MUTATED ARYLSULFATASE A
20230058973 · 2023-02-23
Inventors
Cpc classification
International classification
Abstract
The present invention pertains to a novel treatment of pathologies caused by an increased synthesis or accumulation of sulfolipids such as sulfatide. The invention provides mutated arylsulfatase A (ARSA or ASA, EC 3.1.6.8) enzymes with increased activity towards sulfatide metabolization. The invention provides nucleic acids encoding the mutant ARSA, the use of the proteins and nucleic acids, as well as pharmaceutical compositions comprising them, in the treatment of lysosomal storage disorders (LSDs) such as metachromatic leukodystrophy (MLD).
Claims
1. A mutated arylsulfatase A (ARSA) enzyme, or a functional fragment thereof, comprising an amino acid sequence with at least 80% sequence identity to SEQ ID NO: 1, wherein the mutated ARSA enzyme amino acid sequence when aligned to the sequence of SEQ ID NO: 1, comprises at least one mutation compared to the sequence between residues 100 and 400 of SEQ ID NO: 1.
2. The mutated ARSA enzyme, or the functional fragment thereof, according to claim 1, wherein the amino acid sequence of the mutated ARSA enzyme, or of the functional fragment thereof, when aligned to the sequence of SEQ ID NO: 1, comprises at least one mutation at amino acid positions 202, 286 and/or 291 of SEQ ID NO: 1, and, preferably, comprises an amino acid sequence at least 80% identical to the sequence of SEQ ID NO: 3 or 4.
3. The mutated ARSA enzyme, or the functional fragment thereof, according to claim 1, wherein the mutation is selected from a substitution, deletion, addition, insertion or amino acid modification, and preferably is an amino acid substitution.
4. The mutated ARSA enzyme, or the functional fragment thereof, according to claim 1, wherein the mutation is a murinization of a residue in the human ARSA enzyme to a corresponding murine ARSA enzyme residue.
5. The mutated ARSA enzyme, or the functional fragment thereof, according to claim 1, wherein the amino acid sequence of the mutated ARSA enzyme, or of the functional fragment thereof, when aligned to the sequence of SEQ ID NO: 1, comprises at least one mutation selected from M202V, T286L and/or R291N compared to SEQ ID NO: 1, preferably of at least M202V.
6. The mutated ARSA enzyme, or the functional fragment thereof, according to claim 1, wherein mutated ARSA enzyme, or the functional fragment thereof, retains an enzymatic activity of degradation of sulfatides, preferably an activity of degradation of cerebroside 3-sulfate into cerebroside and sulfate.
7. An isolated nucleic acid comprising a sequence coding for the mutated ARSA enzyme, or the functional fragment thereof, wherein the mutated ARSA enzyme comprises an amino acid sequence with at least 80% sequence identity to SEQ ID NO: 1, wherein the mutated ARSA enzyme amino acid sequence when aligned to the sequence of SEQ ID NO: 1, comprises at least one mutation compared to the sequence between residues 100 and 400 of SEQ ID NO: 1.
8. A vector, comprising the nucleic acid according to claim 7.
9. The vector according to claim 8, which is an expression vector, comprising promoter sequence operably linked to the nucleic acid.
10. A recombinant cell comprising a mutated ARSA enzyme, or the functional fragment thereof, or a nucleic acid or vector encoding the mutated ARSA, wherein the mutated ARSA enzyme comprises an amino acid sequence with at least 80% sequence identity to SEQ ID NO: 1, wherein the mutated ARSA enzyme amino acid sequence when aligned to the sequence of SEQ ID NO: 1, comprises at least one mutation compared to the sequence between residues 100 and 400 of SEQ ID NO: 1.
11. The recombinant cell according to claim 10, which is a bacterial cell, an insect cell or a vertebrate, preferably a mammalian cell such as a Chinese Hamster Ovary (CHO) cell, or a hematopoietic stem cell (HSC).
12. A pharmaceutical composition comprising the mutated ARSA enzyme, or the functional fragment thereof, or a nucleic acid or vector encoding the mutated ARSA, or a recombinant cell comprising the mutated ARSA or comprising the nucleic acid or vector, wherein the mutated ARSA enzyme comprises an amino acid sequence with at least 80% sequence identity to SEQ ID NO: 1, wherein the mutated ARSA enzyme amino acid sequence when aligned to the sequence of SEQ ID NO: 1, comprises at least one mutation compared to the sequence between residues 100 and 400 of SEQ ID NO: 1.
13. A method for the treatment of a disease in a subject, the method comprising administering to the subject a mutated ARSA enzyme, or a nucleic acid or vector encoding the mutated ARSA enzyme, wherein the mutated ARSA enzyme comprises an amino acid sequence with at least 80% sequence identity to SEQ ID NO: 1, wherein the mutated ARSA enzyme amino acid sequence when aligned to the sequence of SEQ ID NO: 1, comprises at least one mutation compared to the sequence between residues 100 and 400 of SEQ ID NO: 1.
14. (canceled)
15. A method for designing and/or producing a mutated ARSA enzyme, or a functional fragment thereof, comprising the steps of (a) providing a parent ARSA enzyme-encoding nucleic acid sequence which encodes a parent ARSA enzyme having an amino acid sequence with at least 80% sequence identity to SEQ ID NO: 1, or a functional fragment thereof, (b) introducing into said parent ARSA enzyme-encoding nucleic acid sequence, or the functional fragment thereof, at least one mutation, thereby generating a mutated ARSA enzyme-, or functional fragment thereof, -encoding nucleic acid sequence, wherein the mutated ARSA enzyme, or functional fragment thereof, -encoding nucleic acid sequence encodes a mutated ARSA enzyme, or a functional fragment thereof, comprising a mutated ARSA enzyme amino acid sequence, that, when aligned to the sequence of SEQ ID NO: 1, comprises at least one mutated amino acid residue compared to the sequence of SEQ ID NO: 1 between residues 100 and 400, and wherein said at least one mutated amino acid residue constitutes a mutation when compared to the amino acid sequence of the parent ARSA enzyme, (c) Optionally, expressing said mutated ARSA enzyme-, or functional fragment thereof, -encoding nucleic acid sequence, to obtain a mutated ARSA enzyme, or the functional fragment thereof.
Description
[0065] The present invention will now be further described in the following examples with reference to the accompanying figures and sequences, nevertheless, without being limited thereto.
[0066] For the purposes of the present invention, all references as cited herein are incorporated by reference in their entireties. In the Figures:
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080] SEQ ID NO: 1 shows the sequence of wild type human ARSA protein including the signal peptide (underlined) and most preferred positions for mutation (bold and underlined):
TABLE-US-00001 MGAPRSLLLALAAGLAVARPPNIVLIFADDLGYGDLGCYGHPSSTTPNLD QLAAGGLRFTDFYVPVSLCTPSRAALLTGRLPVRMGMYPGVLVPSSRGGL PLEEVTVAEVLAARGYLTGMAGKWHLGVGPEGAFLPPHQGFHRFLGIPYS HDQGPCQNLTCFPPATPCDGGCDQGLVPIPLLANLSVEAQPPWLPGLEAR YMAFAHDLMADAQRQDRPFFLYYASHHTHYPQFSGQSFAERSGRGPFGDS LMELDAAVGTLMTAIGDLGLLEETLVIFTADNGPETMRMSRGGCSGLLRC GKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPLPN VTLDGFDLSPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFT QGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGENYNLLGGVAGATP EVLQALKQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACC HCPDPHA
[0081] SEQ ID NO: 2 shows the wild type human ARSA encoding nucleic acid sequence (cDNA). The preferred positions for mutations are in bold and underlined.
TABLE-US-00002 GGGGCACCGCGGTCCCTCCTCCTGGCCCTGGCTGCTGGCCTGGCCG TTGCCCGTCCGCCCAACATCGTGCTGATCTTTGCCGACGACCTCGGCTA TGGGGACCTGGGCTGCTATGGGCACCCCAGCTCTACCACTCCCAACCTG GACCAGCTGGCGGCGGGAGGGCTGCGGTTCACAGACTTCTACGTGCCTG TGTCTCTGTGCACACCCTCTAGGGCCGCCCTCCTGACCGGCCGGCTCCC GGTTCGGATGGGCATGTACCCTGGCGTCCTGGTGCCCAGCTCCCGGGGG GGCCTGCCCCTGGAGGAGGTGACCGTGGCCGAAGTCCTGGCTGCCCGAG GCTACCTCACAGGAATGGCCGGCAAGTGGCACCTTGGGGTGGGGCCTGA GGGGGCCTTCCTGCCCCCCCATCAGGGCTTCCATCGATTTCTAGGCATC CCGTACTCCCACGACCAGGGCCCCTGCCAGAACCTGACCTGCTTCCCGC CGGCCACTCCTTGCGACGGTGGCTGTGACCAGGGCCTGGTCCCCATCCC ACTGTTGGCCAACCTGTCCGTGGAGGCGCAGCCCCCCTGGCTGCCCGGA CTAGAGGCCCGCTACATGGCTTTCGCCCATGACCTCATGGCCGACGCCC AGCGCCAGGATCGCCCCTTCTTCCTGTACTATGCCTCTCACCACACCCA CTACCCTCAGTTCAGTGGGCAGAGCTTTGCAGAGCGTTCAGGCCGCGGG CCATTTGGGGACTCCCTGATGGAGCTGGATGCAGCTGTGGGGACCCTGA TGACAGCCATAGGGGACCTGGGGCTGCTTGAAGAGACGCTGGTCATCTT CACTGCAGACAATGGACCTGAGACCATGCGTATGTCCCGAGGCGGCTGC TCCGGTCTCTTGCGGTGTGGAAAGGGAACGACCTACGAGGGCGGTGTCC GAGAGCCTGCCTTGGCCTTCTGGCCAGGTCATATCGCTCCCGGCGTGAC CCACGAGCTGGCCAGCTCCCTGGACCTGCTGCCTACCCTGGCAGCCCTG GCTGGGGCCCCACTGCCCAATGTCACCTTGGATGGCTTTGACCTCAGCC CCCTGCTGCTGGGCACAGGCAAGAGCCCTCGGCAGTCTCTCTTCTTCTA CCCGTCCTACCCAGACGAGGTCCGTGGGGTTTTTGCTGTGCGGACTGGA AAGTACAAGGCTCACTTCTTCACCCAGGGCTCTGCCCACAGTGATACCA CTGCAGACCCTGCCTGCCACGCCTCCAGCTCTCTGACTGCTCATGAGCC CCCGCTGCTCTATGACCTGTCCAAGGACCCTGGTGAGAACTACAACCTG CTGGGGGGTGTGGCCGGGGCCACCCCAGAGGTGCTGCAAGCCCTGAAAC AGCTTCAGCTGCTCAAGGCCCAGTTAGACGCAGCTGTGACCTTCGGCCC CAGCCAGGTGGCCCGGGGCGAGGACCCCGCCCTGCAGATCTGCTGTCAT CCTGGCTGCACCCCCCGCCCAGCTTGCTGCCATTGCCCAGATCCCCATG CC
[0082] SEQ ID NO: 3 shows the amino acid sequence of a mutated ARSA of the invention including one amino acid substitution. The mutation is bold and underlined.
TABLE-US-00003 MGAPRSLLLALAAGLAVARPPNIVLIFADDLGYGDLGCYGHPSSTTPNLD QLAAGGLRFTDFYVPVSLCTPSRAALLTGRLPVRMGMYPGVLVPSSRGGL PLEEVTVAEVLAARGYLTGMAGKWHLGVGPEGAFLPPHQGFHRFLGIPYS HDQGPCQNLTCFPPATPCDGGCDQGLVPIPLLANLSVEAQPPWLPGLEAR YVAFAHDLMADAQRQDRPFFLYYASHHTHYPQFSGQSFAERSGRGPFGDS LMELDAAVGTLMTAIGDLGLLEETLVIFTADNGPETMRMSRGGCSGLLRC GKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPLPN VTLDGFDLSPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFT QGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGENYNLLGGVAGATP EVLQALKQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACC HCPDPHA
[0083] SEQ ID NO: 4 shows the amino acid sequence of a mutated ARSA of the invention including three amino acid substitution. The mutations are bold and underlined.
TABLE-US-00004 MGAPRSLLLALAAGLAVARPPNIVLIFADDLGYGDLGCYGHPSSTTPNLD QLAAGGLRFTDFYVPVSLCTPSRAALLTGRLPVRMGMYPGVLVPSSRGGL PLEEVTVAEVLAARGYLTGMAGKWHLGVGPEGAFLPPHQGFHRFLGIPYS HDQGPCQNLTCFPPATPCDGGCDQGLVPIPLLANLSVEAQPPWLPGLEAR YVAFAHDLMADAQRQDRPFFLYYASHHTHYPQFSGQSFAERSGRGPFGDS LMELDAAVGTLMTAIGDLGLLEETLVIFTADNGPELMRMSNGGCSGLLRC GKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPLPN VTLDGFDLSPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFT QGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGENYNLLGGVAGATP EVLQALKQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACC HCPDPHA
EXAMPLES
Example 1
Comparison of Human and Murine ARSA Enzyme Activity
[0084] The rate of galactosylceramide (galcer) formation was measured by an established micellar assay (Matzner U et al., J Biol Chem, 2009, 284, 9372-81). For the reaction, purified ARSA (ASA, 1 μg) was incubated with 5 nmol sulfatide (sulf) in the presence of 0.33 nmol saposin B (SapB) in 10 mM sodium acetate buffer pH 4.5 at 37° C. Experiments were done in triplicates (#1-3). After incubation times of 30 and 60 min, respectively, lipids were extracted (Folch J et al., J Biol Chem., 1957, 226, 497-509) and separated by thin layer chromatography. Under in vitro conditions, the bile salt taurodeoxycholate (TDC), but not unconjugated deoxycholate, can functionally substitute for SapB. TDC (100 nmol) and deoxycholate (100 nmol) were used instead of SapB in positive (pos) and negative controls (neg), respectively. Results are shown in
[0085] The intensity of the galactosylceramide band is a measure for the catalytic rate of ARSA. The densitometric evaluation of the galactosylceramide band (not shown) revealed a 3- to 4-fold higher catalytic rate of murine ARSA compared to human ARSA.
Example 2
Mutagenesis of Human ARSA
[0086] In order to identify targets responsible for the increased activity of murine ARSA compared to human ARSA, the amino acid sequences of both enzymes were compared (
[0087] Using site-directed mutagenesis (see
[0088] In
[0089] In
[0090] As shown in
[0091] Based on the observation that murinization of either v4 or v6 increased the specific activity of the human ARSA (see
[0092] Various combinations of amino acid and domain exchanges were constructed to identify individual amino acids in v4 and v6 that increase the ARSA activity (
[0093] The construct M202V, x:v6 combines the three amino acid exchanges M202V, T286L and R291N (
[0094] To detect amino acid exchanges in variable domain v5 which might increase the specific activity of M202V, T286L, R291N (=M202V, x:v6) individual amino acids of v5 (T260, I265) or the entire v5-domain was murinized as indicated (
Example 3
Specific Activities of ARSA Mutants
[0095] To determine the specific activities of the murinized ARSA polypeptides four different methods to measure enzyme concentrations were compared (
Example 4
Endocytosis of Mutated ARSA
[0096] In preparation of a proof-of-concept study demonstrating increased therapeutic efficacy of the hyperactive ARSA mutants additional experiments were conducted. In particular, the endocytosis, stability and immunogenicity of the hyperactive ARSA mutants were analysed. Furthermore, the recombinant ARSAs were purified in milligram amounts being sufficient for a preclinical enzyme replacement trial in the near future. For this purpose, ARSA_M202V and ARSA_M202V,T286L,R291N were continuously expressed over 6 months as Strep-tagged recombinant proteins by Chinese hamster ovary (CHO) suspension cells and isolated from the conditioned medium by affinity chromatography. In parallel, similar amounts of Strep-tagged wildtype human ARSA and Strep-tagged wildtype murine ARSA were purified as controls.
[0097] Enzyme replacement therapy depends on efficient uptake of the infused lysosomal enzyme by the enzyme-deficient cells of the patient. ARSA is primarily endocytosed via mannose 6-phosphate receptors that recognize mannose 6-phosphate residues that are attached to the N-glycans of the enzyme during its synthesis in the endoplasmic reticulum and Golgi apparatus. To analyse a possible adverse effect of the mutations on this posttranslational modification and the endocytic rate, CHO-K1 cells were fed with recombinantly expressed ARSA mutants or wildtype human ARSA for 24 h and the amount of internalized ARSA was determined by activity measurements. No significant difference in the endocytosis of wildtype human ARSA, ARSA_M202V and ARSA_M202V,T286L,R291N was discernible (
Example 5
Stability of Mutated ARSA
[0098] Higher enzymatic activity can be a consequence of increased conformational flexibility of loop and hinge regions in the polypeptide scaffold promoting the active site dynamics and the velocity of the catalytic cycle. The stability of an enzyme is therefore often inversely correlated with its activity (Miller, S R.; 2017 Evolution 71, 1876-1887). To analyse possible consequences of the activity-promoting amino acid exchanges M202V,T286L and R291N, the stability of the four recombinantly expressed ARSAs in solution (shelf life) and within cells (lysosomal half life) was analysed. Storage in Tris-buffered saline pH 7.4 at 4° C. for up to 10 days diminished the enzyme activities of the recombinant ARSAs by approximately 10% with no clear difference between the four preparations (
Example 6
Immunogenicity of Mutated ARSA
[0099] To analyse possible new epitopes and immunogenicities introduced into the human ARSA polypeptide by the amino acid exchanges, an MLD mouse model was treated by repeated intravenous injections of wildtype human ARSA, ARSA_M202V and ARSA_M202V,T286L,R291N, respectively. Treatments were done in weekly intervals for a total of four weeks (four injections) using 20 mg enzyme per kg body weight in each injection. The ARSA knockout mouse model used for this study was transgenic for an active site-mutant of the human ARSA. This ARSA variant has zero activity and has been constructed by an amino acid exchange in the substrate binding pocket that does not affect the surface structure of the enzyme (Matzner, U., et al. Mol. Med. 13, 471-479; 2007). Consequently, the mouse strain retains its MLD-like phenotype, but does not develop immune reactions to injected wildtype human ARSA. ARSA knockout mice without this transgene show, in contrast, deteriorating adverse reactions with the second injection and more than 50% have died from anaphylactic complications after the fourth injection of 20 mg/kg wildtype human ARSA. By this means, repeated treatment of the immunotolerant mouse strain allows conclusions about possible new immunogenicities of the human ARSA mutants.
[0100] Treatment of the immunotolerant mouse model with either wildtype human ARSA, ARSA_M202V or ARSA_M202V,T286L,R291N for four weeks caused no obvious behavioral side effects (n=3 mice per group). Treatment with the murine ARSA, on the contrary, elicited apparent incompatibility reactions such as bristling of the fur, unsteady gait and reduced cage activity. These reactions were transient and occurred 5 to 20 min after treatment in two of the three mice. Signs were observed for the first time after the third and were more pronounced after the fourth injection. The third mouse treated with mARSA showed no behavioral abnormalities except enhanced skin scratching 5 to 10 min after treatment possibly related to histamine-induced itch.
[0101] To analyse the development of antibodies to repeatedly infused ARSA, blood was taken three days after the fourth treatment. Antibody titers were measured by the capability of serum to precipitate that recombinant ARSA from solution that had been used for treatment (Matzner, U et al. (2008) J. Mol. Med. (Berl.) 86, 433-442). In this assay, the amount of ARSA lost from the supernatant is a measure for the α-ARSA antibody concentration. Serum from the three mice that had received wildtype human ARSA did not precipitate human ARSA from solution indicating the absence of antibodies and confirming the immunotolerance of the mice (
[0102] The behavioral and biochemical data indicate that expression of wildtype human ARSA fully protects from immune reactions to ARSA_M202V and ARSA_M202V,T286L,R291N, but only partially to adverse reactions to murine ARSA. Though the mice respond not equally to murine ARSA in this short treatment period of four weeks, it is likely, that they will develop a progressive immune response in the long range. It has to be mentioned that approximately 94% of European MLD patients express human ARSA polypeptides, though at a decreased level or with markedly reduced activity (Polten, A et al (1991). N. Engl. J. Med. 324, 18-22). The preclinical data presented here suggest that ARSA_M202V and ARSA_M202V,T286L,R291N will not cause immunological complications in this majority of patients.
[0103] Materials and Methods
[0104] Purification of Recombinant ARSAs
[0105] For the production of recombinant proteins, CHO-suspension (CHO-S) cells (Thermo Fisher Scientific) were stably transfected with pcDNA3-hARSA-strep, pcDNA3-mARSA-strep, pcDNA3-hARSA_M202V-strep and pcDNA3-hARSA_M202V,T286L,R291N-strep, respectively. Transfection, selection, isolation and screening of single clones as well as production of recombinant ARSA was as described before.sup.3. Briefly, medium was collected twice a week from Miniperm bioreactors (Sarstedt, Nürnbrecht, Germany) and mixed with 50% (w/v) ammonium sulfate to precipitate ARSA. Precipitates were stored at 4° C. For affinity purification, the precipitated ARSAs were collected by centrifugation (1,500×g, 4° C., 30 min) and then excessively dialysed against Tris-buffered saline pH 7.4 at 4° C. Insoluble material was removed by centrifugation (100,000×g, 4° C., 60 min) and recombinant ARSA was subsequently purified from the supernatant by affinity chromatography using Strep-Tactin Macroprep® (IBA Lifesciences, Göttingen, Germany) according to the manufacturers recommendations.
[0106] Endocytosis and Stability
[0107] To determine the endocytic rate of recombinant ARSAs, CHO-K1 cells were cultured for 24 h in cell culture medium to which the respective recombinant ARSA was added at a concentration of 2.5 μg/ml. Then the cells were washed with 1× PBS pH 7.4 and cultured in fresh medium for different chase times. Before harvesting, cells were washed for 3 min at room temperature with 50 mM Glycin, 150 mM NaCl, pH 3.0 to remove surface-bound ARSA. Following trypsinization, cells were spun down and homogenized in 100 μl homogenization buffer (0.5% Triton N-101 in 1× TBS pH 7.0). For endocytosis experiments, cells were harvested immediately after feeding and the ARSA activity of the homogenate was measured. Activities were corrected by subtracting the activity of CHO-K1 cells cultured without recombinant ARSAs (mean of n=3 dishes) and related to the activity of the incubation medium added to the cells at t.sub.0. The lysosomal stability was analysed by Western blotting. For that purpose, aliquots of homogenates (20 μl) or incubation media (4 μl) were separated by SDS-PAGE. ARSA was detected with a mixture of the two polyclonal rabbit antisera #1057 (specific for human ARSA, 1:10.000) and N14 (Santa Cruz Biotechnology, Heidelberg, Germany; sc-79848; detects also murine ARSA; 1:200). The antisera were used in combination with peroxidase-conjugated goat-anti-rabbit (Dianova, Hamburg, Germany; 111-035-003; 1:10.000) as secondary antibody. ARSAs were quantified by densitometry of signals using the image analysis software AIDA (Raytest, Straubenhardt, Germany). Time course data were fitted to the mono-exponential equation N(t)=N.sub.0 e.sup.−λt, using the least square method (Microsoft Excel 2010). Half-lives were calculated according to the formula T.sub.1/2=(ln2)/λ.
[0108] Tolerability Study
[0109] ARSA knockout mice being immunotolerant to wildtype human ARSA (Baum, H. et al 1959 Clin. Chim. Acta 4, 453-455.) were treated by repeated intravenous injection of high doses of recombinant ARSAs into the tail vein. For this purpose, four groups of age- and sex-matched immunotolerant ARSA knockout mice (13 months old females, n=3 mice per group) were injected with one recombinant ARSA preparation each using a treatment dose of 20 mg per kg body weight given once a week for a total of four weeks (four injections). A fifth group of mice was mock-treated with buffer (1× TBS pH 7.4) according to the same schedule. Acute immune complications such as scratching, wiping of eyes, bristling of the fur and reduced cage activity were analysed by visual inspection of the mice within the first 30 min after each injection. The formation of antibodies was determined by the ability of serum isolated three days after the fourth treatment to immunoprecipitate the ARSA that has been used for treatment from solution (Matzner, U., et al (2008) J. Mol. Med. (Berl.) 86, 433-442.).