NOVEL RECOMBINANT HIGH-STABILITY SUPEROXIDE DISMUTASE AND APPLICATION THEREOF
20180303743 ยท 2018-10-25
Inventors
Cpc classification
A61P29/00
HUMAN NECESSITIES
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
C12N15/63
CHEMISTRY; METALLURGY
International classification
C12N15/63
CHEMISTRY; METALLURGY
A61P29/00
HUMAN NECESSITIES
Abstract
The invention discloses a novel high-temperature resistant superoxide dismutase (SOD) and a coding gene and application thereof. The superoxide dismutase has a very high stability and activity under various severe conditions such as high temperature, high acidity or alkalinity and various proteases such as pepsin and trypsin. The superoxide dismutase of the present invention overcomes the problems of the existing SOD products, such as unstability, low in activity or even a complete lack of activity and prone to degradation and inactivation in the digestive tract. And the superoxide dismutase of the present invention is expected to be developed into cosmetics or health-care foods or to medicines which are stable in activity and have a good effect.
Claims
1. A superoxide dismutase comprising the amino acid sequence of SEQ ID NO.4.
2. (canceled)
3. (canceled)
4. A pharmaceutical composition comprising an effective therapeutic amount of the superoxide dismutase according to claim 1.
5. The pharmaceutical composition according to claim 4, wherein the pharmaceutical composition further comprises an antibacterial agent and/or a pharmaceutically acceptable carrier and/or excipient.
6. The pharmaceutical composition according to claim 4, wherein the pharmaceutical composition is in the form of an oral or external dosage form, wherein the oral dosage form is preferably an oral solution, a tablet, a pill, a capsule, granules and oral powders; the external dosage form is preferably external powders, ointment, patch, external liquid agent, suppository, spray, aerosol, inhalant.
7. A cosmetic composition comprising an effective amount of the superoxide dismutase according to claim 1.
8. A food additive comprising the superoxide dismutase according to claim 1.
9. (canceled)
10. A method of anti-inflammation comprising administrating an effective therapeutic amount of the superoxide dismutase according to claim 1 or a pharmaceutical composition thereof to a subject in need.
11. The method according to claim 10, wherein said inflammation comprises mucosal inflammation, inflammation caused by exogenous inflammatory factors, or skin inflammation.
12. The method according to claim 11, wherein the mucosal inflammation comprises mucosal inflammations of respiratory tract, digestive tract, reproductive organs, auditory organs, visual organs, preferably oral ulcer, gingivitis, enteritis, gastritis, vaginitis, pelvic Inflammation, cystitis, cervicitis, rhinitis, pharyngitis, otitis media, otitis externa, eye conjunctivitis, eye keratitis; an inflammation caused by exogenous inflammatory factors includes an inflammation caused by biological factors, physical factors, exogenous chemical factors, or a combination thereof; preferably, the inflammation caused by the biological factors includes inflammations caused by bacteria, virus, rickettsia, protozoon, fungi, spirochete and parasite acting on the body; preferably, the inflammation caused by the physical factors includes an inflammation caused by mechanical force, high temperature, low temperature, ionizing radiation, ultraviolet radiation acting on the body, more preferably an inflammation caused by burn, scald, frostbite, sunburn, cut, radiation damage, oeeeee an inflammation formed after surgery and radiotherapy; preferably, the inflammation caused by the exogenous chemical factors includes an inflammation caused by radioactive material, strong acid, strong base, strong oxidant, alcohol, chemical drug acting on the body, more preferably alcohol or drug-induced hepatitis, inflammation formed after chemotherapy; the skin inflammation includes tinea manus and pedis, folliculitis, contact dermatitis, eczema, urticaria, neurodermatitis, seborrheic dermatitis, preferably infant eczema.
13. A method of anti-aging and preventing skin pigmentation comprising administrating an effective amount of the superoxide dismutase according to claim 1 or a cosmetic composition thereof to a subject in need.
Description
DESCRIPTION OF THE DRAWINGS
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
DETAILED DESCRIPTION OF THE INVENTION
Example 1. Preparation of Mutant High Temperature Resistant Superoxide Dismutase of the Present Invention
[0046] 1. The mutant high temperature resistant SOD strain with a high yield was obtained
[0047] The target gene was amplified with the following primer sequences using the gene encoding SOD in the thermophilic bacteria HB27 (purchased from the American ATCC cell bank) as the template: Forward primer: 5-AAGAATTCATGCCGTACCCGTTCAAGCT-3 (SEQ ID NO.1); Reverse primer: 5-CTGTCGACTCAGGCTTTGTTGAAGAAC-3 (SEQ ID NO. 2). The amplified product was recovered using a extraction kit (purchased from Sangon Biotech (Shanghai) Co., Ltd.), digested with enzymes (EcoRI and SalI) and ligated to the plasmid vector (pET28a (+), purchased from Sangon Biotech (Shanghai) Co., Ltd.) which was also digested with the same enzymes, then the recombinant plasmid was transformed into the competent E. coli BL21 (DE3) (purchased from Sangon Biotech (Shanghai) Co., Ltd.). The strain of mutant high temperature resistant SOD with a high-yield (hereinafter referred to as M-type SOD) was obtained by screening and sequencing, and the specific nucleotide sequence of the M-type SOD encoding gene were sequenced as:
TABLE-US-00001 (SEQIDNO.3) 1 ATGCCGTACCCGTTCAAGCTTCCTGACCTAGGCTACCCCTACGAGGCCCTCGAGCCCCAC 61 ATTGACGCCAAGACCATGGAGATCCACCACCAGAAGCACCACGGGGCCTACGTGACGAAC 121 CTCAACGCCGCCCTGGAGAAGTACCCCTACCTCCACGGGGTGGAGGTGGAGGTCCTCCTG 181 AGGCACCTCGCCGCCCTTCCCCAGGACATCCAGACCGCCGTGCGCAACAACGGGGGCGGG 241 CACCTGAACCACAGCCTCTTCTGGAGGCTCCTCACCCCCGGGGGGGCCAAGGAGCCCGTG 301 GGGGAGCTGAAGAAGGCCATTGACGAGCAGTTCGGGGGCTTCCAGGCCCTCAAGGAGAAG 361 CTCACCCAGGCGGCCATGGGCCGGTTCGGCTCGGGCTGGGCCTGGCTCGTGAAGGACCCC 421 TTCGGCAAGCTCCACGTCCTCTCCACCCCCAACCAAGACAACCCCGTGATGGAGGGCTTC 481 ACCCCCATCGTGGGCATTGACGTCTGGGAGCACGCCTACTACCTCAAGTACCAGAACCGC 541 CGGGCCGATTACCTCCAGGCCATCTGGAACGTCCTCAACTGGGACGTGGCCGAGGAGTTC 601 TTCAATAAAGCCTGA
2. The Expression and Purification of M-Type SOD
[0048] The fermentation process was carried out by four steps of primary seed culture, secondary seed culture, tank fermentation, induction expression, and finally the fermentation product M-type SOD was obtained. The specific process is as follows:
[0049] The basic LB medium components of the fermentation tank were formulated, and the supplement ingredients were shown as the table below.
TABLE-US-00002 supplement supplement Ingredient amount frequency glucose 80 g 5 h ammonium sulfate 20 g 5 h K.sub.2HPO.sub.4 8 g 5 h
(1) Primary seed culture: 20 ml LB liquid culture;
(2) The culture medium was inoculated with 5 l of glycerol stock and the final concentration of kanamycin was 50 mg/L, 37 C. and 220 rpm, culture for 10 hours;
(3) Secondary seed culture: the bacteria culture in the last step was transferred to 200 ml LB liquid medium, and the final concentration of kanamycin was 50 mg/L, 37 C., 220 rpm, culture for 4 h;
(4) Tank fermentation: 200 ml of secondary seed bacteria culture in the previous step was inoculated into a fermentation tank with a capacity of 6.6 L; fermentation conditions: dissolved oxygen 30%, temperature at 30 C., pH7.0, rotational speed was automatically adjusted between 200 rpm and 800 rpm according to dissolved oxygen;
(5) Add the inducer IPTG with a final concentration of 1 mM when fermentation was carried out for 5-6 hours and the OD600 was about 28; the fermentation were stopped to after 24 hours and the cells were collected by centrifugation;
(6) After centrifugation, the cells were dissolved in Buffer A (10 mM Tris-HCl, pH 8.0); the cells were ultrasonically broken at 300 W ultrasound, and the total time of ultrasound was 45 min;
(7) Heated at 90 C. for 1 h;
[0050] (8) After cooled to room temperature, centrifuged at 4 C., 12000 g for 30 min;
(9) Collected the supernatant and added 50% ammonium sulfate to precipitate the enzyme;
(10) Leave at 4 C. for 120 min, centrifuged at 4 C., 12000 g for 30 min;
(11) Dissolve the precipitate and dialyze overnight;
(12) The product after dialysis was subpackaged and dried and made into end product.
[0051] Purified M-type-SOD (purity was up to 98%) has the amino acid sequence:
TABLE-US-00003 (SEQIDNO.4) 1 MPYPFKLPDLGYPYEALEPHIDAKTMEIHHQKHHGAYVTNLNAALEKYPYLHGVEVEVLL 61 RHLAALPQDIQTAVRNNGGGHLNHSLFWRLLTPGGAKEPVGELKKAIDEQFGGFQALKEK 121 LTQAAMGRFGSGWAWLVKDPFGKLHVLSTPNQDNPVMEGFTPIVGIDVWEHAYYLKYQNR 181 RADYLQAIWNVLNWDVAEEFFNKA
[0052] The difference between the amino acid sequences of the M-type SOD and the high temperature resistant SOD disclosed in GenBank (GenBank: BAA25701.1, wild-type high temperature resistant SOD, hereinafter referred to as W-type SOD) is that the amino acid at position 202 of the M-type SOD provided by the present invention is mutated from lysine (Lys or K) at the corresponding position of W-type SOD to asparagine (Asn or N).
Example 2. Analysis of the Physicochemical Properties of the Mutant Type High Temperature Resistant Superoxide Dismutase
1. The Comparison of Heat Resistance
[0053] We have compared the thermal stability of the W-type SOD (Jianguo Liu et al., Extremophiles, 2011: 15: 221 226, the same below), the M-type SOD provided by the present invention and the ordinary SOD (Sigma, MFCD00132404) (the experiment conditions are the same with that in Jianguo Liu et al., Extremophiles, 2011: 15: 221 226, i.e. treated at different temperatures for 1 hour to measure the remaining enzyme activity). The results were shown in
2. PH Resistance Comparison:
[0054] We compared the stability of W-type SOD, M-type SOD and ordinary SOD (Sigma, MFCD00132404) at different pH (exactly the same conditions as described in Jianguo Liu et al., Extremophiles, 2011: 15: 221 226). The results are shown in
[0055] It can be seen that M-type SOD kept 97% activity at pH 12, while W-type SOD only kept less than 40% activity at pH 11, showing that the M-type SOD has a very prominent acid and alkaline resistance.
3. The Pepsin Resistance Test:
Preparation of Simulated Gastric Fluid:
[0056] in accordance with the standard of the Pharmacopoeia 2010, namely: take dilute hydrochloric acid 16.4 ml (dilute hydrochloric acid: diluted hydrochloric acid 234 ml with water up to 1000 ml. The HCl contained in the solution should be 9.5% to 10.5%), add about 800 ml of water and pepsin 10 g (Sinopharm, 20141209) and shake well, then add water up to 1000 ml.
[0057] SOD is also a protein, which is digested readily by the protease in the digestive tract thus losing activity. After treating both M-type SOD and ordinary SOD enzymes in the above simulated gastric fluid for two hours, it could be found that resistance of M-type SOD against pepsin degradation was significantly better than ordinary SOD, see
4. The Trypsin Resistance Test:
[0058] The M-type SOD and ordinary SOD are incubated in 10 U/ml 300 U/ml trypsin solution (Shanghai Ruiyong Biotechnology Co. Ltd, RM1021-100 g) at 37 C. for 3 hours, and it was found that M-type SOD did not lose activity, while the ordinary SOD lost nearly 60% activity. This indicates that M-type SOD also has a strong anti-trypsin degradation ability, see
[0059] The enzyme activity of SOD was determined by pyrogallol autoxidation method.
[0060] In summary, the mutant SOD (M-type SOD) has the outstanding performance in resistance to high temperature, acid and alkaline changes and digestive enzymes degradation, therefore is expected to be used in oral and external drugs, food and cosmetics, and achieve good therapy, cosmetic and healthy effects.
Example 3. Research of Anti-Mucosal Inflammation of the Mutant High Temperature Resistant Superoxide Dismutase (M-Type SOD) of the Present Invention
Experimental Animals:
[0061] The zebrafish model is widely used for disease research and drug screening with the following main conditions: (1) a large number of samples can be provided for high-throughput drug screening; (2) high conservation with human in immunology genomics and the like; (3) has a good tracer; (4) can explicitly and clearly demonstrate the most important common pathological features of inflammation. The zebrafish model is one of the most important internationally recognized model animals of drug screening. Zebrafish is transparent and has a strong imaging feature that makes it easier for the researchers to manipulate genes, rendering the animal an ideal model for studying various inflammatory responses. The digestive system of zebrafish is similar to that of mammals, which also contains a liver, pancreas, gallbladder, and a intestinal tract of linear segments with absorption and secretion function. The intestinal epithelium plays a role throughout the intestinal tract and it also contains many epithelial cells that can also be found in mammals, including: absorptive cells, goblet cells, endocrine cells, and the like. Therefore, in recent years zebrafish has become a typical animal model of various inflammatory studies, including mucosal inflammation, especially digestive tract mucosal inflammation, the most representative of which is the zebrafish animal model of inflammatory bowel disease (IBD).
[0062] Wild-type (AB) zebrafish (provided by Hunter Biotechnology, Inc) was selected as the experimental animals and in a natural pair of mating breeding mode. A total of 630, each experiment group of 30, with the age of 3 days after fertilization were used for the analysis of M-type SOD on the treatment of colonitis and intestinal histopathology. Transgenic neutrophil fluorescent zebrafish (provided by Hunter Biotechnology, Inc) are in a natural pair of mating breeding mode. A total of 210, each experiment group of 30, with the age of 3 days after fertilization were used for the evaluation of M-type SOD on colonitis inflammation resolution. The zebrefish was kept in water for fish at 28 C. (Water quality: adding 200 mg instant sea salt per liter reverse osmosis water, conductivity was 480510 S/cm, pH: 6.97.2; hardness was 53.771.6 mg/L CaCO.sub.3), experimental animal use license number: SYXK (Zhejiang) 2012-0171. Feed management was in line with international AAALAC certification requirements.
Experimental Drug:
[0063] The M-type SOD prepared in Example 1, white powder, was prepared at a concentration of 20 mg/mL with ultrapure water at the time of application as mother solution, fresh made.
[0064] Prednisone, white powder, batch number 28778, provided by the Shanghai Crystal Pure Industrial Co., Ltd, was prepared at a concentration of 15 mg/mL with 100% DMSO at the time of application as mother solution.
[0065] Trinitrobenzene sulfonic acid (hereinafter referred to as TNBS), brown liquid, batch number D1326018, provided by the Shanghai Crystal Pure Industrial Co., Ltd.
The Instruments Used:
[0066] Dissection microscope (SZX7, OLYMPUS, Japan), motorized zoom fluorescence microscopy which can continuously switch magnifications (AZ100, Nikon Corporation); 6-well plates (Nest Biotech); methylcellulose (Aladdin, Shanghai, China).
Model Establishment:
Model 1:
[0067] A wild-type (AB) zebrafish of 3 days after fertilization was used to establish a zebrafish colonitis model after incubation for 48 h in water for fish containing a final concentration of 4.5 M TNBS. (Please refer to A. Jemal, R. Siegel, J. Xu, et al. Ward. Clinicians, 2010, 277-300, and Intestinal Upregulation of Melanin-Concentrating Hormone in TNBS-Induced Enterocolitis in Adult Zebrafish. Plos One, 2013, 8(12):1524-1528). The results of the modeling showed that: compared with the normal control group (130711), the intestinal lumen area of the model control group was 197660, p<0.001, indicating that the model was established successfully and used in the following experiment 1.
Model 2:
[0068] Transgenic neutrophil fluorescent zebrafish of 3 days after fertilization was used to establish a zebrafish colonitis model after incubation for 48 h in water for fish containing a final concentration of 4.5 M TNBS. The method was the same as above. The results showed that: compared with the normal control group (1.6), the number of neutrophils in intestinal tract of zebrafish in the model control group was 9.4, p<0.001, indicating that the model was established successfully and used in the following experiment 2.
Experiment 1:
[0069] The Treatment Effect of M-Type SOD on Colonitis
Experimental Method:
(1) Determine the Maximum Non-Lethal Concentration of M-Type SOD (MNLC)
[0070] Treatment of zebrafish with M-type SOD (treatment for 48 hours), set a number of different concentrations of M-type SOD;
[0071] The initial detection concentrations of M-type SOD were 150 g/mL, 200 g/mL, 333 g/mL, 1000 g/mL and 2000 g/mL, respectively;
[0072] 30 zebrafishes were treated in each experiment group;
[0073] During the experiment course, count dead zebrafish every day and remove dead zebrafish;
[0074] After the end of M-type SOD treatment, the number of dead zebrafish in each experiment group was counted and MNLC was determined.
Experimental Results:
[0075] According to the concentration-lethal data in table 1, the MNLC of M-type SOD was 150 g/mL, and the concentration of 15 g/mL, 50 g/mL and 150 g/mL were selected in pharmacodynamics evaluation experiment.
TABLE-US-00004 TABLE 1 M-type SOD concentration-lethal data sheet. Concentration Death Death rate (g/mL) (tail) (%) 150 0 0 200 6 20 330 30 100 1000 30 100 3000 30 100
(2) Evaluation of the Therapeutic Efficiency of M-Type SOD on Colonitis.
[0076] Model control group: TNBS-induced colonitis zebrafish model (model 1);
[0077] Positive control group: prednisone was added to water for fish at a final concentration of 15 g/mL.
[0078] Treatment group: M-type SOD was added to the water for fish and the final concentrations were 1MNLC, 1/3MNLC and 1/10MNLC, respectively.
[0079] The normal control group and the solvent group were the same in the context, specifically were the wild type AB zebrafishes of 3 days after fertilization without any treatment;
Note:
[0080] 30 zebrafishes were treated in each experiment group (treatment time of 48 hours); after the end of M-type SOD treatment, 15 zebrafishes were randomly observed under microscope, and pictures were taken and saved. Image analysis was performed by image analysis software, the area of zebrafish intestinal lumen was calculated, and quantitative analysis was carried out, and the statistical result was expressed with
[0081] The treatment of M-type SOD on colonitis was calculated as follows:
[0082] The therapeutic efficiency of the positive control group was calculated by replacing the treatment group in the above formula with the positive control group;
[0083] Statistical analysis was performed by variance analysis and Dunnett's T-test, p<0.05 indicats a significant difference;
[0084] A representative experimental chart was provided.
Experimental Results:
[0085] Compared with the normal control group (130711), the intestinal lumen area of the model control group was 197660, p<0.001, indicating that the model was established successfully; compared with the model control group with p<0.001, the intestinal lumen area of the positive control prednisone group was 147876, the therapeutic efficiency for zebrafish colonitis is 74%. The therapeutic efficiency of M-type SOD with concentrations at 15 g/mL, 50 g/mL and 150 g/mL were 66%, 82% and 84% respectively, each group compared with the model control group with p<0.001, indicating the significant therapeutic efficiency of M-type SOD on colonitis. Please refer to table 2,
TABLE-US-00005 TABLE 2 The quantitative results of the therapeutic efficiency of M-type SOD on colonitis (n = 15). intestinal therapeutic Concentration lumen area efficiency group (g/mL) (mean SE) (%) normal control 130711 7075 group model control 197660 6280 group prednisone 15 147876 5809*** 74%*** 15 153560 6080*** 66%*** M-type SOD 50 142595 3167*** 82%*** 150 141259 5359*** 84%*** Compared with the model control group, ***p < 0.001
Experiment 2:
[0086] Effects of M-Type SOD on Inflammation Resolution of Colonitis
Experimental Method:
[0087] Tests were carried out at 3 concentrations of M-type SOD (added to the water for fish with final concentrations of 15 g/mL, 50 g/mL and 150 g/mL);
[0088] Model control group: TNBS-induced colonitis zebrafish model (model 2);
[0089] Treatment group: M-type SOD was added to treat the colonitis zebrafish model;
[0090] Positive control group: prednisone was added to water for fish at a final concentration of 15 g/mL;
[0091] The normal control group and the solvent group are the same in the context, specifically refer to the untreated transgenic neutrophil fluorescent zebrafish;
[0092] 30 transgenic neutrophil fluorescent zebrafishes were treated in each experiment group for 48 hours;
[0093] After the end of M-type SOD treatment, 12 zebrafishes were randomly observed under fluorescent microscope, and pictures were taken and saved;
[0094] The distribution of neutrophils in colonitis tissue was quantitatively analyzed by image analysis software; the result of statistical analysis was showed as
[0095] The therapeutic efficiency of the positive control group was calculated by replacing the treatment group in the above formula with the positive control group;
[0096] Statistical analysis was performed by variance analysis and Dunnett's T-test, p<0.05 indicating a significant difference;
[0097] A representative experimental chart was provided.
Experimental Results
[0098] Compared with the normal control group (1.6), the number of neutrophils in the intestinal tract of zebrafish in model control group was 9.4, p<0.001, indicating that the model was established successfully. Compared with the model control group, the number of neutrophils in positive control prednisone group was 3.8, p<0.001, indicating that prednisone has the effect of promoting the inflammation resolution of colonitis with an inflammation resolution rate of 71%. The therapeutic efficiency of M-type SOD at 15 g/mL, 50 g/mL and 150 g/mL on the inflammation resolution of colonitis were 34%, 49% and 74% respectively, with p<0.05 & p<0.01 & p<0.001 of each group, compared with the model control group, indicating that M-type SOD has a significant effect on inflammation resolution of colonitis. See Table 3,
TABLE-US-00006 TABLE 3 The quantitative results of the promoting effect of M- type SOD on colonitis inflammation resolution (n = 12). number of inflammation Concentration neutrophils resolution rate group (g/mL) (mean SE) (%) normal control 1.6 0.30 group model control 9.4 0.94 group prednisone 15 3.8 0.64*** 71%*** 15 6.8 0.88* 34%* M-type SOD 50 5.6 0.45** 49%** 150 3.7 0.53*** 74%*** Compared with the model control group, *p < 0.05 **p < 0.01 ***p < 0.001.
Experiment 3:
[0099] Pathological Analysis of Intestinal Tract Tissue
Groups:
[0100] Experiment group 1, normal control group; experiment group 2, model control group; experiment group 3, positive control drug prednisone 15 g/mL; experiment group 4, M-type SOD15 g/mL; experiment group 5, M-type SOD 50 g/mL; experiment group 6, M-type SOD 150 g/mL.
Experimental Method:
[0101] M-type SOD treatment group: treatment mode, concentrations were the same as in experiment 1;
[0102] Positive control group: prednisone treatment group (the same as above);
[0103] Enteritis model group: model 1;
[0104] Normal control group: wild type AB zebrafish of 3 days after fertilization without any treatment;
[0105] 30 zebrafishes were treated in each experiment group for 48 hours;
[0106] After treatment with M-type SOD, the mixture was fixed with 4% paraformaldehyde and then the zebrafish was transferred to 70% ethanol;
[0107] The fixed zebrafish was observed under the microscope for the colonic tissue and photographed for histopathological analysis, as described in the experimental results.
Experimental Results
[0108] In the normal control group, the intestinal mucosa of the zebrafish was smooth and intact, and the intestinal folds were obvious. In the model control group, the zebrafish had a expansion of intestinal lumen, the intestinal mucosa became thinner and the intestinal folds disappeared, and the mucosal erosion and ulcer was observed. After the treatment with the positive control drug prednisone, intestinal mucosal histology was improved significantly. After treatment with M-type SOD at concentrations of 15 g/mL, 50 g/mL and 150 g/mL, the intestinal lumen area and intestinal folds were restored substantially, the inflammation of intestinal mucosa was significantly improved, and no obvious inflammatory ulcer was observed. See
Example 4: Therapeutic Efficiency of M-Type SOD Provided by the Present Invention on Human Enteritis (Clinical Observation)
[0109] Inflammatory bowel disease (IBD) is a common disease, Crohn's disease (CD) and ulcerative colitis (UC) are often known as IBD. Crohn's disease is also known as regional enteritis, segmental enteritis or granulomatous enterocolitis. The disease is a gastrointestinal chronic granulomatous disease with unknown causes, more common in the terminal ileum and near the colon, the lesions are of a phased or leaping distribution, which is a whole layer of intestinal inflammation. Ulcerative colitis, also known as non-specific ulcerative colitis, is a rectum and colon chronic inflammatory disease with unknown causes. Lesions mainly involve the large intestine mucosa and submucosa, rectum and distal colon is the most common parts of being affected, but the whole colon and terminal ileum can also be involved when the lesions are severe. Their symptoms are generally diarrhea, abdominal pain, and even some people can have bloody stools. It is thought that the pathogenesis of IBD may be: certain genetic determinants render susceptible individuals susceptible to disease, stimulate mucosa-associated lymphoid tissue under the action of infectious agents or intestinal antigens, causing up-regulation of T-cell responses, thereby activating various cytokine network, leading to local tissue inflammation, and then continue to enlarge and sustain, causing intestinal damage and the corresponding clinical manifestations. Treatment often uses glucocorticosteroids (GCS) drugs (prednisone, adrenal cortex hormones) and antibiotics. Such treatment often has a poor efficacy, severe side effects, and drug resistance can be easily developed. We have attempted to verify the therapeutic efficiency of the present invention in the form of tablets (each containing M-type SOD 10000 U) in the present invention, and the tablets were prepared as follows.
[0110] M-type SOD tablets prescription: M-type SOD 2 g; lactose 40 g; pregelatinized starch 50 g; povidone K30 6 g; magnesium stearate 1 g.
Preparation Process:
[0111] 1, M-type SOD powder is passed over 80 mesh sieve for use;
[0112] 2, Adhesive preparation: weigh and add prescription dosage of povidone k30 to appropriate amount of 75% ethanol (about 60 g), stirred for use;
[0113] 3, Prescription amount of pregelatinized starch, lactose, prescription amount of SOD were weighed and mixed evenly;
[0114] 4, Granulation: the adhesive obtained in step 2 was added to the above-mentioned mixed powder and made into soft material, and then granulated with a 20 mesh sieve;
[0115] 5, Wet granules were dried at 602 C. to a water content of 1.0% to 3.5%, granulated with a 20 mesh sieve;
[0116] 6, Mix the prescription amount of magnesium stearate with dry granules evenly;
[0117] 7, Tablet compressing machine was used for tabletting, each tablet contains 10,000 units of M-type SOD.
[0118] In this example, 63 volunteers were tested for this product, including 37 males and 26 females, of whom 21 cases of 30-40 years old, 30 cases of 40 to 50 years old, 12 cases over 50 years old.
Diagnostic Criteria:
[0119] Because of the lack of specific diagnostic criteria for UC, and CD is difficult to obtain histopathological results so as to confirm the diagnosis, i.e. non-caseous granuloma, it is still difficult to diagnose the etiology and disease type of IBD currently. However, IBD patients have common clinical manifestations of perennial repeated abdominal pain and diarrhea, and one can observe and record whether these symptoms are improved and eased.
Application Method:
[0120] one tablet per night, taking 10 consecutive days for a treatment course.
Efficacy Evaluation Criteria:
[0121] Excellent: the use of 10 days without diarrhea and abdominal pain phenomenon, having a formed stool.
[0122] Improved: occasionally with diarrhea and abdominal pain phenomenon.
[0123] Invalid: Diarrhea and abdominal pain was not improved.
Result:
[0124]
TABLE-US-00007 Number Disease of Treatment Excellent Improved Invalid Total type application time Cases Excellent % Cases Improved % Cases Invalid % efficacy % IBD 63 10 Days 44 69.8% 16 25.4% 3 4.8% 95.2%
[0125] The above-described Example 3-4, from the animal models and the clinical observation of the patients respectively, demonstrated that the M-type SOD of the present invention had a significant therapeutic efficiency on various inflammatory bowel diseases, and the therapeutic efficiency of M-type SOD of the present invention is superior to that of the hormone prednisone.
Example 5: The Research on the M-Type SOD Provided by the Present Invention for Anti-Inflammation Caused by Exogenous Inflammatory Factors
Experimental Animals
[0126] Transgenic neutrophil fluorescent zebrafish (provided by Hunter Biotechnology, Inc) are in a natural pair of mating breeding mode. A total of 810, with each experiment group of 30, the age of 3 days after fertilization are used. The zebrefishes were kept in water for fish at 28 C. (Water quality: adding 200 mg instant sea salt per liter reverse osmosis water, conductivity of 480510 S/cm, pH: 6.97.2; hardness of 53.771.6 mg/L CaCO.sub.3), experimental animal use license number: SYXK (Zhejiang) 2012-0171. Feed management is in line with international AAALAC certification requirements.
Experimental Drug:
[0127] The M-type SOD prepared in Example 1, white powder, was prepared at a concentration of 20 mg/mL with ultrapure water at the time of application as mother solution, fresh made.
[0128] Indometacin, white powder, batch number 1108939, was prepared at a concentration of 60 mM with 100% DMSO at the time of application as mother solution, provided by the Shanghai Crystal Pure Industrial Co., Ltd.
[0129] Lipopolysaccharide (LPS), white powder, batch number L-2880, was prepared at a concentration of 10 mg/mL with 100% DMSO at the time of application as mother solution, provided by Sigma of the United States.
[0130] Dimethyl sulfoxide (DMSO), Sigma, batch number BCBN0845V.
[0131] Copper sulfate pentahydrate, Xilong Chemical Co. Ltd., batch number 120201.
Instruments and Reagents Used:
[0132] Dissection microscope (SZX7, OLYMPUS, Japan); motorized zoom fluorescence microscopy which can continuously switch magnifications (AZ100, Nikon Corporation, Japan); 6-well plates (Nest Biotech, China); methylcellulose (Aladdin, Shanghai, Chi na).
The Maximum Non-Lethal Concentration of M-Type SOD (MNLC)
[0133] Treat zebrafish with M-type SOD for 5 hours, and the six detection concentrations of M-type SOD were 15 g/mL, 50 g/mL, 150 g/mL, 450 g/mL, 1350 g/mL and 2000 g/mL respectively. 30 zebrafishes were treated in each experiment group. During the course of the experiment, the dead zebrafishes were counted and removed. After the M-type SOD treatment, the number of dead zebrafishes in each experiment group was counted, and MNLC was determined. The results showed that M-type SOD at 2000 g/mL concentration for 5 hours still had no toxic effects on zebrafish. Therefore, the concentration of 2000 g/mL was selected as the maximum concentration in the evaluation of anti-inflammatory effect of SOD.
Experiment 1:
[0134] Evaluation of the Anti-Inflammatory Effect of M-Type SOD on Copper Sulfate-Induced Inflammation
Groups:
[0135] Experiment group 1, normal control group, specifically refers to untreated transgenic neutrophil fluorescent zebrafish; experiment group 2, model control group; experiment group 3, positive control drug indometacin 60 M; experiment group 4, M-type SOD15 g/mL; experiment group 5, M-type SOD 50 g/mL; experiment group 6, M-type SOD150 g/mL; experiment group 7, M-type SOD 450 g/mL; experiment group 8, M-type SOD 1350 g/mL; experiment group 9, M-type SOD 2000 g/mL.
Concentration Determining Basis:
[0136] According to the above exploratory test of concentration, SOD at concentration of 2000 g/mL had no toxic effect on zebrafish, so 2000 g/mL was selected as the maximum concentration of SOD for anti-inflammatory effect. The anti-inflammatory concentrations were set at 15 g/mL, 50 g/mL, 150 g/mL, 450 g/mL, 1350 g/mL and 2000 g/m L.
Model Making
[0137] The zebrafish inflammation model was established by treatment of transgenic neutrophil fluorescent zebrafish with 10 M of copper sulfate pentahydrate dissolved in water. The specific method was described by d'Alencon et al., BMCBiology. 2010, 8: 151, A to high-throughput chemically induced inflammation assay in zebrafish. Compared with the number of neutrophils at the inflammatory site (the region of auditory cells) in the normal control group (1.3), the number in the model control group was 15.5, p<0.001, indicating that the model was established successfully.
Experimental Method
[0138] The transgenic neutrophil fluorescent zebrafish were randomly selected and put in the six-well plate, each well 30, using copper sulfate induced zebrafish inflammation model. Water-soluble M-type SOD15 g/mL, 50 g/mL, 150 g/mL, 450 g/mL, 1350 g/mL and 2000 g/mL; the positive control drug indometacin concentration was 60 M; 3 mL per well of the drug solution was added, and the normal control group and the model control group were set up at the same time. The treatment time of M-type SOD was 5 hours, 10 zebrafishes were randomly selected to be observed under the fluorescence microscope, and images were taken and saved. The images were analyzed by Nikon NIS-ElementsD3.10 advanced image processing software. The number of neutrophils (N) in zebrafish was calculated and quantitatively analyzed. The calculation formula of the rate of inflammation resolution was as follows:
[0139] The subject group included the M-type SOD treatment group and the positive control indometacin treatment group.
[0140] Statistical analysis used variance analysis and Dunnett's T-test, p<0.05 indicating of significant differences; providing a representative experimental chart.
Experimental Results
[0141] Compared with the normal control group (1.3), the number of neutrophils at the inflammatory site in the model control group was 15.5, p<0.001, indicating that the model was established successfully; compared with the model control group, the number of neutrophils at the inflammatory site in the indometacin group was 1.9, p<0.001, indicating that indometacin had anti-inflammatory effect. The numbers of neutrophils at to the inflammatory site were 14.9, 11.8, 8.3, 3.6, 1.4 and 1.2 respectively at the M-type SOD concentrations of 15 g/mL, 50 g/mL, 150 g/mL, 450 g/mL, 1350 g/mL and 2000 g/mL groups, the rates of inflammation resolution were 4%, 24%, 47%, 77%, 91% and 92%, respectively. Compared with the model control group, the remaining groups were p<0.05 & p<0.01 & p<0.001, indicating that M-type SOD at the experimental concentrations had a significant anti-inflammatory effect on copper sulfate-induced zebrafish inflammation, except the 15 g/mL and 50 g/mL groups, and showed a dose-dependent manner. See Table 4,
TABLE-US-00008 TABLE 4 Quantitative results of anti-inflammatory effects of M-type SOD on zebrafish inflammation (n = 12). numbers Inflammation of neutrophils resolution rate group Concentration (mean SE) (%) normal control 1.3 0.2 group model control 15.5 1.1 group indometacin 60 M 1.9 0.3*** 88*** 15 g/mL 14.9 0.6 4 50 g/mL 11.8 1.2** 24** 150 g/mL 8.3 0.6*** 47*** M-type SOD 450 g/mL 3.6 0.5*** 77*** 1350 g/mL 1.4 0.2*** 91*** 2000 g/mL 1.2 0.4*** 92*** Compared with the model control group, **p < 0.01, ***p < 0.001.
Experiment 2:
[0142] Evaluation of anti-inflammatory effect of M-type SOD on LPS-induced inflammation.
Concentration Group:
[0143] Experiment group 1, normal control group, specifically refers to untreated transgenic neutrophil fluorescent zebrafish; experiment group 2, model control group; experiment group 3, positive control drug indometacin 60 M; experiment group 4, M-type SOD15 g/mL; experiment group 5, M-type SOD 50 g/mL; experiment group 6, M-type SOD150 g/mL, experiment group 7, M-type SOD 450 g/mL; experiment group 8, M-type SOD 1350 g/mL; experiment group 9, M-type SOD 2000 g/mL.
Model Making
[0144] The zebrafish inflammation model was established by treatment of transgenic neutrophil fluorescent zebrafish through LPS injection. Compared with the normal control group (2.4), in the model control group, the number of neutrophils at the inflammatory site (yolk sac area) was 17.8, p<0.001, indicating that the model was established successfully. (See Li-LingYang et al., Molecules, 2014, 19, 2390-2409. Endotoxin Molecule Lipopolysaccharide-Induced Zebrafish Inflammation Model: A Novel Screening Method for Anti-Inflammatory Drugs.)
Experimental Method
[0145] The zebrafishes were randomly selected and put in the six-well plate, 30 per well. The LPS-induced zebrafish inflammation model was given water-soluble M-type SOD 15 g/mL, 50 g/mL, 150 g/mL, 450 g/mL, 1350 g/mL and 2000 g/mL respectively; the concentration of positive control drug indometacin was 60 M, 3 mL drug liquid per well was added. The normal control group and model control group were set at the same time. After 5 hours treatment, 10 zebrafishes were randomly selected from each group to be observed under fluorescence microscopy, images were taken and saved. Image analysis was performed with Nikon NIS-Elements D3.10 advanced image processing software, the number of neutrophils (N) in zebrafish was calculated, and quantitatively analyzed. The formula of the rate of inflammation resolution was as follows:
[0146] The subjects group included the M-type SOD treatment group and the positive control indometacin treatment group.
[0147] Statistical analysis used variance analysis and Dunnett's T-test, p<0.05, indicating of significant differences; providing a representative experimental chart.
Experimental Results
[0148] Compared with the normal control group (2.4), the number of neutrophils in the model control group was 17.8, p<0.001, indicating that the model was established successfully. Compared with the model control group, he number of neutrophils at the to inflammatory site in the indometacin group was 4.9, p<0.001, the rate of inflammatory resolution was 72%, indicating that indometacin had an anti-inflammatory effect. The number of neutrophils at the inflammatory sites were 17.7, 14.9, 12.3, 11.7, 7.4 and 6.3, respectively, at the M-type SOD concentrations of 15 g/mL, 50 g/mL, 150 g/mL, 450 g/mL, 1350 g/mL and 2000 g/mL groups, the rates of inflammation resolution were 0%, 16%, 31%, 34%, 58% and 65%, respectively. Compared with the model control group, the remaining groups were p<0.05 & p<0.01 & p<0.001 except the 15 g/mL and 50 g/mL groups, indicating that M-type SOD at the experimental concentrations had a significant anti-inflammatory effect on LPS-induced zebrafish inflammation, and showed a dose-dependent manner. See Table 5,
TABLE-US-00009 TABLE 5 Quantitative results of anti-inflammatory effects of M-type SOD on zebrafish inflammation (n = 12). numbers Inflammation of neutrophils resolution rate group Concentration (mean SE) (%) normal control 2.4 0.5 group model control 17.8 1.0 group indometacin 60 M 4.9 1.0*** 72*** 15 g/mL 17.7 1.4 0 M-type SOD 50 g/mL 14.9 1.0 16 150 g/mL 12.3 2.1* 31* 450 g/mL 11.7 1.6** 34** 1350 g/mL 7.4 1.3*** 58*** 2000 g/mL 6.3 1.0*** 65*** Compared with the model control group, *p < 0.05, **p < 0.01, ***p < 0.001
Experiment 3:
[0149] Evaluation of anti-inflammatory effect of M-type SOD on inflammation of tail amputation injury.
Groups:
[0150] Experiment group 1, normal control group, specifically refers to untreated transgenic neutrophil fluorescent zebrafish; experiment group 2, model control group; experiment group 3, positive control drug indometacin 60 M; experiment group 4, M-type SOD 150 g/mL, experiment group 5, M-type SOD 450 g/mL; experiment group 6, M-type SOD 1350 g/mL; experiment group 7, M-type SOD 2000 g/mL.
Model Making:
[0151] The model of zebrafish inflammation was established by mechanical amputation of tail fins of transgenic neutrophil fluorescent zebrafish. Compared with the normal control group (4.8), the number of neutrophils at the inflammatory site was 20.2 in the model control group, p<0.001, indicating that the model was established successfully. The most famous zebrafish damage model is the fish larvae tail trauma model, in which a part of tail fins of the larvae were amputated. The researchers used the transgenic zebrafish damage model to study the latest mechanism of neutrophil chemotaxis to the site of injury by green fluorescent protein (EGFP) expressed under the transcription control of neutrophil-specific peroxidase catalyst. (Specifically see J. Yuan, S. Shaham, S. Ledoux, et al. The C. elegans cell death gene ced-3 encodes a protein similar to mammalian interleukin-1-converting enzyme [J]. Cell, 1993, 641-652.)
Experimental Method
[0152] The transgenic neutrophil fluorescent zebrafish were randomly selected and put in the six-well plate after mechanical amputation of tail fins, 30 per well. Each group was given water-soluble M-type SOD 150 g/mL, 450 g/mL, 1350 g/mL, and 2000 g/mL respectively; the concentration of positive control drug indometacin was 60 M, 3 mL drug solution per well. The normal control group and model control group were set at the same time. After 5 hours treatment, 10 zebrafishes from each group was randomly selected and observed under fluorescence microscopy, the pictures were taken and saved. Image analysis was performed with Nikon NIS-Elements D3.10 advanced image processing software, the number of neutrophils (N) in zebrafish was calculated, and quantitatively analyzed. The formula of the rate of inflammation resolution was as follows:
[0153] The subject group included the M-type SOD treatment group and the positive control indometacin treatment group.
[0154] Statistical analysis used variance analysis and Dunnett's T-test, p<0.05, indicating of significant differences; providing a representative experimental chart.
Experimental Results
[0155] Compared with the normal control group (4.8), the number of neutrophils at the to inflammatory site in the model control group was 20.2, p<0.001, indicating that the model was established successfully. Compared with the model control group, the number of neutrophils at the inflammatory site in the indometacin group was 7.6, p<0.001, the rate of inflammatory resolution was 62%, indicating that indometacin had an anti-inflammatory effect. The number of neutrophils at the inflammatory sites were 14.3, 9.9, 8.4 and 8.3, respectively, at the M-type SOD concentrations of 150 g/mL, 450 g/mL, 1350 g/mL and 2000 g/mL groups. The rates of inflammation resolution were 29%, 51%, 58% and 59%, respectively, compared with the model control group, the groups were p<0.01 & p<0.001, indicating that M-type SOD at the above experimental concentrations had a significant anti-inflammatory effect on tail amputation injury zebrafish inflammation, and showed a dose-dependent manner. See Table 6,
TABLE-US-00010 TABLE 6 Quantitative results of anti-inflammatory effects of M-type SOD on zebrafish inflammation (n = 12). numbers Inflammation of neutrophils resolution rate group Concentration (mean SE) (%) normal 4.8 0.7 control group model control 20.2 1.2 group indometacin 60 M 7.6 0.9*** 62*** 150 g/mL 14.3 2.1** 29** 450 g/mL 9.9 1.2*** 51*** M-type SOD 1350 g/mL 8.4 0.8*** 58*** 2000 g/mL 8.3 0.6*** 59*** Compared with the model control group, **p < 0.01, ***p < 0.001.
[0156] The above experiments 1-3 showed that the M-type SOD of the present invention had a significant anti-inflammatory effect on a variety of exogenous stimuli such as copper sulfate, LPS and tail amputation-induced zebrafish inflammation. In the above experiments, LPS, by continuously stimulating the mononuclear macrophage system, produces a large number of bioactive substances such as cytokines, reactive oxygen etc, causing cell damage and apoptosis, eventually leading to uncontrolled inflammatory response; CuSO.sub.4 can damage the zebrafish auditory cells to cause inflammation, which was used to study the local inflammatory response; tail-injury test used mechanics to to amputate the zebrafish tail fins, which is used to study the inflammatory response caused by damage. Whether the model had been established successfully was determined by microscopic observation of the number of neutrophils of transgenic neutrophil fluorescent zebrafish, and then treated with drugs (indometacin) and M-type SOD. Indometacin is non-steroidal anti-inflammatory drug, with anti-inflammatory, antipyretic and analgesic effects. But the incidence of adverse reactions of indometacin is relatively high. After drug treatment, the number of neutrophils at the inflammatory site was reduced, indicating that the faster the inflammation resolution was, the better anti-inflammatory effects the drug had. The above experimental data showd that: no matter whether the inflammation was systemic, local or mechanical injury, the treatment effect of M-type SOD was superior or equal to the drug indometacin.
Example 6. The Therapeutic Effect of the Mutant High Temperature Resistant Superoxide Dismutase (M-Type SOD) of the Present Invention on Skin Inflammation
Experiment 1:
[0157] The clinical observation of the present invention in the treatment of dermatitis eczema.
[0158] A total of 51 volunteers were administrated with this product (M-type SOD dissolved in glycerol, mixed homogeneously, with a final concentration of 4000-6000 U/mg), including 24 males and 27 females, of which 14 cases were 5 to 15 years old, 26 cases were 20-30 years old, 6 cases were 40 to 50 years old, 5 cases were over 50 years old.
Diagnostic Criteria:
[0159] dermatitis eczema manifested as: skin turns red, slightly swollen when severe, papules, blisters on top, itchy, discharging pus when scratching, scab (see
Method of Application:
[0160] The product of the invention was applied to the skin surface of the patients three times a day, for 7 days as a treatment course.
Efficacy Evaluation Criteria:
[0161] Excellent: the skin returns to normal after applying for a week.
[0162] Improved: 80% of the skin returns to normal (see
[0163] Invalid: local skin does not meet the criteria of improvement, or no improvement, or even continues to deteriorate.
Result:
[0164]
TABLE-US-00011 Number Disease of Treatment Excellent Improved Invalid Total type patients time Cases Excellent % Cases Improved % Cases Invalid % efficacy % Dermatitis 51 7 Days 39 76.5% 11 21.6% 1 1.9% 98.1% eczema
Experiment 2.
[0165] The clinical observation of the present invention in the treatment of tinea pedis.
[0166] A total of 47 volunteers were administrated with this product (M-type SOD dissolved in glycerol, mix homogeneously, with a final concentration of 4000-6000 U/mg), including 22 males and 25 females, of which 18 cases were 15 to 30 years old, 23 cases were 30-50 years old, 6 cases were over 50 years old.
Diagnostic Criteria:
[0167] tinea manus and pedis symptom: keratosis of the skin between toes (fingers), blisters, pimples, erosion, red and swollen, often accompanied by local red and swollen, seriously itching (see
Method of Application:
[0168] The product of the invention was applied to the skin surface of the patient three times a day, for 7 days as a treatment course.
Efficacy Evaluation Criteria:
[0169] Excellent: the skin returns to normal after applying for a week (see
[0170] Improved: 80% of the skin returns to normal.
[0171] Invalid: local skin does not meet the criteria of improvement, or no improvement, or even continue to deteriorate.
Result:
[0172]
TABLE-US-00012 Number Disease of Treatment Excellent Improved Invalid Total type patients time Cases Excellent % Cases Improved % Cases Invalid % efficacy % tinea 47 7 Days 33 70.2% 13 27.7% 1 2.1% 97.9% manus and pedis
Experiment 3.
[0173] The clinical observation of present invention in the treatment of allergic dermatitis
[0174] A total of 74 volunteers tried this product (M-type SOD dissolved in glycerol, mix homogeneously, with a final concentration of 4000-6000 U/mg), including 38 males and 36 females, of which 34 cases were 15 to 30 years old, 31 cases were 30-50 years old, 9 cases were over 50 years old.
Diagnostic Criteria:
[0175] allergic dermatitis is a skin disease caused by allergens, mainly refers to the symptoms of skin such as red and swollen, itching, wheal, peeling when human body is exposed to some allergens (see
Application Method:
[0176] The product of the invention was applied to the skin surface of the affected area, three times a day, using 7 days for a treatment course.
Efficacy Evaluation Criteria:
[0177] Excellent: the skin returns to normal after applying for a week (see
[0178] Improved: 80% of the skin returns to normal.
[0179] Invalid: local skin does not meet the criteria of improvement, or no improvement, or even continue to deteriorate.
Result:
[0180]
TABLE-US-00013 Number Disease of Treatment Excellent Improved Invalid Total type patients time Cases Excellent % Cases Improved % Cases Invalid % efficacy % allergic 74 7 Days 58 78.4% 14 18.9% 2 2.7% 97.3% dermatitis
Conclusion:
[0181] Inflammation is a defensive response to infection source, trauma or tissue to ischemia. The most important and common pathological features of inflammation are the migration, aggregation and infiltration of leukocytes (neutrophils and macrophages). Among them, the chemotaxis, migration and aggregation of the neutrophils is the immune response mechanism of the body in defense of acute injury and inflammatory response, especially when the body's own tissue is damaged or the presence of invasion of foreign objects, this defense is more important.
[0182] However, in this defense process (increased vascular permeability, leukocyte migration, aggregation and infiltration), a large number of free radicals are produced causing local oxidation tension. If the oxidation tension cannot be normally removed (decomposition of free radicals), it will cause the body tissue and cell damage (lipid peroxidation, DNA damage, etc.), leading to excessive accumulation of inflammatory cells at the site of injury, resulting in a sustained, severe inflammatory response. Many human diseases have similar characteristics for example mucosal inflammation such as chronic ulcerative colonitis, vaginitis, pharyngitis etc, inflammation caused by exogenous inflammatory factors for example burn, scald, cut, infection or surgery or radiotherapy and chemotherapy etc, and skin inflammation such as tinea manus and pedis, dermatitis, eczema etc.
[0183] The occurrence and development of various inflammatory reactions have a common pathology, that is, neutrophil chemotaxis and migration. Therefore, effective inhibition of the chemotaxis and migration of neutrophil to the inflammatory site is a key to effectively screen anti-inflammatory drugs. The invention has successfully constructed a variety of zebrafish inflammatory models and carried out relevant clinical observation experiments. The results showed that the M-type SOD of the invention has a significant therapeutic effect on various inflammations. Meanwhile, the study also revealed the change regulation of neutrophils during inflammation resolution. As described above, such cells are characteristic indicators of many inflammatory responses. The M-type SOD of the present invention achieves an anti-inflammatory effect by removing the oxygen radicals in the process, and thus the M-type SOD provided by the present invention can be effective in treating various Inflammations, such as various mucosal inflammations, inflammation caused by exogenous inflammatory factors or skin inflammation etc.