amino acid residues; with the proviso that said peptide is not the peptide shown in SEQ ID NO:75, SEQ ID NO:77 and SEQ ID NO:98-101.
2. The peptide according to claim 1, wherein the CPP moiety is: a peptide derived from the trans-activator of transcription (tat) peptide of the Human Immunodeficiency Virus (HIV) type-1; or a MAP peptide.
3. The peptide according to claim 1 or 2, wherein the CPP moiety is selected in the group consisting of SEQ ID NO:1 to SEQ ID NO:62, in particular from SEQ ID NO:1 to SEQ ID NO:5, more particularly wherein the CPP moiety is selected from SEQ ID NO:1 and SEQ ID NO:4.
4. The peptide according to any one of claims 1 to 3, wherein the Beclin-derived peptide moiety is a Beclin-1-derived peptide moiety, such as a sequence of Beclin-1 or a functional derivative of said sequence, that includes the 1 sheet region of Beclin-1, or a Beclin-2-derived moiety such as a Beclin-2-derived moiety comprising the amino acid sequence of SEQ ID NO:89 or a functional variant thereof.
5. The peptide according to claim 4, wherein the Beclin-1-derived peptide moiety comprises the amino acid sequence shown in SEQ ID NO:65 or a functional variant thereof.
6. The peptide according to claim 4 or 5, wherein the Beclin-1-derived peptide moiety comprises a sequence selected in the group consisting of SEQ ID NO:65 to 73.
7. The peptide according to any one of claims 1 to 6, wherein the CPP moiety and the Beclin-derived peptide moiety are linked together via a linker, such as a peptide linker, more particularly a dipeptide linker such as a GG dipeptide linker.
8. The peptide according to any one of claims 1 to 7, wherein the peptide comprises, or consists of, the sequence shown in any one of SEQ ID NO:74, SEQ ID 76, SEQ ID NO:78 to 83 and SEQ ID NO:90 to 91.
9. An in vitro method for promoting the transduction of a cell by a virus or viral vector, comprising contacting the cell with the virus and a peptide comprising: a cell-penetrating peptide (CPP) moiety; and a Beclin-derived peptide moiety.
10. The method of claim 9, wherein the virus is a retrovirus, in particular a lentivirus.
11. The method of claim 10, wherein the lentivirus is a pseudotyped lentivirus.
12. The method of claim 9, wherein the virus is a parvovirus, in particular an adeno-associated virus (AAV).
13. The method of any one of claims 9 to 12, wherein the cell is a hematopoietic stem/progenitor cell, preferably a hCD34+ cell.
14. The method according to any one of claims 9 to 13, further comprising contacting another viral transduction enhancer, such as vectofusin, human fibronectin fragments, various semen-derived enhancers of viral infection or peptides derived from HIV-1 envelope glycoproteins.
15. The method according to any one of claims 9 to 14, wherein the peptide is as defined in claims 1 to 8, or wherein the peptide comprises or consists of the sequence shown in SEQ ID NO:75, SEQ ID NO:77 and SEQ ID NO:98-101.
16. The method according to any one of claims 9 to 15, wherein the peptide is used at a concentration comprised between 0.01 and 20 M, such as between 2.5 and 20 M.
17. A peptide comprising: a cell-penetrating peptide (CPP) moiety; and a Beclin-derived peptide moiety; for use in a method for gene therapy in combination with a viral vector encoding a therapeutic gene.
18. The peptide for use according to claim 17, wherein the viral vector is a retrovirus, in particular a lentivirus.
19. The peptide for use according to claim 18, wherein the lentivirus is a pseudotyped lentivirus.
20. The peptide for use according to claim 17, wherein the viral vector is a parvovirus, in particular an adeno-associated virus (AAV).
21. The peptide for use according to any one of claims 17 to 20, further comprising contacting another viral transduction enhancer, such as vectofusin, human fibronectin fragments, various semen-derived enhancers of viral infection or peptides derived from HIV-1 envelope glycoproteins.
22. The peptide for use according to any one of claims 17-21, wherein the peptide is as defined in claims 1 to 8, or wherein the peptide comprises or consists of the sequence shown in SEQ ID NO:75, SEQ ID NO:77 and SEQ ID NO:98-101.
23. The peptide for use according to any one of claims 17-22, wherein the peptide is used at a concentration comprised between 0.01 and 20 M, such as between 2.5 and 20 M.
24. A complex of a virus or viral vector with a peptide comprising: a cell-penetrating peptide (CPP) moiety; and a Beclin-derived peptide moiety.
25. A mixture of a virus or viral vector with a peptide comprising: a cell-penetrating peptide (CPP) moiety; and a Beclin-derived peptide moiety.
26. The complex according to claim 24 or the mixture according to claim 25, wherein the viral vector is a retrovirus, in particular a lentivirus.
27. The complex or the mixture according to claim 26, wherein the lentivirus is a pseudotyped lentivirus.
28. The complex or the mixture according to claim 26, wherein the viral vector is a parvovirus, in particular an adeno-associated virus (AAV).
29. The complex or the mixture according to any one of claims 24 to 28, wherein the peptide is as defined in claims 1 to 8, or wherein the peptide comprises or consists of the sequence shown in SEQ ID NO:75, SEQ ID NO:77 and SEQ ID NO:98-101.
30. A nucleic acid construct comprising a polynucleotide encoding the peptide of claims 1-8.
31. The nucleic acid construct of claim 26, further comprising one or more control sequence(s).
32. A kit comprising the peptide according to claims 1 to 8 or comprising a peptide comprising or consisting of the amino acid sequence shown in SEQ ID NO:75 and SEQ ID NO:77, and a viral vector.
33. The kit of claim 32, wherein the viral vector is a retrovirus, in particular a lentivirus.
34. The kit of claim 33, wherein the lentivirus is a pseudotyped lentivirus.
35. The kit of claim 32, wherein the viral vector is a parvovirus, in particular an adeno-associated virus (AAV).
36. An in vitro method for increasing the sensitivity of a cell-based assay for detecting the presence or absence of a virus in a sample, comprising contacting the sample, or an extract from the sample, with a cell and a peptide, wherein said peptide comprises: a cell-penetrating peptide (CPP) moiety; and a Beclin-derived peptide moiety; the method further optionally comprising determining the level of a virus within the cell and/or in the cell culture medium.
37. The method according to claim 32, wherein the peptide is as defined in claims 1 to 8, or wherein the peptide comprises or consists of the sequence shown in SEQ ID NO:75 and SEQ ID NO:77.
Description
LEGENDS OF THE FIGURES
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
DETAILED DESCRIPTION
[0028] The present invention relates to non-naturally occurring, synthetic peptides comprising, or consisting of: [0029] (i) a CPP moiety; and [0030] (ii) a Beclin-derived peptide moiety.
[0031] Both moieties are covalently bound, optionally via an amino acid or non-amino acid linker. In addition, according to the present invention, the peptide may comprise both moieties in any orientation (such as, from the N-terminal to the C-terminal ends: CPP moietyBeclin-derived moiety; or Beclin-derived moietyCPP moiety)
Cell-Penetrating Peptide (CPP) Moiety
[0032] In the context of the present invention, the term cell-penetrating peptide or CPP refers to a peptide chain of variable length, without limitation and independently of the mechanism by which the peptide carries out its function, that is known or can be demonstrated to enhance or promote the transfer of a cargo (e.g. a peptide, a nucleic acid, a virus or any other cargo) from an extracellular compartment across a cell membrane such that the cargo is conveyed into a cell where it can effect at least one measurable biological response or function. CPPs may typically have an amino acid composition that either contains a high relative abundance of positively charged amino acids such as lysine or arginine or may have sequences that contain an alternating pattern of polar/charged amino acid and non-polar, hydrophobic amino acids.
[0033] Accordingly, in a particular embodiment of the present invention, the CPP moiety consists of an amino acid sequence having from 5 to 50 amino acid residues, in particular from 10 to 20 amino acid residues. In a further particular embodiment, the CPP moiety has an amino acid sequence comprising positively charged residues such as lysine and arginine residues. In another embodiment, the CPP moiety has an amino acid sequence alternating positively charged residues such as lysine or arginine residues, and non-polar, hydrophobic residues such as alanine and leucine residues.
[0034] The CPP moiety may be derived from naturally-occurring proteins which are able to translocate across cell membranes such as the Drosophila homeobox protein Antennapedia (a transcriptional factor), viral proteins such as the HIV-1 transcriptional factor TAT and the capsid protein VP22 from HSV-1, and/or they may be synthetically-derived, e.g. from chimeric proteins or synthetic polypeptides such as polyarginine. A review on CPPs may be found in Milletti, 2012.
[0035] In a particular embodiment, the CPP moiety is a peptide derived from the trans-activator of transcription (tat) peptide of the Human Immunodeficiency Virus (HIV) type-1. In the context of the present invention, a peptide derived from the tat peptide is a tat fragment including an amino acid sequence having cell-penetration properties. In particular, the tat-derived peptide is a peptide comprising, or consisting of, amino acids 47-57 (SEQ ID NO:1), 48-60 (SEQ ID NO:2) or 49-57 (SEQ ID NO:3) of tat.
[0036] Other CPPs that may be used, without limitation, in the practice of the present invention include MAP- or antennapedia-derived peptides.
[0037] Table 1 lists various representative peptides which may be used.
TABLE-US-00001 TABLE1 listofCPPs CPP Sequence SEQID Tat(47-57) YGRKKRRQRRR SEQIDNO:1 Tat(48-60) GRKKRRQRRRPPQ SEQIDNO:2 Tat(49-57) RKKRRQRRR SEQIDNO:3 MAPpeptides KLALKLALKALKAALKA SEQIDNO:4 KLALKLALKALKAALKLA SEQIDNO:5 Antennapedia(or RQIKIWFQNRRMKWKK SEQIDNO:6 penetratin) Penetratinderivatives RRMKWKK SEQIDNO:7 NRRMKWKK SEQIDNO:8 QNRRMKWKK SEQIDNO:9 FQNRRMKWKK SEQIDNO:10 RREKWKK SEQIDNO:11 RRQKWKK SEQIDNO:12 KRMKWKK SEQIDNO:13 RKMKWKK SEQIDNO:14 RROKWKK SEQIDNO:15 RRMKQKK SEQIDNO:16 RRMKWFK SEQIDNO:17 RORKWKK SEQIDNO:18 RRMWKKK SEQIDNO:19 RRMKKWK SEQIDNO:20 WhereinO denotesornithine D-penetratin rqikiwfqnrrmkwkk SEQIDNO:21 Pegelin(SynB) RGGRLSYSRRRFSTSTGR SEQIDNO:22 VP22 DAATATRGRSAASRPTERPRAPARSASRPRRVD SEQIDNO:23 Transportan GWTLNSAGYLLGKINLKALAALAKKIL SEQIDNO:24 Transportan-10 AGYLLGKINLKALAALAKKIL SEQIDNO:25 KALA WEAKLAKALAKALAKHLAKALAKALKACEA SEQIDNO:26 Pep-1 KETWVVETWVVTEWSQPKKKRKV SEQIDNO:27 Pep-2 KETWFETWFTEWSQPKKKRKV SEQIDNO:28 MPG GALFLGFLGAAGSTMGAWSQPKSKRKV SEQIDNO:29 Vectocellpeptides VKRGLKLRHVRPRVTRMDV SEQIDNO:30 SRRARRSPRHLGSG SEQIDNO:31 LRRERQSRLRRERQSR SEQIDNO:32 GAYDLRRRERQSRLRRRERQSR SEQIDNO:33 Wr-Ttransporter KETWVVETWVVTEWVVTEWSQGPGrrrrrrrrr SEQIDNO:34 r = Denantiomerarginine R7 RRRRRRR SEQIDNO:35 LAH4and KKALLALALHHLAHLALHLALALKKA SEQIDNO:36 LAH4derivatives KKALLAHALHLLALLALHLAHALKKA SEQIDNO:37 KKALLAHALHLLALLALHLAHALA SEQIDNO:38 RRALLAHALHLLALLALHLAHALRRA SEQIDNO:39 KKALLAHALAHLALLALHLALHLKKA SEQIDNO:40 KKALLALALHHLALLALHLAHALKKA SEQIDNO:41 KKALLALALHHLALLAHHLALALKKA SEQIDNO:42 KKALLHLALLHAALLAHHLALALKKA SEQIDNO:43 KKALLHLALLHAALLAHLAALHLKKA SEQIDNO:44 KKALLHLALLLAALHAHLAALHLKKA SEQIDNO:45 KKALLAHALHLLAALALHLAHLLKKA SEQIDNO:46 KKALLLAALHHLAALALHLAHLLKKA SEQIDNO:47 KKALLLAALHHLLALAHHLAALLKKA SEQIDNO:48 KKALLHAALAHLLALAHHLLALLKKA SEQIDNO:49 KKALLHALLAHLAALLHALLAHLKKA SEQIDNO:50 KKALLHALLAALLAHLHALLAHLKKA SEQIDNO:51 KALLHAALAHLLALAHHLLALLKKA SEQIDNO:52 KKKLLHAALAHLLALAHHLLALLKKA SEQIDNO:53 KKALLHAALAHLLALAHHLLALLA SEQIDNO:54 KKALLHAALAHLLALAHHLLALLKK SEQIDNO:55 KKLLHAALAHLLALAHHLLALLKK SEQIDNO:56 KKALLHAALAHLLALAHHLLALKK SEQIDNO:57 KKLHAALAHLLALAHHLLALLKK SEQIDNO:58 KKLHAALAHLLALAHHLLAKK SEQIDNO:59 KKALLHAALAHLLALAAALLALLKKA SEQIDNO:60 KKALLAAALAALLALAAALLALLKKA SEQIDNO:61 KKLLLHALLAHLLALLHHLLALLKKL SEQIDNO:62
[0038] In a particular embodiment, the CPP moiety comprises, or consists of, a peptide sequence selected from any of SEQ ID NO:1-62, or a variant thereof having at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90% or at least 95% sequence identity to any of SEQ ID NO:1-62 and retaining at least a part of its capacity to enhance the delivery of a cargo molecule into a cell.
[0039] In a particular embodiment, the CPP moiety is selected from the group consisting of SEQ ID NO:1 to SEQ ID NO:4, in particular from SEQ ID NO:1 and SEQ ID NO:4.
Beclin Peptide Moiety
[0040] In the context of the present invention, the Beclin-derived peptide moiety corresponds to an amino acid sequence derived from a Beclin protein.
[0041] In the context of the present invention, a functional variant or a derivative of a Beclin peptide is a peptide capable of improving transduction efficiency of a virus, when said functional variant or said derivative is fused to a CPP moiety. In particular, the functional variant is capable, when fused to a CPP moiety, of improving transduction efficiency of a virus by at least 10%, at least 20%, or at least 30% or more, preferably by at least 30%. More particularly, the functional variant is capable, when fused to a CPP moiety, of improving transduction efficiency of a HIV-1 derived lentiviral vector (LV) pseudotyped with envelope glycoproteins (GPs) from the vesicular stomatitis virus (VSV-G) by at least 10%, at least 20%, or at least 30% or more, preferably at least 30%. Even more particularly, the functional variant is capable, when fused to a CPP moiety, of improving transduction efficiency of hCD34+ cells by a HIV-1 derived lentiviral vector (LV) pseudotyped with envelope glycoproteins (GPs) from the vesicular stomatitis virus (VSV-G) by at least 10%, at least 20%, at least 30% or more. In a further particular embodiment, a functional variant of a Beclin peptide further has at least 50%, at least 60%, at least 70%, at least 75%, at least 80% and most particularly at least 83% sequence identity to the sequence of the parent Beclin peptide (i.e., from the peptide it derives from), such as from the Beclin peptide shown in SEQ ID NO:65 or 89. In a particular embodiment, the sequence of the Beclin-derived peptide moiety includes an amino acid sequence wherein addition, deletion or substitution of 1 to 6 amino acid residues has been made into the parent Beclin peptide, such as into the sequence shown in SEQ ID NO:65 or 89. In a particular aspect, the Beclin-derived peptide moiety is a Beclin-1 or Beclin-2 peptide moiety comprising 1, 2, 3, 4, 5 or 6 amino acid substitutions, such as 4, 5 or 6 amino acid substitutions in SEQ ID NO:65 or 89.
[0042] According to a particular embodiment, the Beclin-derived moiety length is comprised between 14 to 22 amino acid residues, such as from 16 to 20 amino acid residues in length, in particular a peptide consisting of 16, 17, 18, 19 or 20 amino acid residues in length. In a particular embodiment, the Beclin-derived moiety length is of 18 amino acid residues.
[0043] In a particular aspect, the Beclin-derived peptide moiety comprises or consists of the sequence of general formula (I):
TABLE-US-00002 (I) N1N2N3N4N5N6TFN9IN11N12N13GN15N16 N17N18
wherein:
N.sub.1 is a polar amino acid or is I, in particular T or I, and more particularly I;
N.sub.2 is a polar amino acid, in particular N, D or S, and more particularly N;
N.sub.3 is a hydrophobic amino acid or C, in particular V, C or I, and more particularly C;
N.sub.4 is a hydrophobic amino acid, in particular F or L, and more particularly F;
N.sub.5 is a polar amino acid, in particular N, T, S, R or Q, and more particularly T;
N.sub.6 is a hydrophobic amino acid, in particular A or V, and more particularly A;
N.sub.9 is a polar amino acid, in particular H, E or T, and more particularly E;
N.sub.11 is W, S, G or R, in particular W;
N.sub.12 is a polar amino acid or is V, in particular H, V, D, Q or E, and more particularly V;
N.sub.13 is a polar amino acid or is A, in particular S, E, D, A, and more particularly E;
N.sub.15 is Q, P, S or E, in particular P;
N.sub.16 is a hydrophobic amino acid, in particular F, L, V or I, and more particularly L;
N.sub.17 is a hydrophobic amino acid, in particular G, A or P, and more particularly G;
N.sub.18 is T, V or I, in particular V.
[0044] In another particular aspect, the Beclin-derived peptide moiety comprises or consists of the sequence of general formula (II):
TABLE-US-00003 (II) N1N2N3FN5N6TFN9IN11N12N13GN15N16 N17N18
wherein:
N.sub.1 is a polar amino acid or is I, in particular T or I, and more particularly I;
N.sub.2 is a polar amino acid, in particular N, D or S, and more particularly N;
N.sub.3 is a hydrophobic amino acid, in particular V, C or I, and more particularly C;
N.sub.5 is a polar amino acid, in particular N, T, S, R or Q, and more particularly T;
N.sub.6 is a hydrophobic amino acid, in particular A or V, and more particularly A;
N.sub.9 is a polar amino acid, in particular E or T, and more particularly E;
N.sub.11 is W, S, G or R, in particular W;
N.sub.12 is a polar amino acid or is V, in particular H, V, D, Q or E, and more particularly V;
N.sub.13 is a polar amino acid or is A, in particular S, E, D, A, and more particularly E;
N.sub.15 is P or S, in particular P;
N.sub.16 is a hydrophobic amino acid, preferably L, V or I, and more particularly L;
N.sub.17 is a hydrophobic amino acid, preferably G, A or P, and more particularly G;
N.sub.18 is a hydrophobic amino acid, in particular V or I, and more particularly V.
[0045] The term polar amino acid refers to amino acids comprising hydrophilic side-chains that prefer to reside in an aqueous (i.e. water) environment. These side chains can thus be involved in hydrogen bonding interactions. The term polar amino acid comprises polar charged amino acids such as D, E, K, R, H and polar uncharged amino acids such as S, T, Y, C, N, and Q.
[0046] The term hydrophobic amino acid refers to amino acids comprising non-polar side chains that are uncharged at physiological pH. Hydrophobic side chains are chemically unreactive and tend to aggregate rather than be exposed to the aqueous environment. The term hydrophobic amino acid comprises G, A, L, I, V, P, F, W, and M.
[0047] As used herein, amino acids are sometimes specified using the standard one letter code: Alanine (A), Serine (S), Threonine (T), Aspartic acid (D), Glutamic acid (E) Asparagine (N), Glutamine (Q), Arginine (R), Lysine (K), Isoleucine (I), Leucine (L), Methionine (M), Valine (V), Phenylalanine (F), Tyrosine (Y), Tryptophan (W), Proline (P), Glycine (G), Histidine (H), Cysteine (C). Synthetic and non-naturally occurring amino acid analogues (and/or peptide linkages) are included.
[0048] In a particular embodiment, the Beclin-derived moiety is derived from a human Beclin protein, such as the human Beclin-1 protein shown in SEQ ID NO:63 or the human Beclin-2 protein shown in SEQ ID NO:64:
TABLE-US-00004 SEQIDNO:63: MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTA QAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLI GEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDT QLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELED VEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSV ENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW NEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELP LYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEK GKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK SEQIDNO:64: MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTR EVTDAEEQQDGASSRSPPGDGSVSKGHANIFTLLGELGAMHMLSSIQKAA GDIFDIVSGQAVVDHPLCEECTDSLLEQLDIQLALTEADSQNYQRCLETG ELATSEDEAAALRAELRDLELEEARLVQELEDVDRNNARAAADLQAAQAE AAELDQQERQHYRDYSALKRQQLELLDQLGNVENQLQYARVQRDRLKEIN CFTATFEIWVEGPLGVINNFRLGRLPTVRVGWNEINTAWGQAALLLLTLA NTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRA MVAFLDCMQQFKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTH LNTQELWTKALKFMLINFKWSLIWVASRYQK
[0049] In a particular embodiment, the Beclin-2-derived peptide moiety includes the amino acids 249 to 266 in SEQ ID NO:64 (underlined sequence: INCFTATFEIWVEGPLGV referred as SEQ ID NO:89). In a particular embodiment, the Beclin-2-derived peptide moiety comprises, or consists of, the sequence shown in SEQ ID NO:89, or comprises, or consists of, a sequence corresponding to a functional variant thereof as defined above. In a particular embodiment, the functional variant of the Beclin-2-derived peptide has phenylalanine residues at its positions corresponding to amino acids 252 and 256 of SEQ ID NO:64.
[0050] In a particular embodiment, the Beclin-2-derived peptide moiety or the functional variant thereof is derived from Beclin-2 of any species, including without limitations human, mouse, rabbit, pig, horse, panda or cow Beclin-2. The following Table 2 corresponds to the alignment of amino acids from 249 to 266 of human Beclin-2 sequence and corresponding sequences in mouse, rabbit, pig, horse, panda and cow.
TABLE-US-00005 TABLE2 AlignmentofBeclin-2sequences HumanBeclin-2(249-266) INCFTATFEIWVEGPLGV SEQIDNO:89 MouseBeclin-2(262-279) TNIFNATFTISDEGPLGV SEQIDNO:92 HorseBeclin-2(253-270) INVFSVTFEIGHSGPVGV SEQIDNO:93 PandaBeclin-2(645-662) TNVFNATFEIRHDGPVGI SEQIDNO:94 PigBeclin-2(244-261) TNVFRATFEIRHAGPIAI SEQIDNO:95 CowBeclin-2(248-265) TDVFNATFEIVVQDGPLPV SEQIDNO:96 RabbitBeclin-2(238-255) TSIFQVTFEIREEGSVGI SEQIDNO:97
[0051] In a particular embodiment, the Beclin-derived peptide derives from a Beclin-2 peptide selected in the group consisting of the sequences of Table 2.
[0052] In a particular embodiment, the Beclin-1-derived peptide moiety includes the 1 sheet of Beclin-1, or a functional variant of the 1 sheet of Beclin-1, which is located from amino acids 274 to 279 in SEQ ID NO:63. In a further particular embodiment, the Beclin-1 derived peptide moiety includes the L1 loop and the 1 sheet of Beclin-1. In another embodiment, the Beclin-1 derived peptide moiety includes at least a C-terminal part or all of amino acids 250-262 of SEQ ID NO:63 (corresponding to the al helix of Beclin-1), the L1 loop and the 1 sheet of Beclin-1. The sequence which is underlined in SEQ ID NO:63 is referred to as SEQ ID NO:65 in the following description (SEQ ID NO:65: TNVFNATFHIWHSGQFGT). It corresponds to a fragment of the evolutionary conserved domain (ECD.sub.267-284) of Beclin-1. In a particular embodiment, the Beclin-1-derived peptide moiety comprises, or consists of, the sequence shown in SEQ ID NO:65, or comprises, or consists of, a sequence corresponding to a functional variant thereof as defined above. In a particular embodiment, the functional variant of the Beclin-1-derived peptide has phenylalanine residues at its positions corresponding to amino acids 270 and 274 of SEQ ID NO:63.
[0053] The Beclin-1-derived peptide shown in SEQ ID NO:66, which corresponds to SEQ ID NO:65 with substitutions at positions 9, 13 and 15 of SEQ ID NO:65 (corresponding to positions 275, 279 and 281 of SEQ ID NO:63) and phenylalanine residues maintained at the amino acid positions corresponding to positions 270 and 274 of SEQ ID NO:65, is an illustrative functional variant according to the present invention:
TABLE-US-00006 SEQIDNO:66 TNVFNATFEIWHDGEFGT
[0054] In a particular aspect, the Beclin-1-derived peptide moiety may comprise from 10 to 60 amino acids, in particular from 15 to 55, in particular 18 to 50, in particular 18 to 49 amino acids (such as 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48 and 49 amino acids), in particular from 18 to 35 amino acids, more particularly from 18 to 33 amino acids (such as 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32 and 33 amino acids).
[0055] In a particular embodiment, the Beclin-1-derived peptide moiety comprises amino acids 270-282, in particular amino acids 267-284 of SEQ ID NO:63 (i.e. SEQ ID NO:65), or a variant thereof as described above, and at least one or more amino acids of the Beclin-1 protein contiguous to amino acids 267-284 on either ends, or both. For example, the Beclin-1-derived peptide moiety may in particular further comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 or 17 amino acids contiguous to amino acids 267-284 in SEQ ID NO:63, in addition to the sequence shown in SEQ ID NO:65. For example, the Beclin-1-derived moiety may further include amino acids 250-266 or 256-266. It may also include, either alternatively or in addition to the amino acids mentioned in the preceding sentence, amino acids 285-296 or 285-298 of SEQ ID NO:63, in addition to the sequence of SEQ ID NO:65 or to a functional variant thereof such as SEQ ID NO:66. Furthermore, the present invention also envisions functional variants of SEQ ID NO:65 that include a part of said sequence shown in SEQ ID NO:65, such as a functional variant including amino acids 268-284, 269-284, 270-284, 267-283 or 267-282 of SEQ ID NO:63. Additionally, the functional variant may be a variant of the sequence shown in SEQ ID NO:66, wherein 1, 2 or 3 amino acids are deleted from either their N-terminal or C-terminal end, or from both ends.
[0056] Illustrative functional variants of the Beclin-1 peptide according to the invention include:
TABLE-US-00007 FNATFEIWHDGEFGT SEQIDNO:67 TNVFNATFEIVVHDGEF SEQIDNO:68 YAQTQLDKLKKTNVFNATFEIWHDGEFGT SEQIDNO:69 TNVFNATFEIVVHDGEFGTINNFRLGRLPSV SEQIDNO:70 VENQMRYAQTQLDKLKKTNVFNATFEIVVHDGEF SEQIDNO:71 FNATFEIWHDGEFGTINNFRLGRLPSVPV SEQIDNO:72 FEIVVHDGEFGTINNFRLGRLPSVPV SEQIDNO:73
Fusion Peptide
[0057] As mentioned above, the peptide of the invention comprises a CPP moiety and a Beclin-derived moiety covalently linked together and is therefore a fusion peptide.
[0058] Linkage of the two parts of the peptide may be done directly by a covalent bond, or via a linker moiety.
[0059] The peptide of SEQ ID NO:74 is an example of a direct linkage of the two peptide moieties, wherein the CPP moiety is the Tat sequence shown in SEQ ID NO:1, and the Beclin-derived peptide moiety consists of the amino acid sequence shown in SEQ ID NO:66 fused to amino acids 285-296 of SEQ ID NO:63:
TABLE-US-00008 SEQIDNO:74 YGRKKRRQRRRTNVFNATFEIWHDGEFGTINNFRLGRLPSV
[0060] The peptide of SEQ ID NO:90 is an example of a direct linkage of the two peptide moieties, wherein the CPP moiety is the Tat sequence shown in SEQ ID NO:1, and the Beclin-derived peptide moiety consists of the amino acid sequence shown in SEQ ID NO:89:
TABLE-US-00009 SEQIDNO:90 YGRKKRRQRRRINCFTATFEIWVEGPLGV
[0061] In a particular embodiment, the peptide comprises a linker. The linker may be a peptide comprising from 1 to 25 amino acids, in particular from 1 to 5 amino acids. In a particular embodiment, the linker is a single neutral (i.e. neutral at physiological pH) amino acid such as a G, A, V, S, Y or T, in particular G. Alternatively, the linker may be a dipeptide of neutral amino acids such as a dipeptide selected from GG, AA, GA, AG, AS, AY, GS, GT, GV, AV, SV, TV, VG, VA and VT.
[0062] In another particular embodiment, the linker is a non-peptidic linker such as a (CH.sub.2).sub.n linker, wherein n is an integer comprised between 1 and 6.
[0063] From the N-terminal end to the C-terminal end, the peptide of the invention may comprise, in this order: [0064] a CPP moiety and a Beclin-derived moiety, optionally linked via a linker as described above; or [0065] a Beclin-derived moiety and a CPP moiety, optionally linked via a linker as described above.
[0066] In a particular embodiment, the peptide of the invention comprises, from its N-terminal end to its C-terminal end, a CPP moiety and a Beclin-derived moiety, optionally linked via a linker as described above. In a further particular embodiment, the peptide of the invention comprises, in this order, a CPP moiety, a linker (in particular a dipeptide linker such as a GG dipeptide) and a Beclin-derived moiety.
[0067] In another particular embodiment, the peptide of the invention comprises, from its N-terminal end to its C-terminal end, a Beclin-derived moiety and a CPP moiety, optionally linked via a linker as described above. In a further particular embodiment, the peptide of the invention comprises, in this order, a Beclin-derived moiety, a linker (in particular a dipeptide linker such as a GG dipeptide) and a CPP moiety.
[0068] In a particular embodiment, the peptide of the invention is a fusion peptide comprising, in this order, (i) a CPP moiety which is a Tat sequence (e.g. one of the sequences shown in SEQ ID NO:1, 2 and 3, and in particular the sequence shown in SEQ ID NO:1) or a MAP sequence (e.g. SEQ ID NO:4 or 5), (ii) a dipeptide linker such as the GG dipeptide, and (iii) a Beclin-derived moiety of formula (I) or (II), such as a Beclin-1-derived moiety such as one of SEQ ID NO:65-73 or a Beclin-2-derived moiety such as SEQ ID NO:89. In particular, the peptide implemented in the invention is the peptide shown in SEQ ID NO: 75: YGRKKRRQRRR GG TNVFNATFEIWHDGEFGT; SEQ ID NO: 76: KLALKLALKALKAALKA G TNVFNATFEIWHDGEFGT; SEQ ID NO: 77: YGRKKRRQRRR GG TNVFNATFHIWHSGQFGT; SEQ ID NO: 78: YGRKKRRQRRR GG YAQTQLDKLKKTNVFNATFEIWHDGEFGT; SEQ ID NO: 79: YGRKKRRQRRR GG TNVFNATFEIWHDGEFGTINNFRLGRLPSV; SEQ ID NO: 80: YGRKKRRQRRR GG TNVFNATFHIWHSGQFGTINNFRLGRLPSV; SEQ ID NO: 81: YGRKKRRQRRR GG VENQMRYAQTQLDKLKKTNVFNATFEIWHDGEF; SEQ ID NO: 82: YGRKKRRQRRR GG FEIWHDGEFGTINNFRLGRLPSVPV; SEQ ID NO: 83: YGRKKRRQRRR GG FNATFEIWHDGEFGTINNFRLGRLPSVPV; or SEQ ID NO:91: YGRKKRRQRRR GG INCFTATFEIWVEGPLGV.
[0069] According to a particular embodiment, the invention also encompasses retro, inverso or retro-inverso derivatives of the peptides defined above, which retain the transduction promoting properties herein disclosed. In a particular embodiment, the invention relates to a retro-inverso derivative of the peptides as defined above. In particular, retro-inverso derivatives of the peptides of the invention are suitable for in vivo uses since they are more resistant to proteolytic degradation. The peptides may comprise at least one D amino acid as well as iminoamino acids and rare amino acids. The invention also relates to peptide mimetics of the peptides according to the invention. These can be characterized for example by a modification of one or more peptide bonds, for example, by a reverse peptide bond or by an ester bond. The invention also includes derivatives of the peptides described above, comprising amino acids different than alpha-amino acids, such as beta or gamma-amino acids.
Uses of the Fusion Peptide
[0070] The peptides of the invention promote viral infection of a cell. As used herein, viruses relates to natural occurring viruses as well as artificial viruses. For example, paramyxovirus (such as respiratory syncytial virus, measle virus), orthomyxovirus (such as influenza virus), flavivirus (such as hepatitis C virus), hepadnavirus (such as hepatitis B virus), rhabdovirus (such as rabies, VSV), coronavirus (such as SARS), togavirus (such as Sindbis virus, Chikungunya virus), filovirus (such as ebola virus), arenavirus, poxvirus, herpesvirus, bunyavirus, bornavirus, arterivirus, baculovirus, parvovirus such as adeno-associated virus. According to a particular embodiment, the viruses are artificial viruses, which may for instance comprise a cargo, such as a cargo useful for a therapeutic, diagnostic or any other purpose (e.g. useful for conducting functional studies within a target cell). Illustrative cargos include nucleic acid cargos such as a DNA or RNA sequence encoding a product, in particular a gene therapy product (for example a protein or RNA, such as an antisense RNA or a shRNA) or a diagnostic product. Furthermore, according to the present invention, the virus may be a virus-like particle (or VLP) which may further contain a cargo such as a protein cargo, a nucleic acid cargo (such as a DNA or RNA cargo), a diagnostic cargo or a drug cargo. In the context of the present invention, a virus is either an enveloped or non-enveloped virus. Parvoviruses such as adeno-associated viruses (or AAVs) are illustrative non-enveloped viruses. In a preferred embodiment, the viruses are enveloped viruses. In preferred embodiments, the viruses are retroviruses and in particular lentiviruses. The inventors have shown that peptides of the present invention can promote the infection of eukaryotic cells with HIV-1 derived lentiviral vectors (LVs) pseudotyped with envelope glycoproteins (GPs) from the vesicular stomatitis virus (VSV-G), the modified feline endogenous retrovirus (RD114TR), and the modified gibbon ape leukemia virus (GALVTR). The inventors have even shown that the peptides of the invention efficiently promote entry of other viruses such as parvoviruses, including adeno-associated viruses, thereby demonstrating their broad efficiency. In view of the efficiency of the transduction obtained with the peptides of the invention and the diversity of the viral vectors and GPs used in the disclosed experiments, it is clear that the present peptides can be used as a general means for increasing transduction efficiencies of enveloped and non-enveloped viruses in eukaryotic cells. Therefore, it is also expected that the peptides of the invention may promote infection of eukaryotic cells with a number of other viruses or other pseudotyped viruses, such as lentiviruses pseudotyped with various envelope glycoproteins (Levy, 2015), for instance the amphotrophic murine leukemia virus GP (A-MLV) or the modified baboon endogenous virus GP (BaEVTR) or with non-enveloped viruses such as parvoviruses, in particular AAVs such as a recombinant AAV vector.
[0071] The target cells can be any kind of eukaryotic cells such as mammalian cells, in particular human, mouse, rat, monkey, dog or hamster cells. In a particular embodiment, the target cell is a CD34+ cell, in particular a CD34+ cell collected from a patient in need of a gene therapy of his/her hematopoietic lineage. Other representative, non-limiting, target tissues/cells are skin, muscle, liver, eye, neurons, lymphocytes, fibroblasts, keratinocytes, adipocytes, myoblasts, hepatocytes, tumor cells and more generally any eukaryotic cell that is known or will be identified as a target of a virus. The inventors show in the experimental part below that transduction of a wide variety of cells may be obtained thanks to the peptides of the invention, thereby demonstrating their broad efficiency and applicability.
[0072] In methods disclosed herein, the peptide of the invention is used in an effective amount. The term effective amount of the peptide herein denotes the amount required for increasing significantly the transduction efficiency of a viral vector. This effective amount will generally depend on the particular peptide tested, the target cell and the viral vector implemented. In particular, the effective amount is an amount of the peptide inducing an increase in the efficiency of transduction of a viral vector without inducing or increasing the autophagy process. This amount can be determined according to methods well known in the art, in particular according to the above method implementing a reporter assay and illustrated in the examples. For example, the inventors have surprisingly shown of the previously disclosed Tat-Beclin1 peptide (Shoji-Kawata et al., 2013) optimally promotes virus transduction of HCT116 cells or CD34+ cells with VSV-G-LV or GALVTR-LV at a concentration which is low, typically at a concentration comprised between 1 and 20 M, such as 2.5 and 20 M, depending on the cell type which is transduced. Moreover, the present inventors have shown that the Tat-Beclin-2 peptide is a potent enhancer of lentiviral transduction at even lower doses comprised between 0.01 M to about 10 M, in particular between 0.1 and 5 M. Typical concentration ranges for using the peptides of the invention include a concentration of between 0.01 M and 20 M, such as between 1 and 20 M, such as 2.5 and 20 M, in particular between 3 and 15 M, more particularly between 4 and 12 M, such as a concentration of 4, 5, 6, 7, 8, 9 or 10 M. In a particular embodiment, the peptide of the invention is used at a concentration of about 5 M or about 10 M.
[0073] In a particular embodiment, the peptide of the invention, in particular a Tat-Beclin-1 peptide, is used in an effective amount comprised between 0.01 M and 5 M, in particular between 1 M and 5 M.
[0074] According to a further aspect, the invention relates to a complex of a peptide of the invention with a virus particle, in particular non-enveloped (such as a parvovirus, for example an AAV vector) or an enveloped virus particle, more particularly with an enveloped viral vector for gene therapy. Moreover, another aspect of the invention relates to a method for preparing such a complex, which comprises mixing the peptide with a viral particle.
[0075] According to another aspect, the invention relates to a mixture of a peptide of the invention with a virus particle (in particular an enveloped virus particle or non-enveloped virus particle, more particularly with an enveloped viral vector for gene therapy) and with a cell. Moreover, another aspect of the invention relates to a method for preparing such mixture, which comprises mixing the peptide, with the viral particle and the cell.
[0076] The peptides according to the invention can be used in pharmaceutical compositions. Thus, the present invention relates to a composition comprising a peptide as defined above and a suitable pharmaceutically acceptable vehicle. The pharmaceutical compositions of the invention contain one or more of the peptides according to the invention, or a physiologically acceptable salt of the peptide(s). Pharmaceutical compositions according to the invention can also contain pharmaceutically usual auxiliary agents which contribute, for example, to the solubility, stability or sterility of the composition or increase the efficiency of uptake into the body.
[0077] An aspect of the invention also relates to a peptide as defined above, for use as a medicament. In a particular embodiment, the medicament is used for increasing the efficiency of a gene therapy viral vector (D'Costa et al., 2009).
[0078] The form and content of the pharmaceutical composition which contains the peptide(s) depends on the route of administration. Preferably, galenic formulations and application forms are selected in which the peptide(s) arrive(s) at the target site in a non-degraded condition. The medicament can be administered locally as injection, drops, spray, tablets, suppositories, cream, ointments, gel etc. It is possible to perform the administration as a bolus or repeatedly over a period of time.
[0079] The peptide, complex or pharmaceutical composition or medicament of the invention can be administered in vivo via a local or systemic route, for example by injecting it via the intramuscular, intravenous, intra-arterial, intra-peritoneal or intracranial route. The invention thus also relates to a method for gene therapy, comprising administering to a patient in need thereof a peptide, complex or pharmaceutical composition as described above. The method comprises also administering a virus vector for gene therapy before, after or together with the administration of the peptide of the invention. The virus or viral vector for use in gene therapy according to the present invention includes a therapeutic gene, as is well understood in the art.
[0080] According to one aspect, the peptide, complex or pharmaceutical composition or medicament is used in an ex vivo method for cell therapy. In this aspect, the peptide, complex, pharmaceutical composition or medicament is used for enhancing gene therapy viral vector entry into a cell collected from a patient, wherein said cell is intended to be genetically modified thanks to the gene therapy viral vector. In a particular embodiment, the cell is a hematopoietic stem/progenitor cell, such as a hCD34+ cell. The cell may be mixed with a peptide of the present invention and gene therapy viral vector in order to correct any defect detected in said cell. In particular, this ex vivo method is useful for intravenous injection in patients of genetically modified-hCD34+ cells following transduction with a mix of peptide and viral vectors such as HIV-1 derived lentiviral vectors, expressing a gene of interest encoding a product (for example a protein or a therapeutic RNA) useful for the treatment of a disease. For example, the therapeutic product may be the Wiskott-Aldrich Syndrome protein to correct the Wiskott Aldrich syndrome, the IL2 receptor gamma chain to correct the Severe Combined Immune Deficiency 1, the gp91phox protein to correct the Chronic Granulomatous Disease, the adenosine deaminase (ADA) to correct adenosine deaminase deficiency (or ADA-SCID), the -globin to correct thalassemias, the -globin or the -globin to correct sickle cell disease, the Fanconi anemia protein (such as FA-A) to correct Fanconi anemia, the ATP-binding cassette protein to correct childhood cerebral adreno-leukodystrophy or the Arylsulfatase A to correct metachromatic leukodystrophy. Present invention may also be used for other ex vivo gene therapies, such as therapies based on chimeric antigen receptor (CAR)-T cell. In a particular aspect, the invention also relates to a composition comprising a peptide as described above in a culture medium, said composition being intended for use as an infection promoting reagent for facilitating the transduction of a cell with a virus or viral vector, in particular a non-enveloped or enveloped virus or viral vector. Thus, the invention also relates to a virus infection promoting reagent comprising a peptide according to the present invention, in a suitable medium, in particular in a suitable culture medium.
[0081] According to another aspect, the invention also relates to an isolated polynucleotide encoding the peptide of the invention. The polynucleotide of the invention may comprise different nucleotide chemistries, such as DNA, RNA or chemically modified nucleotides.
[0082] In another aspect, the invention relates to a nucleic acid construct comprising the polynucleotide operationally linked to at least one control sequence that directs the production for the peptide in an expression host. The term operably linked denotes herein a configuration in which a control sequence is placed at an appropriate position relative to the coding sequence of the polynucleotide sequence such that the control sequence directs the expression of the coding sequence of a peptide of the invention. A nucleic acid construct in the context of the present invention is a nucleic acid molecule, either single- or double-stranded, which is isolated from a naturally occurring gene or which is modified to contain segments of nucleic acids in a manner that would not otherwise exist in nature or which is synthetic. The term nucleic acid construct is synonymous with the term expression cassette when the nucleic acid construct contains the control sequences required for expression of a peptide coding sequence of the present invention. According to the present invention, control sequences include all components necessary for the expression of a polynucleotide encoding a peptide of the present invention. Each control sequence may be native or foreign to the nucleotide sequence encoding the polypeptide or native or foreign to each other. Such control sequences include, but are not limited to, a leader, polyadenylation sequence, pro-peptide sequence, promoter, signal peptide sequence, and transcription terminator. At a minimum, the control sequences include a promoter, and transcriptional and translational stop signals. The control sequences may be provided with linkers for the purpose of introducing specific restriction sites facilitating ligation of the control sequences with the coding region of the nucleotide sequence encoding a polypeptide.
[0083] In yet another aspect, the invention relates to a recombinant expression vector comprising the nucleic acid construct. Illustrative recombinant expression vectors include, for example, plasmids, cosmids and viral vectors.
[0084] In another aspect, the invention relates to a recombinant host cell comprising the nucleic acid or the recombinant expression vector. The host cell may be a prokaryotic cell (such as an Escherichia Coli cell) or an eukaryotic cell.
[0085] In another aspect, the invention relates to a method for the production of a peptide according to the invention, comprising the steps of (i) cultivating a host cell comprising the nucleic acid construct of the invention under conditions conductive for production of the peptide; and (ii) recovering the peptide. Alternatively, the peptide of the invention may be produced by in vitro synthesis, using conventional methods as known in the art. Various commercial synthetic apparatuses are available, for example automated synthesizers by Applied Biosystems Inc., Beckman, etc. An illustrative in vitro synthesis is presented below in the experimental part, wherein the peptides are produced by standard fluorenylmethyloxy-carbonyl chloride solid-phase peptide synthesis, purified by preparative reverse phase HPLC, and analyzed by HPLC and mass spectrometry. By using synthesizers, naturally occurring amino acids may be substituted with unnatural amino acids, particularly D-isomers (or D-forms) e.g. D-alanine and D-isoleucine, diastereoisomers, side chains having different lengths or functionalities, and the like. The particular sequence and the manner of preparation will be determined by convenience, economics, purity required, and the like.
[0086] The peptides described herein are used for a broad range of applications, such as therapeutic and diagnostic applications, and are valuable laboratory tools for the performance and study of entry of viruses into cells.
[0087] Accordingly, in one aspect the invention relates to a method, in particular an in vitro method, for promoting the transduction of a cell by a virus or viral vector, comprising contacting the cell with the virus and a peptide as defined above, comprising: [0088] a cell-penetrating peptide (CPP) moiety; and [0089] a Beclin-derived peptide moiety.
[0090] In a particular embodiment, the peptide is not the peptide shown in SEQ ID NO:75 and SEQ ID NO:77.
[0091] In a particular embodiment of this aspect, the method further comprises verifying the effective transduction, or the level of transduction, of the cell by the virus. Furthermore, according to this aspect, the peptide herein disclosed is used for improving the infection or transduction of a virus or of a viral vector of interest, which has many applications as described below.
[0092] A preferred embodiment of the invention is the use of the peptide of the invention as general enhancer of viral infection or transduction efficiencies for routine laboratory practice or gene therapeutic approaches based on viral vector systems. The peptides are enhancing the entry of vectors, such as those designed for gene therapy, diagnosis, or any other purpose (such as vectors used for functional studies) into cells in vitro, ex vivo or in vivo. The peptides may be administered in combination with a viral vector, such as a vector for gene therapy or diagnosis, and mediate entry of the viral vector into the target cell. The peptides are also useful in vitro because they promote the uptake of viruses into cells. They are thus useful as a tool for studying viruses and their mechanisms of action. Another embodiment of the invention is the use of the peptide of the invention for diagnostic approaches, especially those of viruses like HIV-1 and other enveloped viruses. Therefore, the present invention also relates to an in vitro method for increasing the sensitivity of a cell-based assay for detecting the presence or absence of a virus in a sample, comprising contacting the sample, or an extract from the sample, with a cell and a peptide as defined above, wherein said peptide comprises: [0093] a cell-penetrating peptide (CPP) moiety; and [0094] a Beclin-derived peptide moiety.
[0095] Following this contacting step, the cell is cultured in appropriate culture conditions. The detection of the presence or absence of a virus may then be carried out by any method known in the art, for example by determining the level of the virus in the cell and/or in the cell culture medium.
[0096] The peptide of the invention enhances the infectious titers of virus particles and therefore enhances their cellular uptake, allowing the detection of residual viral contaminations. Therefore, it can be used to isolate viral particles from samples like serum, blood, plasma, sperm or tissues derived from subjects, in particular a human subject suspected to be infected by a virus, more specifically by an enveloped virus. The peptides according to the invention can also be used to study viral particles from water, food (avian influenza, SARS) or any (enveloped or non-enveloped) virus used in bioterrorism. Successful virus isolation could be favored several times compared with routine diagnostic methods. Preferred methods are binding affinity assays and methods to remove viruses quantitatively from solutions suspected or known to comprise viruses in order to obtain safe solutions. In such methods, the peptides of the invention are preferably covalently bound to a support or a column.
[0097] The peptides of the invention can be used to enhance in general the entry of virus particles into target cells. The peptides can also be used as a general enhancer of the infection/transduction rate of viral particles, such as non-enveloped virus particles like parvoviruses such as AAV vectors, or of virus enveloped particles such as particles that carry foreign envelope glycoproteins (pseudoparticles) like VSV-G, GALVTR, RD114TR, etc. The above peptides of the invention promote the infection rates of all analyzed enveloped virus particles. This allows performing infection experiments, especially in primary cells, that have not been feasible before. The peptides of the invention are thus useful as laboratory tools in vitro.
[0098] The peptides of the invention can also be used to enhance gene delivery rates in ex vivo or in vivo gene therapy approaches based on vector systems, in particular on non-enveloped or enveloped vector systems. Accordingly, the invention also relates to a peptide as described above for use in gene therapy for promoting the infection of an eukaryotic cell by a virus or a viral vector in a subject in need thereof. The peptide of the invention can be used in combination with a virus or viral vector in gene therapy. In particular, the invention relates to a peptide of the invention, for use in a method for the treatment of a disease by gene therapy, wherein the peptide of the invention is used in combination with a virus or viral vector comprising in its genome an appropriate therapeutic transgene for the treatment of said disease. In a particular embodiment, the treatment is carried out by administering a virus or viral vector comprising one of the transgenes described above, for use in the treatment of the corresponding disease listed above. The peptide may be for the simultaneous, separate or sequential administration with the gene therapy vector. The generation of highly infectious viral vectors for gene therapy, especially for ex vivo gene therapy of stem cells, is a difficult procedure. In particular, the transduction efficiencies of viral vectors, such as retroviral vectors (e.g. lentiviral vectors) for stem cells are low. In the presence of a peptide of the invention, however, stem cells and cell lines can be efficiently transduced with viral vectors, resulting in higher efficiencies for gene delivery into the target cell compared to samples containing no peptide. Another advantage of the peptide of the invention is that it allows the use of viral batches with low (or lower than optimal) infectious titers or that it allows the use of less viral vectors than when no peptide of the invention is implemented.
[0099] In the in vitro and ex vivo methods of the present invention, the peptide can be used either with or without prior immobilization on a solid support. Advantageously, no immobilization is required for obtaining an increased transduction efficiency.
[0100] In a particular embodiment of the in vitro methods of the invention, another transduction improving means is used together with the peptide of the invention. For example, in a particular embodiment, transduction efficiency is increased with both a peptide according to the invention and another viral transduction enhancer, such as previously described viral transduction enhancers like Vectofusin-1 (KKALLHAALAHLLALAHHLLALLKKA-NH.sub.2: SEQ ID NO:84), human fibronectin fragments (e.g. Retronectin, which is commercially available, such as from Clontech), various semen-derived enhancers of viral infection (e.g. SEVI (GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY; SEQ ID NO:85), semenogelin 1 peptide SEM1(86-107) (DLNALHKTTKSQRHLGGSQQLL; SEQ ID NO:86)) or peptides derived from HIV-1 envelope glycoproteins (e.g. EF-C peptide (QCKIKQIINMWQ; SEQ ID NO:87), P16 peptide (Ac-NWFDITNWLWYIKKKK-NH2; SEQ ID NO:88)).
[0101] In another embodiment, the invention provides a kit comprising a peptide as defined above. The kit may further comprise and a virus or viral vector.
[0102] The invention is further described by means of the following examples.
Examples
Material and Methods
Peptide and Reagents
[0103] The Vectofusin-1, Tat-Scrambled, Tat-Beclin1 and its derivatives were produced by standard fluorenylmethyloxy-carbonyl chloride solid-phase peptide synthesis, purified by preparative reverse phase HPLC, and analyzed by HPLC and mass spectrometry (Genecust, Dudelange, Luxembourg). 7-amino-actinomycin D (7-AAD), polybrene, protamine sulfate and Triton X-100 were obtained from Sigma-Aldrich (St-Quentin-Fallavier, France).
Cell Line Culture
[0104] HCT116 cells derived from a human colorectal carcinoma (CCL-247; ATCC, Manassas, Va.) and human embryonic kidney HEK293T cells (Merten, 2011) were cultured at 37 C., 5% CO.sub.2 in Dulbecco's modified Eagle's medium (DMEM+Glutamax) supplemented with 10% of heat inactivated fetal calf serum (FCS) (Life Technologies, St-Aubin, France).
Viral Vector Production and Vector Titering
[0105] LVs were generated as described previously (Fenard, 2013). Briefly, HEK293T cells are transiently transfected using calcium phosphate transfection, with four plasmids: The gagpol (pKLgagpol) and rev (pKrev) expression plasmids, the transfer plasmid (pCCLsin.cPPT.hPGK.eGFP.WPRE) and the plasmid encoding either the VSV-G (pMDG) envelope glycoprotein (GP), the GALVTR GP (pBA.GALV/Ampho-Kana) or the RD114TR GP (pHCMV-RD114TR). After 24 hr of production, raw viral supernatants were harvested, filtered (0.45 m) and frozen at 80 C. The purification of GFP-expressing VSV-G-LVs, through several membrane-based and chromatographic steps, has previously been described (Merten, 2011). Physical particle titers were determined by measuring HIV-1 p24 capsid contents using a commercial ELISA kit (Perkin Elmer, Courtaboeuf, France). Infectious titers were determined on HCT116 cells using either the detection of GFP by flow cytometry (FACSCalibur, BD Biosciences, Le Pont de Claix, France), with titers expressed as transducing units per milliliter (TU/ml), or using Q-PCR with titers expressed as infectious genome per ml (ig/ml)(Merten, 2011).
Cell Line Transduction
[0106] For lentiviral transduction, HCT116 cells were transduced in 48-well plates with the desired amount of lentiviral vector supernatant in absence or presence of culture additives during six hours. Next, cells were incubated in fresh medium and further cultured for 3 to 4 days.
[0107] For transduction experiments performed with recombinant adeno-associated virus serotype 8 (AAV8-GFP), 293T cells were transduced in 12-well plates with a multiplicity of infection (MOI) of 1000 in absence or presence of culture additives. After 16 hr, cells were washed and further cultured in fresh medium for 24 hr. In these experiments, transduction efficiencies were evaluated by following GFP expression using flow cytometry (FACSCalibur, BD Biosciences).
Human CD34+ Cells Culture and Transduction
[0108] Umbilical cord blood (UCB) samples were collected with informed consent after uncomplicated births at the Centre Hospitalier Sud Francilien, Evry, France, in accordance with international ethical principles and French national law (bioethics law no 2011-814) under declaration No DC-201-1655 to the French Ministry of Research and Higher Studies. Human CD34+ cells were isolated by immunomagnetic selection (Miltenyi Biotec, Paris, France). The preactivation of hCD34+ cells was performed overnight as previously described (Ingrao et al., 2014). Pre-activated cells were plated in 96-well plates and the transduction was initiated by adding the desired amount of LV particles mixed with or without the peptides of interest. At 6 hr post-transduction, reactions were diluted by adding differentiation medium in each well. After 4-6 days, cellular mortality and transduction efficiency were evaluated respectively by 7-AAD labeling and measurement of GFP expression.
Viral Pull Down Assay
[0109] The pull-down of LV particles in presence of culture additives was adapted from a previously described protocol (Yolamanova, 2013). Briefly, The VSV-G-LV supernatant was diluted to 100 ng/ml of p24 with X-Vivo20 medium equilibrated at room temperature. Next, 1.5 ml tubes were loaded with 500 l of LV suspension in absence or presence of 10 M of the indicated culture additive. After homogenization, samples were centrifuged at low speed (15,000 g) for 5 min at room temperature. Then, the supernatant was discarded, the pellet suspended in 100 l of fresh medium and frozen at 20 C. For each condition, the amount of pelleted p24 was evaluated using a commercial HIV-1 p24 ELISA kit as described above.
Adhesion and BLAM-LV Fusion Assay
[0110] The protocol for LV adhesion to target cells was adapted from a previous study (Fenard, 2013). Briefly, HCT116 cells were pre-incubated 30 min at 37 C. in absence or presence of Tat-Scrambled or Tat-Beclin1 (5 M). Then, cells were further incubated 2.5 hr at 4 C. with viral supernatants in absence or presence of culture additives. Next, cells were washed 3 times with cold PBS1 and lysed in PBS1 containing 1% Triton X-100 and a protease cocktail inhibitor, Complete (Roche diagnostics, Meylan, France). p24 contents in lysates were evaluated using a commercial HIV-1 p24 ELISA kit and data were normalized to total protein content using the DC protein assay (Biorad, Ivry-sur-Seine, France). For the viral fusion assay (BLAM-LV) assay, the protocol was extensively described previously (Ingrao et al., 2014).
CFC Assay
[0111] CFC assays were performed in duplicate by plating 500 transduced or untransduced cells per milliliter of Methocult (H4434, Stemcell Technologies), according to the manufacturer's instructions. After 2 weeks of culture, burst-forming unit, erythroid (BFU-E); colony-forming unit, granulocyte-monocyte (CFU-GM) and colony-forming unit, granulocyte, erythrocyte, macrophage, megakaryocyte (CFU-GEMM) were counted using an inverted microscope with standard visual criteria.
Autophagy Assay Based on Imaging Flow Cytometry (ImageStream)
[0112] HEK293T cells were transfected with the pBABE-puro-mCherry-eGFP-LC3 expression plasmid using the transient calcium phosphate transfection method. Cells (510E5 cells/well), were incubated in the absence or presence of Tat-Beclin1 (5 M) or in an Earle's Balanced Salt solution (EBSS) for 6 h at 37 C., 5% CO.sub.2. Next, cells were washed in PBS 1, fixed (1.2% PFA) and analyzed using the ImageStream (Amnis corporation, Seattle, Wash., USA). Images of cells were acquired in bright field channel, in mCherry-fluorescence channel, and finally in the SSC channel (742 nm) using the 40 magnitude objective and lowest flow velocity to optimize sensitivity. Once, acquired, images were treated with Ideas software. Focused images were gated on a histogram displaying Gradient_RMS feature values in the bright field channel between 40 and 90. Then a scatter plot of Area versus Aspect Ratio (in the bright field channel) was used to gate on single cells and remove doublets of cells. Once gated on single cells, the number of spot on each cell was counted in mCherry channel, using the automatic spot counting wizard included in Ideas software. Data were exported as text files and processed with GraphPad Prism.
Results and Discussion
[0113] Low Doses of Tat-Beclin1 Strongly Improved Lentiviral Transduction of Cell Lines with Various Pseudotypes.
[0114] To evaluate the effect of the TB1 (SEQ ID NO:75) peptide on lentiviral transduction, HCT116 cells were transduced with lentiviral vectors (LVs) pseudotyped with the broadly used VSV-G glycoprotein envelope (VSV-G-LVs) in presence of low or high doses of TB1 or the control peptide Tat-Scrambled (TS) (
[0115] A great advantage of using LVs for gene transfer is their capacity to support pseudotyping with numerous heterologous envelope glycoproteins for specific cell targeting (Levy, 2015). Therefore, the effect of TB1 was evaluated on various LV pseudotypes, namely modified gibbon ape leukemia virus glycoprotein-pseudotyped LV (GALVTR-LV) and modified RD114 feline endogenous retrovirus glycoprotein-pseudotyped LV (RD114TR-LV). Very importantly, these hematopoietic-tropic pseudotypes are well known for their requirement of culture additives to promote an efficient transduction. On adherent cell lines, the classical soluble additives used to promote LVs are the polybrene, the protamine sulfate or the recently identified Vectofusin-1 (Fenard, 2013). As shown in
Tat-Beclin1 Promotes a Safe Lentiviral Transduction of Hematopoietic Stem/Progenitor Cells.
[0116] Although it is interesting to promote lentiviral transduction of cell lines for fundamental research, another strong interest is to optimize current clinical protocols of lentiviral transduction, targeting hematopoietic stem/progenitor cells (HSPCs) for ex vivo gene therapy approaches. As shown in
[0117] Since it has been previously shown that the TB1 peptide is able to trigger a specific cell death called autosis (Liu, 2013), safety studies have been performed on HSPCs. For that, a colony forming cell (CFC) assay was implemented from human CD34+ cells exposed to optimal concentrations of Retronectin, TS or TB1 peptide during lentiviral transduction. For these experiments, we used highly purified VSV-G-LV to transduce CD34+ cells because these vectors exhibit no measurable hematopoietic toxicity in this assay (Merten, 2011). As shown in
Tat-Beclin1 is Acting on the Adhesion and Fusion Steps of LVs with Target Cell Membranes.
[0118] The LV entry into target cells is a rate limiting step. Therefore, we decided to test whether low doses of TB1 are capable to enhance adhesion and fusion of LVs with target cell membranes. For that, the BLAM-LV assay was used (Ingrao, 2014). As shown in
Design and Evaluation of Numerous Tat-Beclin1 Variants on Lentiviral Transduction.
[0119] To evaluate the specificity of action of TB1 on lentiviral transduction, the Tat transduction domain (Tat) and the 267-284 modified beclin1 domain (Bec) have been synthesized and tested during the transduction of HCT116 cells with VSV-G-LVs. As shown in
[0120] To increase its peptide solubility, Shoji-Kawata and colleagues incorporated three mutations in the 267-284 Beclin1 domain of TB1, namely H275E, S279D and Q281E (WO2013/119377, Shoji-Kawata et al. 2013). To evaluate the influence of these mutations on the viral transduction enhancer activity, the wild-type 267-284 domain of the human Beclin1 protein has been fused to Tat (Tat-BecWT). As shown in
[0121] To further understand the action mechanism of TB1 on viral transduction, the role of the two phenylalanine residues in the TB1 peptide has been evaluated. Previously, Shoji-Kawata and colleagues have shown that Tat-Bec(F270S) and Tat-Bec(F274S) peptides are no longer able to induce the autophagy pathway (Shoji-Kawata et al. 2013). In our viral transduction experiments, these peptides are also unable to promote lentiviral transduction (
[0122] Numerous cell-penetrating peptides (CPPs) have been discovered over the last years (Milletti et al. 2012). Therefore, it could be interesting to test a CPP different from the broadly used Tat peptide. One interesting candidate is MAP (Model Amphipathic Peptide). We designed a MAP-Scrambled negative control and a MAP-Beclin1 peptide (with the MAP moiety having the sequence shown in SEQ ID NO:4). As shown in
[0123] The modified Beclin1 domain of the TB1 peptide is corresponding to amino acid residues 267 to 284 of the human Beclin1 protein (homo sapiens, NP_003757). This domain is described has a human GAPR-1 and HIV-1 Nef protein binding domain. However, the optimal Beclin1 peptide sequence capable to promote the lentiviral transduction with high efficiency has not been evaluated. For that, numerous peptides have been designed (
[0124] Altogether, these beclin1 domain variants highlight a very important role of the region covering amino acid residues 270 to 282 in the human Beclin1 sequence to promote lentiviral transduction. The most performant peptide at a low dose (2.504) is Tat-Bec(250-282), suggesting an important role of the al helix, the L1 loop and the 131 sheet domains.
Evaluation of TB1 Action on Adeno-Associated Viral Vectors
[0125] Adeno-associated vectors (AAVs) are among the most frequently used viral vectors for gene therapy approaches. Among the different serotypes, AAV-8 has been successfully used in the clinic and hold great promise for liver-directed gene therapy (Nathwani et al, 2014). Hence, the effect of TB1 on AAV8 transduction efficiency has been evaluated in vitro. As shown in
Evaluation of TB1 Optimal Dose on the Autophagy Process
[0126] To better understand the mechanism of action of TB1, we sought to investigate whether the increase in lentiviral transduction is the consequence of the activation of the autophagy process. To monitor autophagy at the single cell level, HEK293T cells have been transfected with a plasmid expressing the mCherry-eGFP-LC3 fusion protein. Next, cells were incubated with TB1 (5 M) or the EBSS starvation solution and analyzed with an imaging flow cytometer. As expected, EBSS is increasing the number of autophagolysosomes (mCherry spots) per cell (
Design and Evaluation of Tat-Beclin2 on Lentiviral Transduction.
[0127] A sequence alignment of the human Beclin 1 and Beclin 2 proteins is showing homologies in the ECD domain. Therefore, we decided to design a Tat-Bec2WT peptide, the fusion of the Tat (47-57) transduction peptide with the human Beclin2 ECD.sub.249-266 domain (
REFERENCES
[0128] D'Costa, J., S. G. Mansfield, and L. M. Humeau. 2009. Lentiviral vectors in clinical trials: Current status. Curr. Opin. Mol. Ther. 11:554-564. [0129] Davis, H. E., M. Rosinski, J. R. Morgan, and M. L. Yarmush. 2004. Charged polymers modulate retrovirus transduction via membrane charge neutralization and virus aggregation. Biophys. J. 86:1234-1242. [0130] Fenard, D., D. Ingrao, A. Seye, J. Buisset, S. Genries, S. Martin, A. Kichler, and A. Galy. 2013. Vectofusin-1, a new viral entry enhancer, strongly promotes lentiviral transduction of human hematopoietic stem cells. Mol. Ther. Nucleic Acids 2:e90. [0131] He, C., Y. Wei, K. Sun, B. Li, X. Dong, Z. Zou, Y. Liu, L N. Kinch, S. Khan, S. Sinha, R J. Xavier, N V. Grishin, G. Xiao, E L. Eskelinen, P E. Scherer, J L. Whistler and B. Levine. 2013. Beclin 2 Functions in Autophagy, Degradation of G Protein-Coupled Receptors, and Metabolism. Cell. 154(5):1085-99. [0132] Huang, W., W. Choi, W. Hu, N. Mi, Q. Guo, M. Ma, M. Liu, Y. Tian, P. Lu, F. L. Wang, H. Deng, L. Liu, N. Gao, L. Yu, and Y. Shi. 2012. Crystal structure and biochemical analyses reveal Beclin 1 as a novel membrane binding protein. Cell Res. 22:473-489. [0133] Ingrao, D., S. Majdoul, A. K. Seye, A. Galy, and D. Fenard. 2014. Concurrent Measures of Fusion and Transduction Efficiency of Primary CD34+ Cells with Human Immunodeficiency Virus 1-Based Lentiviral Vectors Reveal Different Effects of Transduction Enhancers. Hum. Gene Ther. Methods 25:48-56. [0134] Levy, C., E. Verhoeyen, and F. L. Cosset. 2015. Surface engineering of lentiviral vectors for gene transfer into gene therapy target cells. Curr. Opin. Pharmacol. 24:79-85. [0135] Liu, Y., S. Shoji-Kawata, R. M. Sumpter, Jr., Y. Wei, V. Ginet, L. Zhang, B. Posner, K. A. Tran, D. R. Green, R. J. Xavier, S. Y. Shaw, P. G. Clarke, J. Puyal, and B. Levine. 2013. Autosis is a Na+,K+-ATPase-regulated form of cell death triggered by autophagy-inducing peptides, starvation, and hypoxia-ischemia. Proc. Natl. Acad. Sci. U.S.A. 110:20364-20371. [0136] Merten, O. W., S. Charrier, N. Laroudie, S. Fauchille, C. Dugue, C. Jenny, M. Audit, M. A. Zanta-Boussif, H. Chautard, M. Radrizzani, G. Vallanti, L. Naldini, P. Noguiez-Hellin, and A. Galy. 2011. Large-scale manufacture and characterization of a lentiviral vector produced for clinical ex vivo gene therapy application. Hum. Gene Ther. 22:343-356. [0137] Milletti, F. 2012. Cell-penetrating peptides: classes, origin, and current landscape. Drug Discov. Today 17:850-860. [0138] Munch, J., E. Rucker, L. Standker, K. Adermann, C. Goffinet, M. Schindler, S. Wildum, R. Chinnadurai, D. Rajan, A. Specht, G. Gimenez-Gallego, P. C. Sanchez, D. M. Fowler, A. Koulov, J. W. Kelly, W. Mothes, J. C. Grivel, L. Margolis, O. T. Keppler, W. G. Forssmann, and F. Kirchhoff. 2007. Semen-derived amyloid fibrils drastically enhance HIV infection. Cell 131:1059-1071. [0139] Nathwani, A. C., U. M. Reiss, E. G. Tuddenham, C. Rosales, P. Chowdary, J. McIntosh, M. Della Peruta, E. Lheriteau, N. Patel, D. Raj, A. Riddell, J. Pie, S. Rangarajan, D. Bevan, M. Recht, Y. M. Shen, K. G. Halka, E. Basner-Tschakarjan, F. Mingozzi, K. A. High, J. Allay, M. A. Kay, C. Y. Ng, J. Zhou, M. Cancio, C. L. Morton, J. T. Gray, D. Srivastava, A. W. Nienhuis, A. M. Davidoff. Long-term safety and efficacy of factor IX gene therapy in hemophilia B. 2014. N. Engl. J. Med. 371(21):1994-2004. [0140] Novelli, E. M., L. Cheng, Y. Yang, W. Leung, M. Ramirez, V. Tanavde, C. Enger, and C. I. Civin. 1999. Ex vivo culture of cord blood CD34+ cells expands progenitor cell numbers, preserves engraftment capacity in nonobese diabetic/severe combined immunodeficient mice, and enhances retroviral transduction efficiency. Hum. Gene Ther. 10:2927-2940. [0141] Pollok, K. E., and D. A. Williams. 1999. Facilitation of retrovirus-mediated gene transfer into hematopoietic stem and progenitor cells and peripheral blood T-lymphocytes utilizing recombinant fibronectin fragments. Curr. Opin. Mol. Ther. 1:595-604. [0142] Roan, N. R., J. Munch, N. Arhel, W. Mothes, J. Neidleman, A. Kobayashi, K. Smith-McCune, F. Kirchhoff, and W. C. Greene. 2009. The cationic properties of SEVI underlie its ability to enhance human immunodeficiency virus infection. J. Virol. 83:73-80. [0143] Rodrigues, T., M. J. Carrondo, P. M. Alves, and P. E. Cruz. 2007. Purification of retroviral vectors for clinical application: biological implications and technological challenges. J. Biotechnol. 127:520-541. [0144] Sandrin, V., B. Boson, P. Salmon, W. Gay, D. Negre, R. Le Grand, D. Trono, and F. L. Cosset. 2002. Lentiviral vectors pseudotyped with a modified RD114 envelope glycoprotein show increased stability in sera and augmented transduction of primary lymphocytes and CD34+ cells derived from human and nonhuman primates. Blood 100:823-832. [0145] Shoji-Kawata, S., R. Sumpter, M. Leveno, G. R. Campbell, Z. Zou, L. Kinch, A. D. Wilkins, Q. Sun, K. Pallauf, D. MacDuff, C. Huerta, H. W. Virgin, J. B. Helms, R. Eerland, S. A. Tooze, R. Xavier, D. J. Lenschow, A. Yamamoto, D. King, O. Lichtarge, N. V. Grishin, S. A. Spector, D. V. Kaloyanova, and B. Levine. 2013. Identification of a candidate therapeutic autophagy-inducing peptide. Nature 494:201-206. [0146] Yolamanova, M., C. Meier, A. K. Shaytan, V. Vas, C. W. Bertoncini, F. Arnold, O. Zirafi, S. M. Usmani, J. A. Muller, D. Sauter, C. Goffinet, D. Palesch, P. Walther, N. R. Roan, H. Geiger, O. Lunov, T. Simmet, J. Bohne, H. Schrezenmeier, K. Schwarz, L. Standker, W. G. Forssmann, X. Salvatella, P. G. Khalatur, A. R. Khokhlov, T. P. Knowles, T. Weil, F. Kirchhoff, and J. Munch. 2013. Peptide nanofibrils boost retroviral gene transfer and provide a rapid means for concentrating viruses. Nat. Nanotechnol. 8:130-136.