COMPOSITE PROTEIN MONOMER HAVING NON-STRUCTURAL PROTEIN OF VIRUS SUPPORTED THEREON, AGGREGATE OF COMPOSITE PROTEIN MONOMER, AND COMPONENT VACCINE COMPRISING AGGREGATE AS ACTIVE INGREDIENT

Abstract

An object of the present invention is to establish means for providing a component vaccine which can elicit immunity to a non-structural protein. The present inventors have found that the object can be attained by providing a component vaccine containing an associated product containing a trimer and/or a hexamer of a molecular needle to which a non-structural protein of a pathogenic virus is attached.

Claims

1. A composite protein represented by the amino acid sequence of the following formula (1):
W-L.sub.1-X.sub.n-Y   (1) [wherein W represents an amino acid sequence including one or more amino acid sequences of a part or the entirety of a pathogenic virus non-structural protein serving as an immunogen; L.sub.1 represents a first linker sequence having 0 to 100 amino acids; X represents an amino acid sequence represented by SEQ ID NO: 1; Y represents an amino acid sequence of a cell introduction domain; and repetition number n of X is an integer of 1 to 3], wherein the amino acid sequence of the cell introduction domain Y is represented by the following formula (2):
Y.sub.1-L.sub.2-Y.sub.2-Y.sub.3   (2) [wherein Y.sub.1 represents any one amino acid sequence selected from the group consisting of SEQ ID NOs: 2 to 5; Y.sub.2 represents any one amino acid sequence selected from the group consisting of SEQ ID NOs: 6 to 9; L.sub.2 represents a second linker sequence having 0 to 30 amino acids; Y.sub.3 represents an amino acid sequence for modification; and either of Y.sub.2 and Y.sub.3 may be absent], wherein the amino acid sequence represented by X.sub.n, Y.sub.1, or Y.sub.2 included in the above formulas may include a modified amino acid sequence thereof obtained by deleting, substituting, or adding one or more amino acid residues from, in, or to the original amino acid sequence.

2. The composite protein according to claim 1, wherein, in the modified amino acid sequence obtained through deletion, substitution, or addition of one or more amino acid residues from, in, or to the amino acid sequence represented by X.sub.n, Y.sub.1, or Y.sub.2 included in the above formulas, the number of modifications of amino acid residues in each amino acid sequence is ≤8n in the case of X.sub.n; ≤30 in the case of Y.sub.1; and ≤15 in the case of Y.sub.2.

3. A gene expression vector, to which a nucleic acid fragment encoding a composite protein as recited in claim 1 has been incorporated.

4. A transformant, which is formed through transformation with a nucleic acid fragment encoding a composite protein as recited in claim 1.

5. (canceled)

6. An associated product comprising a protein trimer and/or a protein hexamer formed of one or more composite proteins as recited in claim 1 as a protein monomer.

7. (canceled)

8. A component vaccine comprising, as an active ingredient, an associated product including a protein trimer and/or a protein hexamer formed of one or more composite proteins as recited in claim 1 as a protein monomer.

9. The component vaccine according to claim 8, which is to be administered subcutaneously, intradermally, percutaneously, mucosally, or intramuscularly.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0046] FIG. 1 A scheme of forming the associated products of the present invention (trimer and hexamer) from the composite protein of the present invention.

[0047] FIG. 2 MALDI-TOF mass spectra of PN-sRL-VPg: (a) a signal of monomer, (b) a signal of trimer, and (c) a signal of hexamer (i.e., trimer-dimer). A rough sketch showing the association state of the composite protein of the present invention (i.e., monomer) is attached to each spectrum chart.

[0048] FIG. 3 MALDI-TOF mass spectra of PN-sFL-VPg: (a) a signal of monomer, (b) a signal of trimer, and (c) a signal of hexamer (i.e., trimer-dimer). A rough sketch showing the association state of the composite protein of the present invention (i.e., monomer) is attached to each spectrum chart.

[0049] FIG. 4 Schematic structure of an RS virus gene.

[0050] FIG. 5 Graphs showing an IgG induction effect by nasal inoculation of a component vaccine employed in Example 2 (3 weeks and 7 weeks after inoculation). The active ingredient of the vaccine is the composite protein associated product of the present invention having P protein (a non-structural protein of RS virus).

[0051] FIG. 6 Graphs showing an IgA induction effect by nasal inoculation of a component vaccine employed in Example 2 (3 weeks and 7 weeks after inoculation). The active ingredient of the vaccine is the composite protein associated product of the present invention having P protein (a non-structural protein of RS virus).

[0052] FIG. 7 A graph showing an inhibitory effect on infection of the lung with RS virus by nasal inoculation of a component vaccine employed in Example 2. The active ingredient of the vaccine is the composite protein associated product of the present invention having P protein (a non-structural protein of RS virus).

[0053] FIG. 8 Schematic structure of a peptide of F protein (a structural protein of RS virus employed in Example 3) corresponding to a domain to which a neutralizing antibody is bound (i.e., neutralization epitope), and schematic structure of a plasmid in which four units of the peptide are quadruple-linked and which expresses the composite protein of the present invention having the linked product as an immunogen.

[0054] FIG. 9 Graphs showing an IgG induction effect and an IgA induction effect by nasal inoculation of a vaccine (7 weeks after inoculation). The active ingredient of the vaccine is the composite protein associated product of the present invention in which a quadruple-linked product of the neutralization epitope peptide of F protein is attached as immunogen to a molecular needle.

[0055] FIG. 10 A graph showing an inhibitory effect on infection of the lung with RS virus by nasal inoculation of a vaccine. The active ingredient of the vaccine is the composite protein associated product of the present invention in which a quadruple-linked product of the neutralization epitope peptide of F protein is attached as immunogen to a molecular needle.

Modes for Carrying Out the Invention

(1) The Composite Protein of the Present Invention

[0056] The composite protein of the present invention is represented by the amino acid sequence of the following formula (1):

W-L.sub.1-X.sub.n-Y   (1)

[wherein W represents an amino acid sequence including one or more amino acid sequences of a part or the entirety of a pathogenic virus non-structural protein serving as an immunogen; L.sub.1 represents a first linker sequence having 0 to 100 amino acids; X represents an amino acid sequence represented by SEQ ID NO: 1; Y represents an amino acid sequence of a cell introduction domain; repetition number n of X is an integer of 1 to 3].

[0057] In formula (1), a specific example of the immunogen W is an amino acid sequence based on a part or the entirety of the peptide structure of the virus non-structural protein. The wording “based on” refers to the immunogen W including the original peptide structure and also a modified amino acid sequence thereof.

[0058] The concept “a part or the entirety of a pathogenic virus non-structural protein” has been described above.

[0059] The first linker sequence L.sub.1 is required for appropriately maintaining the distance between the immunogen W and the molecular needle part Y, to thereby suppress steric hindrance. As described above, the number of amino acid residues of L.sub.1 is 0 to 100, preferably 4 to 40. No particular limitation is imposed on the specific amino acid sequence, and examples thereof include (GGGGS).sub.m and (PAPAP).sub.m [m represents the number of repetitions and is preferably an integer of 1 to 5, particularly preferably 1 to 3]. Needless to say, the above examples are non-limitative ones.

[0060] X is an amino acid residue represented by SEQ ID NO: 1, and the amino acid sequence X.sub.n is a sequence of repeating unit Xs with the number of repetitions n (n is an integer). The mode of repetition is linear repetition. The case of X.sub.2 means “X-X” (wherein symbol “-” denotes a peptide bond). Also, in the repeated sequence X.sub.n, the amino acid sequence may be modified in the aforementioned manner. As mentioned above, the number n is an integer of 1 to 3. The number n is preferably 1 but may be 2 or 3. The repeated sequence X.sub.n (n=2 or 3) is employed for consistently maintaining the suitable distance between the molecular needle part Y and the immunogen W according to the dimension and characteristics of the immunogen W.

[0061] The cell introduction domain Y is a basement of the molecular needle and is based on the tail needle of a bacteriophage (i.e., cell-penetrating part). The domain Y is a protein represented by the following formula (2):

Y.sub.1-L.sub.2-Y.sub.2-Y.sub.3   (2)

[wherein Y.sub.1 represents an amino acid sequence selected from the group consisting of SEQ ID NOs: 2 to 5; Y.sub.2 represents an amino acid sequence selected from the group consisting of SEQ ID NOs: 6 to 9; L.sub.2 represents a second linker sequence having 0 to 30 amino acids; Y.sub.3 represents an amino acid sequence for modification of interest; and Y.sub.2 or Y.sub.3 may be absent].

[0062] In Y.sub.1 of formula (2), the amino acid sequence from the end of the N-terminal side to the 32 amino acid residue (32 Leu) corresponds to the amino acid sequence of a triple helix β-sheet structure of the bacteriophage T4. The N-terminal amino acid of valine (1 Val) may also be leucine (1 Leu). The remaining C-terminal amino acid sequence is an amino acid sequence of the needle protein of the bacteriophage on the C-terminal side. Examples of the amino acid sequence which can be used on the C-terminal side of Y.sub.1 include an amino acid sequence of gp5 of bacteriophage T4, an amino acid sequence of gpV of bacteriophage P2, an amino acid sequence of gp45 of bacteriophage Mu, and an amino acid sequence of gp138 of bacteriophage ϕ92. More specific examples of Y.sub.1 include the amino acid sequence (SEQ ID NO: 2) which has the amino acid sequence of gp5 of bacteriophage T4 on the C-terminal side, the amino acid sequence (SEQ ID NO: 3) which has the amino acid sequence of gpV of bacteriophage P2 on the C-terminal side, the amino acid sequence (SEQ ID NO: 4) which has the amino acid sequence of gp45 of bacteriophage Mu on the C-terminal side, and the amino acid sequence (SEQ ID NO: 5) which has the amino acid sequence of gp138 of bacteriophage ϕ92 on the C-terminal side. The nucleotide sequence encoding the amino acid sequence of Y.sub.1 may be selected in accordance with a generally known amino acid-nucleobase relationship.

[0063] Y.sub.2 in formula (2) is an amino acid sequence of a domain “foldon” of bacteriophage T4 or an amino acid sequence of a domain “tip” of bacteriophage P2, bacteriophage Mu, or bacteriophage ϕ92. The foldon or tip is a domain forming the tip portion of the molecular needle structure (i.e., fibritin) of bacteriophage. In formula (2), Y.sub.2 is not necessarily present. However, when the amino acid sequence of the foldon or the tip is included, the efficiency of incorporation of the molecular needle to the cell membrane can be enhanced. Thus, the presence of Y.sub.2 is preferred. The amino acid sequence of the foldon of bacteriophage T4 is represented by SEQ ID NO: 6. The nucleotide sequence encoding the amino acid sequence may be selected in accordance with a generally known amino acid-nucleobase relationship.

[0064] The amino acid sequence of the tip of bacteriophage P2 is represented by SEQ ID NO: 7. The nucleotide sequence encoding the amino acid sequence may be selected in accordance with a generally known amino acid-nucleobase relationship. The amino acid sequence of the tip of bacteriophage Mu is represented by SEQ ID NO: 8. The nucleotide sequence encoding the amino acid sequence may be selected in accordance with a generally known amino acid-nucleobase relationship. The amino acid sequence of the tip of bacteriophage ϕ92 is represented by SEQ ID NO: 9. The nucleotide sequence encoding the amino acid sequence may be selected in accordance with a generally known amino acid-nucleobase relationship.

[0065] L.sub.2 serves as a second linker intervening between Y.sub.1 and Y.sub.2. The number of amino acid residues in linker L.sub.2 is 0 to 30, preferably 0 to 5. The number of amino acid residue in the linker being 0 means the absence of second linker L.sub.2.

[0066] Y.sub.3 is an amino acid sequence for modification and may be selectively incorporated into Y. The modification amino acid sequence is added in order to purify or protect protein (or for another reason), and examples thereof include tag peptides such as histidine tag, GST tag, and FLAG tag. An appropriate linker sequence may be incorporated into Y.sub.3. Such an additional linker sequence may also be a component of the amino acid sequence of Y.sub.3.

[0067] The composite protein of the present invention may be produced through a known method; specifically, a genetic engineering process or chemical synthesis. The entirety of the composite protein of the present invention may be produced in a single process. Alternatively, segments of the composite protein are individually produced, and the produced segments are linked through a chemical modification method. In one linking procedure of polypeptides by the mediation of a linker (e.g., L.sub.1 or L.sub.2), a lysine residue or a cysteine residue of one polypeptide may be linked to that of another polypeptide by the mediation of a linker having a succinimido group or a maleimido group.

[0068] In a genetic engineering procedure, a nucleic acid fragment encoding the entirety or a part of the target composite protein of the present invention may be expressed in host cells (e.g., Escherichia coli, yeast, insect cells, and animal cells) as a transformant, or in a cell-free expression system such as an E. coli extract, a rabbit reticulocyte extract, or a wheat germ extract. As an expression vector in which the nucleic acid fragment is incorporated, a vector corresponding to each expression system can be used. Examples of the expression vector include pET (for expression in E. coli), pAUR (for expression in yeast), plEx-1 (for expression in insect cells), pBApo-CMV (for expression in animal cells), and pF3A (for expression in wheat germ extract).

[0069] Regarding chemical synthesis, any known method for chemically synthesizing peptides may be employed. More specifically, the entirety or a part of the composite protein of the present invention may be produced through any established customary method (e.g., liquid phase peptide synthesis or solid phase peptide synthesis). Generally known suitable solid phase peptide synthesis techniques (i.e., chemical synthesis) such as a Boc solid phase method or an Fmoc solid phase method may be employed. Also, as described above, a ligation technique may be employed in accordance with need. Needless to say, each amino acid may be produced through a known method, and a commercial product thereof may be used.

(2) The Associated Product of the Present Invention

[0070] FIG. 1 is a scheme of forming the associated products of the present invention (trimer and hexamer) from the composite protein of the present invention. In FIG. 1, reference numeral 10 denotes the composite protein of the present invention in the form of monomer. Reference numeral 20 denotes the trimer of the present invention, and reference numeral 30 denotes the hexamer of the present invention.

[0071] The composite protein 10 of the present invention is formed of a “molecular needle domain 13 corresponding to Y in formula (1)” in which a “base part 131 corresponding to X.sub.n and Y.sub.1 in formula (2)” is linked to a “foldon 132 corresponding Y.sub.2 in formula (2),” and an “immunogen 11 corresponding to W in formula (1),” wherein two components are linked together via a “linker 12 corresponding to L.sub.1 in formula (1). A linker or linkers other than linker 12, and the modification sequence corresponding to Y.sub.3 in formula (2) are not illustrated. The composite protein 10 of the present invention per se substantially exhibits no function of penetrating the cell membrane of the target cells.

[0072] The trimer 30 is an associated product of three molecules of the aforementioned composite protein 10 serving as a monomer via a spontaneous association process. In the trimer 30, 3 units of the molecular needle domain 13 are combined with association via formation of C-terminal-C-terminal bonds, to thereby provide a trimer parallel β-sheet structure, and a helix structure of the β-sheet structure per se (i.e., triple helix β-sheet structure), which corresponds to a needle structure. As a result, a molecular needle 13×3 is formed. The molecular needle 13×3 is composed of a basic part 131×3 and a foldon aggregate 132×3. In this way, a “molecular needle” which has a target tissue cell membrane penetration function is formed through trimerization and a self-assembly process. Three linkers (12.sup.1, 12.sup.2, 12.sup.3) originating from the respective monomers, and three immunogen portions (11.sup.1, 11.sup.2, 11.sup.3) linked to the respective linkers exist in the outside area of the molecular needle 13×3.

[0073] The hexamer 60 is formed through linking 2 units of the trimer 30, with formation of a bond between the N-terminals of the molecular needle basic parts (13×3).sup.1 and (13×3).sup.2. The hexamer 60 also exhibits a target tissue cell membrane penetration function. Six linkers (12.sup.1, 12.sup.2, 12.sup.3, 12.sup.5, 12.sup.6, 12.sup.4 (12.sup.4: not illustrated)) originating from the respective trimers, and six immunogen portions (11.sup.1, 11.sup.2, 11.sup.3, 11.sup.5, 11.sup.6, 11.sup.4 (11.sup.4: not illustrated) linked to the respective linkers exist in the outside area of two molecular needles (13×3).sup.1 and (13×3).sup.2.

[0074] Trimerization of the composite protein 10 of the present invention to form the trimer 30, and further dimerization of the trimer 30 to form the hexamer 60 spontaneously proceed in an aqueous liquid. The formed trimer or hexamer exists in a stable state. The stability of the trimer or hexamer is remarkably high. For example, the trimer or hexamer is stable in an aqueous liquid at 100° C., in an aqueous liquid at a pH of 2 to 11, or in an aqueous liquid containing 50 to 70 vol. % of organic solvent. In addition, the trimer or hexamer is excellent in safety. When being isolated from the aqueous liquid and dried, the trimer or hexamer is highly stable and retains an excellent cell membrane penetration function.

[0075] As described above, transformation of the composite protein of the present invention to the associated product of interest proceeds spontaneously. Generally, most of the composite protein is hexamized (final form), but some remains as the trimers.

(3) The Vaccine of the Present Invention

[0076] The vaccine of the present invention contains, as an active ingredient, the associated product of the present invention which exhibits an excellent cell penetration function and immunogenicity. Thus, when administered to target tissue cells via subcutaneous administration, intradermal administration, percutaneous administration, mucosal administration, or intramuscular administration, a part or the entirety of the virus non-structural protein serving as the immunogen can be efficiently transferred to the target tissue cells, to thereby attain immunization. As a result, the efficacy and safety of a virus component vaccine via subcutaneous administration, intradermal administration, percutaneous administration, mucosal administration, or intramuscular administration can be enhanced. One demonstrated characteristic feature of the component vaccine of the invention resides in that the vaccine may be used as an adjuvant-free vaccine. No particular limitation is imposed on the target mucosal tissue to which the vaccine is administered, and the target mucosal tissue may be freely selected in accordance with the characters of the target virus (for example, the site affected by the virus). Examples of the target mucosal tissue include the nasal mucous membrane, throat mucous membrane, oral mucous membrane, mucous membrane of bronchus, alimentary canal mucous membrane, and vaginal mucous membrane. In the case of a virus causing respiratory tract inflammation (cold) (e.g., RS virus), suitable targets include the nasal mucous membrane, throat mucous membrane, oral mucous membrane, mucous membrane of bronchus, sublingual mucous membrane, and lung mucous membrane.

[0077] As the vaccine for mucosal administration, there will be disclosed a component vaccine containing only a molecular needle to which the aforementioned pathogenic virus structural protein has been attached as an active ingredient.

[0078] The vaccine of the present invention is provided as a pharmaceutical composition for subcutaneous administration, intradermal administration, percutaneous administration, mucosal administration, or intramuscular administration, the composition containing the aforementioned associated product of the present invention as an active ingredient (protective antigen). Even in the case of directly administering the associated product of the present invention, the associated product is mixed with and suspended in a buffer or the like upon use, to provide a liquid agent to be subcutaneously, intradermally, percutaneously, mucosally, or intramuscularly administered. Thus, the pharmaceutical composition also encompasses the form of the associated product itself. In the case of the aforementioned mucosal administration, suitable agent forms include spray (e.g., aerosol or spray), capsule, and coating.

[0079] The vaccine of the present invention may be prepared in the form of a pharmaceutical composition by blending the associated product of the present invention serving as an essential active ingredient (protective antigen) with an optional molecular needle to which a virus structural protein has been attached and a further optional adjuvant (including the form of the aforementioned molecular needle) and an appropriate pharmaceutical carrier. The pharmaceutical carrier may be selected in accordance with the form of use. Examples of the pharmaceutical carrier which may be used in the invention include a filler, an extender, a binder, a humectant, a disintegrant, a surfactant, an excipient, and a diluent. The form of the composition is generally liquid, but may be a dry product, powder, granule, and the like which are diluted with liquid upon use.

[0080] In the vaccine of the present invention, the amount of the associated product of the present invention (in the case where an associated product of a molecular needle to which a structural protein is attached, is also included, the total amount) is not necessarily fixed and may be appropriately chosen. Generally, the associated product of the present invention is suitably used as a liquid formulation containing the product in a dose of 1 to 10 mass % upon administration. The appropriate single dose of administration (inoculation) is about 0.01 μg to about 10 mg for an adult. As needed, the initial inoculation may be appropriately combined with the booster inoculation. The administration (inoculation) may be carried out one or more times.

Examples

[0081] The present invention will next be described in detail by way of example.

[0082] The Examples are provided so as to demonstrate the advantageous feature of the associated product of the present invention as the active ingredient of a component vaccine targeted to a virus. In view of difficulty in current production of such a vaccine and usefulness of the production method, RS virus (RSV), also called orthopneumovirus, was selected as an example of the virus.

[0083] RS virus is widely identified in the world and can cause lifelong apparent infection of a human subject regardless of age. Particularly in infancy, RS virus is a serious pathogen. Although babies and infants have an antibody to RS virus, which antibody has been transferred from the mother's body, most severe symptoms may be induced in a period of several weeks to several months after birth. In the case of low birth-weight infants, or human subjects having an underlying cardiopulmonary disease or immunodeficiency, the symptoms tend to become more grave. Thus, RS virus has a large impact in clinical settings and on public health.

[0084] Currently, there is no authorized RSV vaccine. Previously, some clinical tests were conducted with a formalin-inactivated vaccine. However, the trials failed, since the symptoms of the vaccinated groups were more aggravated than those of the control group. As a pharmaceutical product to cope with RSV infection, Palivizumab, which is a human monoclonal antibody, is only used for prophylactic administeration to a subject in need thereof. Thus, there is demand for an effective vaccine (cited from Web pages of the National Institute of Infectious Disease, Japan).

[Example 1]Production and Identification of the Associated Product of the Present Invention

(a) Introduction

[0085] In Example 1, a composite protein falling within the scope of the present invention was prepared through a genetic engineering technique. The composite protein employed, as an attached immunogen, “VPg (viral protein genome-linked),” which serves as a non-structural protein of human norovirus GII.4 (i.e., LM14-2 variant). VPg is a non-structural protein included in open reading frame 1 (ORF1) of the norovirus genome. ORF1 encodes a series of non-structural proteins of nororvirus including N-terminal protein, NTPase (p48), p22 (3A-like), VPg, protease, and RNA-dependent RNA polymerase (RdRp). After completion of total translation, ORF1 is cut by the corresponding protease to provide individual non-structural proteins serving as mature products. Among these mature products, VPg has been found to play an essential role in replication of the norovirus genome via translation from the genomic RNA and the subgenomic RNA. Actually, VPg functions as a cap substitute in mobilization of ribosomes. VPg of LM14-2 variant employed as an immunogen in Example 1 has an amino acid sequence represented by SEQ ID NO: 10 (Notably, Met on the N-terminal originates from start codon ATG). The nucleotide sequence encoding the amino acid sequence may be selected in accordance with a generally known amino acid-nucleobase relationship.

[0086] All the reagents employed in Example 1 were purchased from commercial suppliers and used without additional purification. As a gene fragment of HNV-VPg, there was used a gene fragment included in a cDNA fragment (7,640 bases: SEQ ID NO: 12) of human norovirus LM14-2 variant incorporated into plasmid pHuNoV-LM14-2F (1 to 12,550 bases: SEQ ID NO: 11) provided by Katayama, Omura Satoshi Memorial Institute, Kitasato University. VPg is represented by a sequence formed of 372 bases (SEQ ID NO: 13) corresponding to the 2,630th base to the 3,028th base of a cDNA fragment (7,640 bases) of the LM14-2 variant. Start codon ATG was attached to the 5′-terminal of the above sequence, and the product was used in gene expression.

[0087] UV-vis spectra were measured by means of SHIMADZU UV-2400PC UV-vis spectrometer. MALDI-TOF mass spectra were measured by means of Bruker ultrafleXtrme. In the MALDI-TOF-MS measurement, each sample was mixed with an equivolume of 70% (v/v) acetonitrile/water containing 0.03% (w/v) sinapic acid and 0.1% (v/v) trifluoroacetic acid. Gel permeation chromatography (GPC) was conducted by means of an HPLC system with a column (Asahipack GF-510HQ, Shodex, Tokyo, Japan).

(b) Production of Plasmid for Forming “PN-VPg” via Gene Expression, and Gene Expression

[0088] (b)-1: Summary

[0089] “PN-VPg” is a composite protein represented by the aforementioned formula (1):

W-L.sub.1-X.sub.n-Y   (1),

wherein Y represents a cell introduction domain represented by formula (2):

Y.sub.1-L.sub.2-Y.sub.2-Y.sub.3   (2).

[0090] In the above formulas, the immunogen W is “LM14-2 variant-VPg” represented by amino acid sequence SEQ ID NO: 10; the first linker L.sub.1 is amino acid sequences SEQ ID NO: 14 (SNSSSVPGG), 15 (GGGGS), or 16 (PAPAP); the repeating unit of the repeating sequence X.sub.n is amino acid sequence SEQ ID NO: 1; the number n is 1; the amino acid sequence of the molecular needle base Y.sub.1 is amino acid sequence SEQ ID NO: 2; the second linker L.sub.2 is “SVE”; the amino acid sequence of the foldon Y.sub.2 is amino acid sequence SEQ ID NO: 6; and the amino acid sequence of the modification sequence Y.sub.3 is amino acid sequence SEQ ID NO: 17 (VEHHHHHH).

[0091] The plasmid forming PN-VPg via gene expression was constructed from a flexible linker (FL: SNSSSVPGG (SEQ ID NO: 14)) as a template, and based on the plasmid, plasmids were constructed from two shorter linkers; a flexible linker (sFL: GGGGS (SEQ ID NO: 15)) and a rigid linker (sRL: PAPAP (SEQ ID NO: 16)). Through expression of the target protein, an associated product generated spontaneously. The presence of a protein trimer and a protein hexamer was confirmed by analyzing the contents of the associated product. Based on the above, an RS virus component vaccine (i.e., a present target) was produced and tested. As a result, it was demonstrated that the associated product of the present invention employing the virus non-structural protein was remarkably useful for providing a component vaccine.

(b)-2: Construction of Template Plasmid by Use of Flexible Linker (FL: SNSSSVPGG (SEQ ID NO: 14))

[0092] A VPg segment obtained from LM14-2 plasmid was amplified through polymerase chain reaction (PCR) by use of a gene amplification primer VPg_F (with an Ndel restriction enzyme site: ACGCCATATGGGCAAGAAAGGGAAGAACAAGTCC (SEQ ID NO: 18)) and a gene amplification primer VPg_R (with an EcoRI restriction enzyme site: GCTCGAATTCGACTCAAAGTTGAGTTTCTCATTGTAGTCAACAC (SEQ ID NO: 19)). Thereafter, the PCR product was cloned into plasmid pKN1-1 (plasmid for GFP-gp5f expression) (Patent Document 2) digested by Ndel-EcoRI.

[0093] The plasmid pKN1-1 was yielded according to the disclosure of Patent Document 2. In the specific procedure, firstly, the gene fragment corresponding to the 461th to the 484th amino acid residues of the wac protein of T4 phage was amplified through PCR from the T4 phage genome, followed by cloning to pUC18, to thereby yield a gene encoding the foldon. Subsequently, the plasmid was cut by restriction enzymes EcoRI and SalI, and the product was inserted into a plasmid pET29b (Novagen) treated by EcoRI and XhoI, to thereby yield plasmid pMTf1-3. Also, the gene fragment corresponding to the 474th to the 575th amino acid residues of gp5 of the T4 phage was amplified through PCR from the T4 phage genome, followed by cloning to pUC18, to thereby yield a gene encoding gp5. Thereafter, the resultant plasmid was cut by restriction enzymes EcoRI and SalI, and the product was inserted into the aforementioned plasmid pMTf1-3 treated by EcoRI and XhoI, to thereby yield plasmid pKA176. Separately, the GFP expression vector provided by Takahasi of Gunma University was cut by restriction enzymes Ndel and EcoRI, to thereby yield a gene encoding the GFP. The product was inserted into the aforementioned plasmid pKA176 treated by NdeI and EcoRI.

[0094] The thus-cloned gene fragment was introduced into competent cells of E. coli BL21 (DE3), and the presence of the gene fragment was identified through DNA sequencing. Thus, formation of a plasmid structure including PN and VPg with the interposition of the flexible linker (SNSSSVPGG: SEQ ID NO: 15) “PN-FL-VPg” was confirmed.

(b)-3: Production of the Associated Products by Use of sFL/sRL Linker and Identification Thereof

[0095] Primer combinations for gene amplification were individually used in inverted PCR employing the “PN-FL-VPg” as a template. One primer combination was a gene amplification primer VPgPA-F (with XhoI restriction site:

TABLE-US-00001 (SEQ ID NO: 20) CCGGCTCCGGCCCCACTCGAGGGAAGCAATACAATATTTGTACG)
and a gene amplification primer VPgPA-R (CTCAAAGTTGAGTTTCTCATTGTAGTCAACAC (SEQ ID NO: 21)), for interposing a “shorter rigid linker (sRL: PAPAP)” represented by SEQ ID NO: 16 as linker L.sub.1. The other primer combination was a gene amplification primer VPgGS-F (with an XhoI restriction site:

TABLE-US-00002 (SEQ ID NO: 22) GGAGGCGGGGGTTCACTCGAGGGAAGCAATACAATATTTGTACG
and a gene amplification primer VPgGS-R (the same as that of the aforementioned VPgPA-R (SEQ ID NO: 21)), for interposing a “shorter flexible linker (sFL: GGGGS)” represented by SEQ ID NO: 15 as linker L.sub.1. As a result, a plasmid structure “PN-sRL-VPg” (wherein L.sub.1 is a shorter rigid linker represented by SEQ ID NO: 16) and a plasmid structure “PN-sFL-VPg” (wherein L.sub.1 is a shorter flexible linker represented by SEQ ID NO: 15) were constructed.

[0096] Subsequently, each of the two plasmids was introduced into DH5α competent cells. The thus-obtained vectors were identified through DNA nucleotide sequencing. Thereafter, PN-sRL-VPg and PN-sFL-VPg were formed via gene expression.

[0097] Each of the thus-formed “PN-sRL-VPg” and “PN-sFL-VPg” was applied to an Ni affinity column, and the protein contents were eluted with imidazole with a higher concentration gradient of 20 to 500 mM and 1 mM DTT. Fractions containing PN-VPg were combined, and the volume of the mixture was reduced to 5 mL. The product was dialyzed overnight against a 20 mM Tris-HCl buffer (pH: 8.0) at 4° C. with a dialysis membrane. The thus-concentrated product was filtered through a 0.2-μm filter, and the filtered liquid was applied to a HiTrap Q column. Then, elution was performed with concentration-graded (0 to 1 M) sodium chloride solution. Fractions containing PN-VPg (i.e., shorter linker) were combined, and the combined product was analyzed through Native PAGE and SDS-PAGE.

[0098] The SDS PAGE analysis showed a band attributable to a monomer having a calculated molecular weight of about 31 kDa, which corresponds to PN-VPg (sFL/sRL linker) (not illustrated). In addition, the MALDI-TOF mass spectra regarding PN-sRL-VPg showed a monomer signal (in FIG. 2(a), m/z (observed): 31,955, m/z (calculated): 31,514), a trimer signal (in FIG. 2(b), m/z (observed): 95,257, m/z (calculated): 94,542), and a hexamer (trimer-dimer) signal (in FIG. 2(c), m/z (observed): 190,929, m/z (calculated): 189,084). Further, the MALDI-TOF mass spectra regarding PN-sFL-VPg showed a PN-sFL-VPg monomer signal (in FIG. 3(a), m/z (observed): 31,266, m/z (calculated): 31,396), a trimer signal (in FIG. 3(b), m/z (observed): 93,857, m/z (calculated): 94,188), and a hexamer (trimer-dimer) signal (in FIG. 3(c), m/z (observed): 187,218, m/z (calculated): 188,376).

[0099] From the above experimental results, the associated product of the present invention was found to include a trimer and a hexamer.

[Example 2] Component Vaccine Against RS Virus

(a) Introduction

[0100] In Example 2, a composite protein falling within the scope of the present invention was prepared through a genetic engineering technique. The composite protein had an immunogen, which is a non-structural protein of a human RS virus Long variant; specifically, “P protein (phosphorylated protein: protein involved in phosphorylation).” P protein is encoded by a template sequence of messenger RNA of P protein in the RS virus genome. Each particle of RS virus has a minus-strand as the genome. As shown in FIG. 4, a complementary chain of messenger RNA of each protein is present at each position. Once cells have been infected with RS virus, messenger RNA of each protein is synthesized by RNP (as described above) using the genomic minus-chain as a template. Each messenger RNA includes an initiation codon and a termination codon. Through translation in cells, corresponding proteins are generated. The virus proteins formed via translation undergo a maturation step and exhibit a virus protein function. P protein forms a tetramer, which binds to L protein and RNP on its the C-terminal side, whereby L protein and RNP are linked by the mediation of the tetramer. On the N-terminal side, P protein serves as a chaperone that can bind free N protein to RNA during synthesis. RNP is surrounded by an envelope originating from a host cell membrane. On the surface of the envelope, two virus glycoproteins; i.e., a receptor binding protein and a fusion protein (F protein), form spikes.

[0101] In Example 2, the aforementioned P protein was selected as a non-structural protein component of W. The actually used P protein of RSV Long variant (RSV-P) serving as an immunogen has an amino acid sequence of SEQ ID NO: 23

TABLE-US-00003 “MEKFAPEFHGEDANNRATKFLESIKGKFTSPKDPKKKDSIISVNSIDIE VTKESPITSNSTIINPTNETDDNAGNKPNYQRKPLVSFKEDPIPSDNPFS KLYKETIETFDNNEEESSYSYEEINDQTNDNITARLDRIDEKLSEILGML HTLVVASAGPTSARDGIRDAMVGLREEMIEKIRTEALMTNDRLEAMARLR NEESEKMAKDTSDEVSLNPTSEKLNNLLEGNDSDNDLSLDDF.”
The nucleotide sequence encoding the amino acid sequence may be selected in accordance with a generally known amino acid-nucleobase relationship. In Example 2,

TABLE-US-00004 (SEQ ID NO: 24) “ATGGAAAAGTTTGCTCCTGAATTCCATGGAGAAGATGCAAACAACAGGG CTACTAAATTCCTAGAATCAATAAAGGGCAAATTCACATCACCTAAAGAT CCCAAGAAAAAAGATAGTATCATATCTGTCAACTCAATAGATATAGAAGT AACCAAAGAAAGCCCTATAACATCAAATTCAACCATTATTAACCCAACAA ATGAGACAGATGATAATGCAGGGAACAAGCCCAATTATCAAAGAAAACCT CTAGTAAGTTTCAAAGAAGACCCTATACCAAGTGATAATCCCTTTTCAAA ACTATACAAAGAAACCATAGAGACATTTGATAACAATGAAGAAGAATCTA GCTATTCATATGAAGAAATAAATGATCAGACGAACGATAATATAACTGCA AGATTAGATAGGATTGATGAAAAATTAAGTGAAATACTAGGAATGCTTCA CACATTAGTAGTAGCAAGTGCAGGACCTACATCTGCTAGGGATGGTATAA GAGATGCCATGGTTGGTTTAAGAGAAGAAATGATAGAAAAAATCAGAACT GAAGCATTAATGACCAATGACAGATTAGAAGCTATGGCAAGACTCAGGAA TGAGGAAAGTGAAAAGATGGCAAAAGACACATCAGATGAAGTGTCTCTCA ATCCAACATCAGAGAAATTGAACAACCTGTTGGAAGGGAATGATAGTGAC AATGATCTATGAGTTGATGATTTC(TGA)” was employed.

[0102] All the reagents employed in Example 2 were purchased from commercial suppliers and used without additional purification. The RSV-P gene fragment was obtained from the genome RNA of RSV-Long variant provided by Sawada, Virus Infection I, Omura Satoshi Memorial Institute, Kitasato University. Specifically, a terminal stop codon (TGA in parenthesis mentioned above) was removed from the P protein gene sequence, and the resultant part was amplified.

(b) Production and Expression of Plasmid for Forming “PN-P Protein” Through Gene Expression

[0103] In Example 2, a plasmid structure “PN-FL-P” of interest was constructed through the following procedure. Specifically, the aforementioned RSV-Long variant was subjected to PCR amplification, to amplify the nucleotide sequence (SEQ ID NO: 24) encoding P protein. From the thus-amplified nucleotide sequence (SEQ ID NO: 24) encoding P protein, the terminal stop codon (TGA) was removed, to thereby yield a gene fragment. Using the template plasmid structure “PN-FL-VPg” produced in “Example 1(b)-2” as a template, the gene fragment was substituted with VPg through In-Fusion cloning, to obtain the plasmid structure “PN-FL-P” of interest.

[0104] In a more specific procedure, the P domain was amplified by the mediation of

TABLE-US-00005 In-Fusion RS-P sense (SEQ ID NO: 25) 5′-GGAGATATACATATGGAAAAGTTTGCTCCTGA-3′ and In-Fusion RS-P antisense (SEQ ID NO: 26) 5′-TGAACCCCCGCCTCCGAAATCATCAAGTGATAGAT-3′,
to thereby yield a P domain amplification product into which the underlined portions had been added. Separately, inverted PCR was performed by use of 5′-GGAGGCGGGGGTTCA-3′ (SEQ ID NO: 27) and 5′-ATGTATATCTCCTTCTTAAAG-3′ (SEQ ID NO: 28) as primers with the template plasmid structure “PN-FL-VPg” as a template, to thereby amplify the entirety of the vector portion excepting the sequence of VPg. Thus, a vector body was provided. These two fragments were linked through In-Fusion cloning, to thereby yield a plasmid structure “PN-FL-P” of interest.

[0105] Subsequently, the above plasmid was introduced into DH5α-competent cells. The thus-obtained vector was identified through DNA nucleotide sequencing and then, PN-sFL-P was formed through gene expression.

[0106] E. Coli BL21 (DE3) having the “PN-sFL-P” plasmid was incubated overnight in an LB medium containing 30 μg/mL Kanamicyn at 37° C. After the OD.sub.600 of the incubated solution (37° C.) had reached 0.8, 1 mM isopropyl-β-D-1-thiogalactopyranoside (IPTG) and arabinose were added to the solution. Sixteen (16) to seventeen (17) hours after addition of IPTG and arabinose, the solution was centrifuged at 8,000 rpm for 5 minutes, to thereby recover microorganism pellets, and the recovered matter was incubated at 20° C. and a rotation rate of 180 rpm. Subsequently, on ice, the cell pellets were suspended in 100 mM Tris-HCl (pH: 8.0) buffer containing 5 mM imidazole with one tablet of “cOmplete, EDTA-free,” and the cells were lysed through ultrasonication. Cell broken pieces were removed through centrifugation (17,500 rpm for 50 minutes). The supernatant was filtered through a 0.8 μm filter, and the filtrate was added to an Ni affinity column. The added matter was eluted at 4° C. with the same buffer under a linear imidazole concentration gradient of 5 mM to 250 mM. Thereafter, the PN-FL-P associated product was dialyzed against 20 mM Tris-HCl (pH: 8.0) and 0.2 M NaCl and further against PBS, and the dialysis product was concentrated through ultrafiltration. Through this process, PN-sFL-P spontaneously yielded an associated product containing a trimer and/or a hexamer thereof. The thus-obtained product was employed in immunoassay as a “PN-sFL-P associated product.” As a control, a recombinant P protein (hereinafter abbreviated as P protein) was obtained based on the aforementioned nucleotide sequence encoding the P protein through a customary procedure according to a series of processes from expression to recovery of “PN-sFL-P.”

[0107] The immunoassay was conducted through nasal immunization by use of 10 μg/mL PBS solution (purified antigen).

(c) Immunoassay (1) of Example 2 (Antibody Titer Measurement)

[0108] Each of the aforementioned PN-sFL-P associated product (PN(+)) and P protein (PN(−)) was nasally inoculated to RS virus-susceptible cotton rats. In all nasal inoculation cases, a vaccine liquid was added dropwise to the nasal cavity, and a purified antigen was caused to be inhaled at 1 mL (10 μg) per rat through the nasal cavity under anesthesia. The nasal inoculation included initial inoculation and booster inoculations three times in total at intervals of 7 days. Blood collection was performed before the initial inoculation, 1 week after the initial inoculation (before the first booster), 2 weeks after the initial inoculation (before the second booster), 3 weeks after the initial inoculation (before the third booster), and 7 weeks after the initial inoculation. Each blood sample was caused to react with RSVP protein, and the IgG titer and the IgA titer to RSVP protein were determined through ELISA.

[0109] Eight weeks after the initial inoculation, the final booster was conducted.

[0110] In a specific procedure of ELISA, the antigen (RSVP protein) was diluted with PBS(−) to 2 μg/mL. The diluted antigen was added to a 96-well ELISA plate at 50 μL/well and incubated overnight at 4° C. The plate was washed thrice with PBST (0.1% Tween 20/PBS) and then, PBSB (1% BSA/PBS) was added to the plate at 80 μL/well. Incubation was further conducted at room temperature for 2 hours for blocking. Subsequently, a test serum sample was diluted with PBSB, to thereby prepare test samples (for IgG detection: 5-fold dilution series (10-fold to 31,250-fold), and for IgA detection: 3-fold dilution series (10-fold to 2,430-fold). PBSB in the plate was removed, and each test sample was added to the plate at 50 μL/well. Incubation was performed at room temperature for 2 hours, and the plate was washed 5 times with PBST. Then, an HRP substrate solution was added to the plate at 50 μL/well. Incubation was performed at room temperature under light shielding conditions until color development was confirmed. The reaction was stopped by adding 2 M sulfuric acid to the plate at 25 μL/well, and absorbance at 490 nm was measured.

[0111] FIG. 5 shows the results of ELISA (IgG), and FIG. 6 shows the results of ELISA (IgA), obtained 3 weeks after the initial inoculation (3W) and 7 weeks after the initial inoculation (7W), respectively. In each graph of FIGS. 5 and 6, the vertical axis represents absorbance, and the horizontal axis represents dilution ratio. The graphs show the results of the cotton rats tested under different conditions. As shown in the graphs, when the rats were immunized directly with P protein, no rise in absorbance in response to antibody titer was observed in both cases of IgG and IgA. In contrast, when immunization was conducted with the associated product of the present invention, the antibody titers (i.e., absorbance values) were found to rise remarkably. Furthermore, it was noteworthy that such a remarkable rise in antibody titer was attained by use of no adjuvant. Therefore, the associated product of the present invention can possibly be used as an adjuvant-free vaccine.

[0112] An RS virus infection is caused by inhaling the RS virus via droplet infection. That is, the infection mainly is caused via the oral cavity or the nasal cavity. Thus, in Example 2, the associated product was nasally inoculated, whereby the associated product directly penetrated the mucosal cells of the nasal cavity through the cell membranes, resulting in the injection of P protein into the nasal mucosal cells. In the nasal cavity, cell-mediated immunity and humoral immunity were induced by the injected P protein, to thereby elicit protective immunity to RS virus. Thus, when a molecular needle to which a non-structural protein of RS virus was attached was nasally inoculated as an immunogen, topical immunity was found to be induced, to thereby attain an effect of preventing infection with RS virus and an effect of mitigating the infection-related symptoms. Particularly, induction of IgA to P protein, which is a non-structural protein of RS virus, is expected to inhibit the function of P protein through a mechanism including binding to the P protein upon secretion of IgA formed in blood into the mucosal layer through cells.

(d) Immunoassay (2) of Example 2 (Lung Inflammatory Inhibiting Effect)

[0113] In the immunoassay (2), RS virus-susceptible cotton rats were immunized with a molecular needle to which an RS virus non-structural protein had been attached, and the rats were tested. Through employment of the rats, the effect of inhibiting lung inflammation caused by RS virus infection was directly investigated.

[0114] To each of the RS virus-susceptible cotton rats, the aforementioned PN-sFL-P associated product (PN(+)) or P protein (PN(−)) was nasally inoculated. In all cases of the nasal inoculation, a purified antigen was caused to be administered at 1 mL (10 μg) via inhalation through the nasal cavity under anesthesia. Similar to the case of the aforementioned “Immunoassay (1),” nasal inoculation was performed. Specifically, initial inoculation was performed, and then booster inoculations were conducted three times in total at intervals of 7 days, and the final booster was performed eight weeks after the initial inoculation. Further, one week thereafter, the test rats were infected with RS virus. The dose of RS virus infection was 2×10.sup.5 PFU/mL, and the infection was conducted in a manner similar to that of the vaccine inoculation (i.e., nasal inoculation).

[0115] Four days after the aforementioned infection, the lung tissue was recovered from each tested rat, and the infection amount of RS virus in the lung was determined. Specifically, the lung (i.e., an infection target tissue) was removed from each rat, and suspended in a medium by a homogenizer, to thereby release the RS virus. The amount of infectious virus contained in the lung tissue (50 mg) was determined through plaque assay.

[0116] In addition to the tested rats, there were also employed a positive control group (the aforementioned cotton rats infected with RS virus without nasal inoculation in advance) and a negative control group (the aforementioned cotton rats not infected with RS virus and not subjected to nasal inoculation in advance).

[0117] The results are shown in FIG. 7. As shown in FIG. 7, on the horizontal axis, the term “Not infected” represents the negative control (n=1), PN(+) PN-sFL-P associated product (n=3), PN(−) P protein (n=3), and “Not immunized” the positive control (n=3). The vertical axis represents the RS virus titer (PFU/50 mg in lung tissue) of the recovered lung tissue. As is clear from FIG. 7, RS virus infection of rats to which the PN-sFL-P associated product had been administered was found to be inhibited at a ratio of ½ or more with a significance of (P<0.0001), as compared with the case of RS virus-infected rats (the positive control).

[0118] Based on the above results, the vaccine of the present invention was found to exhibit substantial virus infection inhibitory effect through, in particular, topical immunity induction such as mucosal membrane immunity induction or cell-mediated immunity induction.

[Example 3] In Case Where RS Virus Structural Protein is Attached

[0119] As described above, the RNP of RS virus (RSV) is surrounded by an envelope originating from a host cell membrane. On the surface of the envelope, two virus glycoproteins (structural proteins); i.e., a receptor binding protein and a fusion protein (F protein), form a spike. In Example 3, four units of a peptide formed of 13 amino acids (SEQ ID NO: 29: DMPITNDQKKLMS) forming the neutralization epitope domain of the F protein (as a structural protein) were linked in line, to thereby form a (quadruple) fusion protein. The resultant protein was attached as an immunogen W to a molecular needle, to thereby yield an associated product. The associated product was tested in a manner similar to that of the immunoassay performed in Example 2.

[0120] The F protein of RS virus (RSV) is formed of 574 amino acids (SEQ ID NO: 30:

TABLE-US-00006 MELPILKANAITTILAAVTFCFASSQNITEEFYQSTCSAVSKGYLSALRT GWYTSVITIELSNIKENKCNGTDAKVKLINQELDKYKNAVTELQLLMQST TAANNRARRELPRFMNYTLNNTKKTNVTLSKKRKRRFLGFLLGVGSAIAS GIAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYID KQLLPIVNKQSCRISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTY MLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYV VQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKT DVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTV SVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKIN QSLAFIRKSDELLHHVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYC KARSTPVTLSKDQLSGINNIAFSN: GenBank accession # AY911262).

[0121] The domain ranging from the 263th amino acid to the 275th amino acid serves as an epitope domain recognized by a neutralizing antibody. A gene encoding a (quadruple) fusion protein in which four units of the epitope domain of F protein were linked in line by the mediation of (GGGG) was created. Then, a plasmid (pET29b(+)/F-PN) which was designed to fuse with PN by the mediation of a linker (GGGGS: SEQ ID NO: 15) was created. E. coli (BL21 DE3) cells were transformed with the plasmid (FIG. 8), and expression was induced by IPTG. The expression product was recovered as a soluble protein. The aforementioned associated product of the quadruple fusion protein (Fnep×4-PN associated product (PN(+)) was purified with TAIRON, and the immunoassay of Example 3 was conducted.

(a) Immunoassay (1) of Example 3 (Antibody Titer Measurement)

[0122] Each of the Fnep×4-PN associated product (PN(+)) and the quadruple fusion protein of the neutralization epitope of F protein (PN(−)) was nasally inoculated to RS virus-susceptible cotton rats. In all nasal inoculation cases, a vaccine liquid was added dropwise to the nasal cavity, and the vaccine was caused to be inhaled. Specifically, a purified antigen was caused to be inhaled at 1 mL (20 μg) per rat through the nasal cavity under anesthesia. The nasal inoculation included initial inoculation, and then booster inoculations conducted three times in total at intervals of 7 days. Blood collection was performed before the initial inoculation, 1 week after the initial inoculation (before the first booster), 2 weeks after the initial inoculation (before the second booster), 3 weeks after the initial inoculation (before the third booster), and 7 weeks after the initial inoculation. Each blood sample was caused to react with F protein, and the IgG titer and the IgA titer to F protein were determined through ELISA.

[0123] Nine weeks after the initial inoculation, the final booster was conducted.

[0124] ELISA was performed in a manner similar to that of Example 2. However, as described above, F protein was used as an antigen.

[0125] The results (3 weeks after) are shown in FIG. 9 (in terms of IgA and IgG). In each graph of FIG. 9, the vertical axis represents absorbance, and the horizontal axis represents dilution ratio. The graphs show the results of the cotton rats tested under different conditions. As shown in the graphs, when the rats were immunized directly with the quadruple fusion protein of the neutralization epitope of F protein, no rise in absorbance in response to antibody titer was observed in both cases of IgG and IgA. In contrast, when immunization was conducted with the Fnep×4-PN associated product, the antibody titers (i.e., absorbance values) were found to rise. The rise in antibody titer was remarkable for IgG, but was observed with variation for IgA.

(b) Immunoassay (2) of Example 3 (Lung Inflammatory Inhibiting Effect)

[0126] In immunoassay (2), RS virus-susceptible cotton rats were immunized with a molecular needle to which the quadruple fusion protein of the neutralization epitope of F protein (serving as an RS virus non-structural protein) was attached, and the rats were tested. Through employment of the rats, the effect of inhibiting lung inflammation caused by RS virus infection was directly investigated.

[0127] Each of the Fnep×4-PN associated product (PN(+)) and the quadruple fusion protein of the neutralization epitope of F protein (PN(−)) was nasally inoculated to RS virus-susceptible cotton rats. In all nasal inoculation cases, a purified antigen was caused to be inhaled at 1 mL (20 μg) per rat through the nasal cavity under anesthesia. The nasal inoculation was conducted in a manner similar to that of “Immunoassay (1).” The nasal inoculation included initial inoculation and then booster inoculations three times in total at intervals of 7 days. Seven weeks after the initial inoculation, the final booster was conducted. Two weeks after the final booster, the test rats were infected with RS virus. The infection dose of the RS virus was 2×10.sup.5 PFU/mL, and the infection was conducted in a manner similar to that of the vaccine inoculation (i.e., nasal inoculation).

[0128] Four days after the aforementioned infection, the lung tissue was recovered from each tested rat, and the infection amount of RS virus in the lung was determined. Specifically, the lung (i.e., an infection target tissue) was removed from each rat and suspended in a medium by means of a homogenizer, to thereby release the RS virus. The amount of the infectious virus in the lung tissue (50 mg) was determined through plaque assay.

[0129] In addition to the test rats, there were also employed a positive control group (the aforementioned cotton rats infected with RS virus without nasal inoculation in advance) and a negative control group (the aforementioned cotton rats not infected with RS virus and not subjected to nasal inoculation in advance).

[0130] The results are shown in FIG. 10. As shown in FIG. 10, on the horizontal axis, the term “Not infected” represents the negative control (n=1), PN(+) Fnep×4PN associated product (n=3), PN(−) the quadruple fusion protein of the neutralization epitope of F protein (n=3), and “Not immunized” the positive control (n=3). The vertical axis represents the RS virus titer (PFU/50 mg of lung tissue) of the recovered lung tissue. As is clear from FIG. 10, the rats to which the Fnep×4PN associated product had been administrated exhibited a reduced RS virus infection of about 36% with a significance of P<0.0001, as compared with RS virus-infected rats (the positive control).

[0131] As is clear from the test results, the needle vaccine containing the associated product having the quadruple fusion protein of the neutralization epitope of F protein (i.e., the structural protein of RS virus) of Example 3 was found to induce topical immunity such as mucosal immunity or cell-mediated immunity. However, the thus-attained effect was found to be weaker than that of the vaccine of the present invention employing a non-structural protein. This indicates that the virus-neutralizing effect of the secretory IgA (sIgA) (i.e., an antibody which was induced through immunization by the associated product having the quadruple fusion protein of the neutralization epitope of F protein, and secreted to the mucin layer of the mucosal epithelium) alone has a limited ability to inhibit virus infection and proliferation. In contrast, the vaccine of the present invention (i.e., the molecular needle employing P protein (a non-structural protein)) was found to more effectively inhibit RS virus infection and proliferation on the basis of cell-mediated immunity induced through immunization with the vaccine of the present invention. In addition, it is considered that the following phenomenon appears as a further effect of the vaccine of the present invention: When IgA molecules synthesized by B cells in blood are taken up into mucosal epithelial cells from the basement membrane side and secreted to the mucosal surface, production of a P-polymerase complex formed between P protein and the polymerase of RS virus is inhibited during passage through the cells.

[0132] Further, a component vaccine containing, for example, the associated product of the present invention of Example 2 which has P protein (i.e., a non-structural protein of RS virus), and an associated product of a molecular needle having a structural protein, such as the associated product of Example 3 which has the quadruple fusion protein of the neutralization epitope of F protein (i.e., a structural protein of RS virus), in combination as active ingredients is expected to have a synergistic effect due to the combination.