MULTIMERIC FUSION PROTEIN VACCINE AND IMMUNOTHERAPEUTIC
20180303931 ยท 2018-10-25
Inventors
Cpc classification
A61K39/21
HUMAN NECESSITIES
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
A61K2039/55561
HUMAN NECESSITIES
C12N2740/15034
CHEMISTRY; METALLURGY
A61K2039/57
HUMAN NECESSITIES
C12N2740/15022
CHEMISTRY; METALLURGY
C12N2710/16234
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
Abstract
The present disclosure provides fusion proteins that incorporate unique mechanisms for multimerizing antigens to enhance their immunogenicity. The fusion proteins comprise at least two antigens, or other vaccine related proteins, separated by a linker sequence and an oligomerization domain. When expressed, the fusion protein forms a muKimeric protein complex, This approach can be used to muHimeri?.e a single antigen/protein or to create multimers comprising two or more different antigens/proteins. Also provided are nucleic acids encoding the fusion proteins. Yet another aspect is directed to methods of inducing or suppressing an immune response in a subject by administering to the subject a vaccine composition comprising a fusion protein or nucleic acid encoding the fusion protein, optionally without using an adjuvant.
Claims
1. A fusion protein comprising a first antigen, a linker sequence, a second antigen, and an oligomerization domain, wherein the linker sequence joins the first antigen to the second antigen and wherein the fusion protein does not include a tetanus toxoid protein, wherein the first and second antigens are viral antigens or bacterial antigens.
2. The fusion protein of claim 1, wherein the first and second antigens are the same.
3. The fusion protein of claim 1, wherein the first and second antigens are HIV antigens.
4. The fusion protein of claim 1, wherein the first HIV antigen is gp120 and the second HIV antigen is gp41.
5. The fusion protein of claim 1, wherein the first and second antigens are herpesvirus antigens.
6. The fusion protein of claim 5, wherein the first and second antigens are herpesvirus antigens selected from gH, gL, and gB.
7. The fusion protein of claim 6, wherein the first and second antigens are herpes simplex virus antigens.
8. The fusion protein of claim 1, wherein the first and second antigens are Bacillus anthracus antigens.
9. The fusion protein of claim 1, wherein the fusion protein forms a multimeric protein complex when expressed in a host cell.
10. The fusion protein of claim 1, wherein the first and second antigens do not occur naturally as a multimeric protein complex.
11. (canceled)
12. (canceled)
13. (canceled)
14. (canceled)
15. (canceled)
16. (canceled)
17. (canceled)
18. (canceled)
19. (canceled)
20. (canceled)
21. The fusion protein of claim 1, wherein the oligomerization domain is a dimerization domain, a trimerization domain, or a tetramerization domain.
22. The fusion protein of claim 21, wherein the dimerization domain is a GCN4 yeast leucine zipper domain or a derivative thereof.
23. The fusion protein of claim 21, wherein the trimerization domain is a T4 bacteriophage fibritin motif or a eukaryotic GNC4 transcription factor motif or a derivative thereof.
24. The fusion protein of claim 1, wherein the oligomerization domain is located at the C terminus or N terminus of the fusion protein.
25. The fusion protein of claim 1, wherein the first linker sequence, the second linker sequence, or the third linker sequence is a polypeptide comprising between 10-25 amino acids.
26. An isolated nucleic acid encoding the fusion protein of claim 1.
27. A method of inducing or suppressing an immune response in a subject, comprising administering to the subject a vaccine composition comprising the fusion protein claim 1, wherein the fusion protein induces or suppresses an immune response against an antigen in the fusion protein in the subject.
28. The fusion protein of claim 8, wherein the Bacillus anthracus antigens is the receptor-binding domain of protective toxin and/or lethal factor.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0017] The accompanying drawings, which are incorporated in and constitute a part of this specification, illustrate certain embodiments, and together with the written description, serve to explain certain principles of the constructs and methods disclosed herein.
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
DETAILED DESCRIPTION
[0028] It is to be understood that the following detailed description is provided to give the reader a fuller understanding of certain embodiments, features, and details of aspects of the invention, and should not be interpreted as a limitation of the scope of the invention.
Definitions
[0029] In order that the present invention may be more readily understood, certain terms are first defined. Additional definitions are set forth throughout the detailed description.
[0030] The term antibody as used in this disclosure refers to an immunoglobulin or an antigen-binding fragment thereof. The term includes but is not limited to polyclonal, monoclonal, monospecific, polyspecific, non-specific, humanized, human, single-chain, chimeric, synthetic, recombinant, hybrid, mutated, grafted, and in vitro generated antibodies. The antibody can include a constant region, or a portion thereof, such as the kappa, lambda, alpha, gamma, delta, epsilon and mu constant region genes. For example, heavy chain constant regions of the various isotypes can be used, including: IgG.sub.1, IgG.sub.2, IgG.sub.3, IgG.sub.4, IgM, IgA.sub.1, IgA.sub.2, IgD, and IgE. By way of example, the light chain constant region can be kappa or lambda.
[0031] The terms antigen-binding domain and antigen-binding fragment refer to a part of an antibody molecule that comprises amino acids responsible for the specific binding between the antibody and antigen. For certain antigens, the antigen-binding domain or antigen-binding fragment may only bind to a part of the antigen. The part of the antigen that is specifically recognized and bound by the antibody is referred to as the epitope or antigenic determinant. Antigen-binding domains and antigen-binding fragments include Fab (Fragment antigen-binding); a F(ab).sub.2 fragment, a bivalent fragment having two Fab fragments linked by a disulfide bridge at the hinge region; Fv fragment; a single chain Fv fragment (scFv) see e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883); a Fd fragment having the two V.sub.H and C.sub.H1 domains; dAb (Ward et al., (1989) Nature 341:544-546), and other antibody fragments that retain antigen-binding function. The Fab fragment has V.sub.H-C.sub.H1 and V.sub.L-C.sub.L domains covalently linked by a disulfide bond between the constant regions. The F.sub.v fragment is smaller and has V.sub.H and V.sub.L domains non-covalently linked. To overcome the tendency of non-covalently linked domains to dissociate, a scF.sub.v can be constructed. The scF.sub.v contains a flexible polypeptide that links (1) the C-terminus of V.sub.H to the N-terminus of V.sub.L, or (2) the C-terminus of V.sub.L to the N-terminus of V.sub.H. A 15-mer (Gly.sub.4Ser).sub.3 peptide (SEQ ID NO:3) may be used as a linker, but other linkers are known in the art. These antibody fragments are obtained using conventional techniques known to those with skill in the art; and the fragments are evaluated for function in the same manner as are intact antibodies.
[0032] The term fusion protein refers to a protein translated from a nucleic acid transcript generated by combining a first nucleic acid sequence that encodes a first protein and at least a second nucleic acid that encodes a second protein, where the fusion protein is not a naturally occurring protein. The nucleic acid construct may encode two or more proteins that are joined in the fusion protein.
[0033] The term adjuvanting protein refers to a protein that enhances the immune system's response to an antigen. An adjuvanting protein may accelerate, prolong, or enhance antigen-specific immune responses when used in combination with specific antigens. Exemplary adjuvanting proteins include, but are not limited to, flagellin, a heat shock protein, a toll like receptor ligand, or fragments or derivatives thereof that retain the adjuvanting property.
[0034] The term cell surface targeting domain refers to any moiety that will direct an antigen, vaccine, or specific cell to another specific cell type by binding to a specific cell surface receptor. Exemplary cell surface targeting domains, include, but not limited to, an antibody, or antigen-binding fragment thereof.
[0035] The term cellular activation domain refers to any moiety that can either specifically or non-specifically bind to a cell and induce cellular activation. Exemplary cellular activation domains include, but are not limited to, CD40 on B cells and CD28 on T cells.
[0036] The term molecule mediating immune suppression or molecule that mediates immune suppression refers to a molecule that upon binding to a cell induces suppression of cellular activation at any stage of activation including for example proliferation, differentiation, or secretion. Exemplary molecules that mediate immune suppression include, but are not limited to, B-7, CTLA-4, PD-1, Lag-3, Tim-3, CD200:CD200R, 2B4, CD160, PIR-B, BTLA, and GP49b.
[0037] The term pharmaceutically acceptable carrier or pharmaceutically acceptable excipient means solvents, dispersion media, coatings, antibacterial agents and antifungal agents, isotonic agents, and absorption delaying agents, and the like, that are compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art.
[0038] The term isolated, when used in the context of a polypeptide or nucleic acid refers to a polypeptide or nucleic acid that is substantially free of its natural environment and is thus distinguishable from a polypeptide or nucleic acid that might happen to occur naturally. For instance, an isolated polypeptide or nucleic acid is substantially free of cellular material or other polypeptides or nucleic acids from the cell or tissue source from which it was derived. The term also refers to preparations where the isolated polypeptide or nucleic acid is sufficiently pure for pharmaceutical compositions; or at least 70-80% (w/w) pure; or at least 80-90% (w/w) pure; or at least 90-95% pure; or at least 95%, 96%, 97%, 98%, 99%, or 100% (w/w) pure.
[0039] The terms polypeptide, peptide, and protein are used interchangeably herein to refer to polymers of amino acids.
[0040] Fusion Proteins. The present disclosure relates to a new strategy for multimerizing protein antigens in vaccine-related or other immunotherapeutic constructs. The strategy involves creating nucleic acid constructs with oligomerization motifs and a linker sequence separating two or more antigens such that the encoded fusion protein can form a dimeric, trimeric, tetrameric, hexameric, heptameric, or octameric complex from a single nucleic acid construct. This strategy was tested first with a nucleic acid construct encoding two copies of a truncated EBV gp350 protein separated by a linker and a leucine zipper oligomerization domain. To enhance the immunogenicity of the construct, two potent T cell epitopes derived from the tetanus toxoid were included because it was believed that they would be necessary to recruit sufficient T cell help. With the leucine zipper domain, this construct formed a tetrameric gp350 complex when expressed. Compared to the traditional monomeric gp350, the tetramer showed an approximately 25-50-fold higher immunogenicity for specific antibody production both in the presence of weak and strong exogenous adjuvants. Surprisingly, however, the tetramer containing the tetanus toxoid T cell epitopes actually induced immune suppression in animals previously immunized with tetanus toxoid, a potential problem if used clinically. Based on these results, another nucleic acid construct was prepared without the tetanus toxoid epitopes. This construct encoded two copies of the truncated EBV gp350 protein separated by a linker and a leucine zipper oligomerization domain. The construct without the tetanus toxoid epitopes induced gp350-specific antibody responses that were comparable to the antibody responses induced by the construct containing the tetanus toxoid epitopes, unexpectedly showing that the tetanus toxoid epitopes were not required to achieve optimal immunogenicity in unprimed animals and in fact could be suppressive.
[0041] This strategy for multimerizing proteins can be exploited with proteins other than EBV gp350/220 proteins, including other viral, bacterial, parasitic, autoimmune, and tumor antigens. This platform can be used to create multimeric fusion proteins comprising multiple copies of a single antigen of interest, like an EBV gp350/220 antigen. For example, a bomodimer, homotrimer or tetramer can be created using two, three, or four copies of the same antigen with a dimerization, trimerization or tetramerization domain. When the oligomerization domains associate together, the construct will form a tetramer (if a dimerization domain is used) comprising four copies of the same antigen, a hexamer (if a trimerization domain is used) comprising six copies of the same antigen, or an octamer comprising eight copies of the same antigen (if a tetramerization domain is used).
[0042] Alternatively, this platform can be used to create multimeric fusion proteins comprising two or more different antigens of interest. For example, a heterodimer can be created with a first antigen linked to a second different, antigen (or a heterotrimer comprising two or three different antigens). When the oligomerization domains associate together, the construct will form a tetramer (if a dimerization domain is used) that is dimeric for both the first and second antigen, a hexamer (if a trimerization domain is used in the construct) that is dimeric for at least the first and second antigen or trimeric for the first, second, and third antigen, or an octamer (if a tetramerization domain is used). Alternatively a trimeric protein can be formed if the original protein is presented in monomeric form in association with the trimerization domain.
[0043] One aspect is directed to a fusion protein comprising a first antigen, a linker sequence, a second antigen, and an oligomerization domain, wherein the linker sequence joins the first antigen to the second antigen and wherein the fusion protein does not include a tetanus toxoid protein. In one embodiment, the first and second antigens are the same. In another embodiment, the first and second antigens are different. The first and second antigens can be viral antigens, bacterial antigens, parasite antigens, autoimmune antigens, or tumor antigens. In one embodiment, the first and second antigens comprise a polypeptide and/or a polysaccharide. In one embodiment, the fusion protein forms a multimeric protein when expressed in a host cell. In another embodiment, the first, second, and third antigens do not occur naturally as a multimeric protein.
[0044] The fusion protein may optionally further comprise a third protein and a second linker sequence, where the second linker sequence joins the second antigen to the third antigen, the first antigen, or the oligomerization domain. In other embodiments, the fusion protein comprises four or more proteins and additional linkers. In one embodiment, the fusion protein forms a multimeric protein when expressed in a host cell. In another embodiment, the first and second antigens do not occur naturally as a multimeric protein.
[0045] In certain embodiments, the oligomerization domain is a dimerization domain. In other embodiments, the oligomerization domain is a trimerization or tetrameric domain. In one embodiment, the dimerization domain is a leucine zipper domain, including but not limited to a yeast GCN4 leucine zipper domain or a derivative thereof. In another embodiment, the trimerization domain is a T4 bacteriophage fibritin motif or a eukaryotic GNC4 transcription factor motif or a derivative thereof. In other embodiments, the tetrameric domain is a modified eukaryotic GCN4 transcription factor motif or a derivative thereof. In embodiments with two antigens, the oligomerization domain can be located at the N terminus of the fusion protein before the first antigen, at the C terminus of the fusion protein after the second antigen, or between the first and second antigens. In embodiments where the fusion protein further comprises a third protein, the oligomerization domain can be located at the N terminus of the fusion protein before the first antigen, at the C terminus of the fusion protein after the third antigen, between the first and second antigens, or between the second antigen and the third protein. In embodiments where the fusion protein comprises four or more proteins, the oligomerization domain can be located at the N terminus of the fusion protein before the first antigen, at the C terminus of the fusion protein after the last antigen, or between any antigens in the fusion protein.
[0046] In one embodiment, the first and second antigen is an EBV antigen, including, but not limited to, a gp350/220 antigen, gH, gL, gB, or gp42. In one embodiment, the fusion protein comprises a homodimer or homotrimcr of EBV gp350/220, gHl, gL, gB, or gp42. In another embodiment, the fusion protein comprises a heterodimer or heterotrimer of EBV antigens selected from gp350/220, gH, gL, gB, or gp42, such as a heterodimer of gH and gL, gB and gp42, gp350/220 and gB, gp350/220 and gp42, or a heterotrimer of gH, gL, and gB; gH, gL, and gp42; gp350/220, gH, and gL; or gp350/220, gB and gp42.
[0047] In another embodiment, the first and second antigen is a CMV antigen, including, but not limited to gB, gL, gH, or pp65. In yet another embodiment, the first antigen is an EBV antigen, including, but not limited to a gp350/220 antigen, and the second antigen is a CMV antigen, including, but not limited to gB, gL, gH, or pp65. In one embodiment, the fusion protein comprises a homodimer or homotrimer of gB, gL, gH, or pp65. In another embodiment, the fusion protein comprises a heterodimer or heterotrimer of CMV antigens selected from gB, gL, gH, and pp65, such as a heterodimer of gB and gL, gB and gH, gB and pp65, gL and gH, gL and pp65, or gH and pp65 or a heterotrimer of gB, gL, and gH, gB, gL, and pp65, gB, gH, and pp65, or gL, gH, and pp65.
[0048] In yet another embodiment, the first antigen is an EBV antigen, including, but not limited to, a gp350/220 antigen, gH, gL, gB, or gp42, and the second antigen is a CMV antigen, including, but not limited to gB, gL, gH, or pp65. In one embodiment, the first antigen is a gp350220 antigen and the second antigen is a CMV gB, gL, gH, or pp65.
[0049] In another embodiment, the first antigen is an EBV antigen, including, but not limited to a gp350/220 antigen, gH, gL, gB, or gp42, and the second antigen is an HIV antigen, including, but not limited to, Env (envelope protein, including, but not limited to gp160, gp140, gp20, and gp41gp140, gp120, or gp41), Gag (capsid protein), Pol (polymerase protein), Tat, Vif, Vpu, Vpr, Rev and Nef. Of course, these specific viral antigens are exemplary. In one embodiment, the first antigen is a gp350/220 antigen and the second antigen is an HIV Env (envelope protein, including, but not limited to gp160, gp140, gp120, and gp41gp140, gp120, or gp41), Gag (capsid protein), Pol (polymerase protein), Tat, Vif, Vpu, Vpr, Rev, or Nef. Given the disclosure of this application, one of skill in the art could substitute any antigen of interest into the fusion protein constructs described herein. Additional viral, bacterial, parasitic, autoimmune, and tumor antigens are discussed in more detail in other sections of the application.
[0050] Another aspect is directed to a fusion protein comprising a first protein, a linker sequence, a second protein, and an oligomerization domain, wherein the linker sequence joins the first protein to the second protein and wherein the first and second proteins are vaccine related proteins, such as a vaccine target protein, an adjuvanting protein, a cell surface targeting domain, a molecule that mediates immune suppression, or a cellular activating domain.
[0051] In one embodiment the fusion protein comprises a first protein, a linker sequence, a second protein, and an oligomerization domain, wherein the linker sequence joins the first protein to the second protein and wherein the first protein is a viral, bacterial, parasitic, autoimmune, tumor antigen, or other protein antigen and the second protein is an adjuvanting protein or comprises a cell surface targeting domain. In certain embodiments, the second protein is an adjuvanting protein, such as flagellin or a heat shock protein, or a toll like receptor (TLR) ligand. In certain embodiments, the cell surface targeting domain is specific for an antigen presenting cell, including, but not limited to a macrophage, a dendritic cell, or a B lymphocyte. In another embodiment, the first protein is a viral, bacterial, parasitic, autoimmune, or tumor antigen, the second protein comprises a cell surface targeting domain, and the fusion protein further comprises a third protein, wherein the third protein comprises a cellular activating domain. In this way, the fusion protein could be used to simultaneously target an antigen to a specific cell and activate the specific cell.
[0052] In another embodiment, the fusion protein comprises a first protein, a linker sequence, a second protein, and an oligomerization domain, wherein the linker sequence joins the first protein to the second protein and wherein the first protein comprises a first cell surface targeting domain and the second protein comprises a second cell surface targeting domain, wherein the first and second cell surface targeting domains target different cells. In this way, the fusion protein could be used to bring different types of cells into close proximity to each other, such as a natural killer cell or cytotoxic T lymphocyte and a tumor cell. In one embodiment, the first cell surface targeting domain binds to a ligand on a natural killer cell.
[0053] In another embodiment, the fusion protein comprises a first protein, a linker sequence, a second protein, and an oligomerization domain, wherein the linker sequence joins the first protein to the second protein and wherein the first protein is a molecule that mediates immune suppression and the second protein is a cell surface target domain that binds to an activated cell. In one embodiment, the molecule that mediates immune suppression binds to the Fe receptor of an antibody (e.g., Fc gamma receptor, Fc alpha receptor, or Fc epsilon receptor) and the cell surface target domain that binds to an activated cell binds to a ligand on a mast cell. In one embodiment, the Fc receptor is an Fc gamma receptor. In this way, the fusion protein construct could be used to suppress the activation of specific cells, for example, during an allergic reaction.
[0054] In yet another embodiment, the fusion protein comprises a first protein, a linker sequence, a second protein, and an oligomerization domain, wherein the linker sequence joins the first protein to the second protein and wherein the first and second proteins are HIV proteins. In one embodiment, the first and second proteins are selected from Env (envelope protein, including, but not limited to gp160, gp140, gp120, and gp41 gp140, gp120, or gp41), Gag (capsid protein), Pol (polymerase protein), Tat, Vif, Vpu, Vpr, Rev and Nef. In one embodiment, the first HIV protein is gp120 and the second HIV protein is gp41 and the oligomerization domain is a trimerization domain. In certain embodiments, the first and second proteins are HIV proteins, such as gp120 and gp41, the oligomerization domain is a trimcrization domain, and the fusion protein further comprises a third protein and a second linker sequence and, optionally, a fourth protein and a third linker sequence. In one embodiment, the third protein is an EBV gp350/220 antigen. In another embodiment, the third protein and fourth protein are EBV gp350/220 antigens.
[0055] In certain embodiments, the oligomerization domain is a dimerization domain. In other embodiments, the oligomerization domain is a trimerization domain or tetrameric domain. In one embodiment, the dimerization domain is a leucine zipper domain, including but not limited to a yeast GCN4 lIcucine zipper domain or a derivative thereof. In another embodiment, the trimerization domain is a T4 bacteriophage fibritin motif or a eukaryotic GNC4 transcription factor motif or a derivative thereof. In other embodiments, the tetrameric domain is a modified eukaryotic GNC4 transcription factor motif or a derivative thereof.
[0056] In embodiments with two proteins, the oligomerization domain can be located at the N terminus of the fusion protein before the first protein, at the C terminus of the fusion protein after the second protein, or between the first and second proteins. In embodiments with three proteins, the oligomerization domain can be located at the N terminus of the fusion protein before the first protein, at the C terminus of the fusion protein after the third protein, between the first and second proteins, or between the second and third proteins. In embodiments where the fusion protein comprises four or more proteins, the oligomerization domain can be located at the N terminus of the fusion protein before the first antigen, at the C terminus of the fusion protein after the last antigen, or between any antigens in the fusion protein.
[0057] Antigens. As used in this application, antigen means a protein or fragment thereof or a polysaccharide linked to a protein carrier that, when expressed in an animal or human cell or tissue, is capable of triggering an immune response. The protein or fragment thereof may be glycosylated or non-glycosylated. Examples include, but are not limited to, viral proteins, bacterial proteins, parasite proteins, autoimmune proteins, and tumor proteins. The antigen may be a wild-type protein, a truncated form of that protein, a mutated form of that protein or any other variant of that protein, in each case able to contribute to immune responses upon expression in the animal or human host to be vaccinated. In certain embodiments, the antigen is a polysaccharide, such as an antigenic polysaccharide from a pathogenic bacterium, that is linked to a protein carrier comprising a glycosylation consensus sequence, as described, for example, in the following published U.S. patent applications, the disclosures of which are hereby incorporated by reference in their entirety: US2011/0097357 and US2011/0274720.
[0058] The viral pathogens from which the viral antigens are derived include, but are not limited to: Orthomyxoviruses, such as influenza virus; Retroviruses, such as RSV, HTLV-I, and HTLV-II, Herpesviruses such as Epstein Barr Virus (EBV); cytomegalovirus (CMV) or herpes simplex virus; Lentiviruses, such as human immunodeficiency virus 1 (HIV-1) and HIV-2; Hepdnavirus, such as hepatitis B virus (HBV); Flavivirus, such as dengue fever virus; Rhabdoviruses, such as rabies virus; Picornaviruses, such as Poliovirus; Poxviruses, such as vaccinia virus; Rotavirus; and Parvoviruses, such as Adeno-Associated Viruses (AAV).
[0059] Examples of viral antigens can be found in the group including, but not limited to, the Human Immunodeficiency Virus (HIV) antigens Rev, Pol, Nef, Gag, Env, Tat, mutant derivatives of Tat, such as Tat-631-45, T- and B-cell epitopes of gp120, chimeric derivatives of HIV-1 Env and gp120, such as a fusion between gp120 and CD4, gp41, a truncated or modified HIV-1 Env, such as gp140 or derivatives of HIV-1 Env and/or gp140. Other examples are EBV envelope glycoproteins, such as Gp350/220; CMV antigens, such as gB, gL, gH, or pp65; hepatitis B surface antigen; rotavirus antigens, such as VP4 and VP7; influenza virus antigens, such as hemagglutinin, neuraminidase, M2, or nucleoprotein; flavivirus antigens, such as non-structural protein NSI; and herpes simplex virus antigens such as thymidine kinase. The EBBV Gp350/220 antigen is discussed in further detail below.
[0060] Examples of bacterial pathogens from which the bacterial antigens may be derived include, but are not limited to, Streptococcus spp. (including S. pneumoniae), Enterococcus spp., Shigella spp., Salmonella spp., Mycobaterium spp., Clostridium spp., Rickettsia spp., Helicobacterpylori spp., Escherichia coli spp., Pseudomonas spp., Listeria spp., Legionella pneumonia, Borellia burgdorferi, Corynebacterium diphtheria, Bordetella pertussis, Chlamydia trachomitis, Haemophilus influenza, Neisseria meningitidis, Vibrio cholera, Listeria monocytogenes, or Bacillus anthracus.
[0061] Examples of protective antigens of bacterial pathogens include the pneumolysin, PsaA, PspC, histidine triad proteins, and pilus proteins of Streptococcus pneumoniae; the somatic antigens of enterotoxigenic E. coli, such as the CFA/1 fimbrial antigen and the nontoxic B-subunit of the heat-labile toxin; pertactin of Bordetella pertussis, adenylate cyclase-hemolysin of B. pertussis, fragment C of tetanus toxin of Clostridium tetani, OspA of Borellia burgdorferi, protective paracrystalline-surface-layer proteins of Rickettsia prowazekii and Rickettsia typhi, the listeriolysin (also known as Llo and Hly) and/or the superoxide dismutase (also known as SOD and p60) of Listeria monocytogenes, urease of Helicobacter pylori, and the receptor-binding domain of lethal toxin and/or the protective antigen of Bacillus anthracus.
[0062] The parasitic pathogens from which the parasitic antigens are derived include, but are not limited to: Plasmodium spp. such as Plasmodium falciparum, Trypanosome spp. such as Trypanosoma cruzi, Giardia spp. such as Giardia intestinalis, Boophilus spp., Babesia spp. such as Babesia microti, Entamoeba spp. such as Entamoeba histolytica, Eimeria spp. such as Eimeria maxima, Leishmania spp., Schistosome spp., Brugia spp.,
[0063] Examples of protective antigens of parasitic pathogens include the circumsporozoite (CS) or Liver Stage Specific (LSA) antigens LSA-1 and LSA-3 of Plasmodium spp. such as those of P. bergerii or P. falciparum, or immunogenic mutants thereof; the merozoite surface antigen of Plasmodium spp., the galactose-specific lectin of Entamoeba histolytica, gp63 of Leishmania spp., gp46 of Leishmania major, paramyosin of Brugia malayi, the triose-phosphate isomerase of Schistosoma mansoni, the secreted globin-like protein of Trichostrongylus colubriformis, the glutathione-S-transferase of Frasciola hepatica, Schistosoma bovis and S. japonicum, and KLH of Schistosoma bovis and S. japonicum.
[0064] The fusion protein may also include host antigens, which may be any cellular protein expressed in the recipient cell including, but not limited to, tumor, transplantation, and autoimmune antigens. Examples of such antigens include, but are not limited to, prostate-specific antigen, mucin-1 (MUCI), gp100, HER2, AE37, E75, GP2, TAG-72, carcinoembryonic antigen (CEA), melanoma associated antigen 1 (MAGE-1), tyrosinase, CD3, and IAS beta chain.
[0065] Epstein Barr Virus. Epstein Barr virus (EBV), also known as human herpesvirus 4, is a major, global source of morbidity and mortality, responsible for such pathologic entities as Burkitt lymphoma, nasopharyngeal carcinoma, infectious mononucleosis, a subset of Hodgkin's disease, and the lymphoproliferative syndrome in immunosuppressed patients [1-3]. EBV has a double stranded, linear DNA genome. The nucleotide sequence of the EBV genome (SEQ ID NO: 15) and the amino acid sequences of the viral proteins encoded thereby are known and set forth under the NCBI Reference Number NC_009334, Version NC_009334.1, GI:139424470, which sequences are hereby incorporated by reference.
[0066] In the developing world, EBV seroconversion typically occurs in infancy, whereas in developed countries it is more likely contracted in adolescence. Infectious mononucleosis typically occurs only in this latter group [3]. The major human reservoir for latent EBV and EBV transmission is the resting memory B lymphocyte [4]. EBV is dependent upon the gp350-CD21 binding event for viral entry into the B cell [5, 6], an event that is critical for infectivity and B cell neoplastic transformation [2]. Gp350 is the major EBV outer membrane glycoprotein, while CD21, also known as complement receptor type 2 (CR2), is a receptor on the surface of B cells that binds to iC3b complement protein. Sera from patients with active EBV infection contain antibody that prevent EBV entry into B cells (neutralizing antibody). Adsorption of these sera with gp350, eliminates most of this neutralizing activity [7], indicating that gp350 serves as the major EBV antigen to which a protective humoral immune response is directed.
[0067] A number of studies have demonstrated that immunization of non-human primates with a subunit gp350 vaccine in adjuvant protects against experimental EBV-induced lymphoma or EBV replication. Thus, purified native gp350, injected into cottontop marmosets (CTM), in association with liposomes, ISCOM's, or muramyl dipeptide, protected against EBV-induced lymphoma [8, 9]. Recombinant gp350 in alum or muramyl dipeptide was similarly protective [10, 11]. Common marmosets also showed decreased viral replication after EBV challenge following immunization with recombinant gp350 in alum [12]. Non-human primate studies using gp350 expressed by adenoviral or vaccinia viral vectors have similarly shown protection against experimental EBV-induced lymphoma or EBV replication in CTM or common marmosets [13-15].
[0068] A pilot study in humans has also suggested a potential role for gp350 vaccination in host protection against EBV. In a study by Gu et al [16] a single dose of gp350/220 expressed by vaccinia virus (VV) was give by scarification to 1-3 year olds who were EBV-seronegative, and VV-seronegative. These children developed neutralizing antibodies to EBV (1:40-1:160). Whereas 10/10 unvaccinated controls became infected at 16 months of follow-up, only 3/9 vaccinated children became infected at this time. More recently, Phase I/II studies were conducted in which healthy EBV-seronegative adults were immunized with a recombinant monomeric gp.sup.350 protein in alum+/?monophosphoryl lipid A [17, 18]. Following 3 doses, up to 82% of subjects had detectable neutralizing serum anti-gp350 antibody titers. The vaccine demonstrated an efficacy of 78.0% in preventing the development of infectious mononucleosis but not in preventing asymptomatic EBV infection. Finally, an additional phase I trial of recombinant monomeric gp350 protein in alum given to children with chronic kidney disease demonstrated only a minority of subjects developing detectable neutralizing serum anti-gp350 titers [19].
[0069] A monomeric protein, as used in phase I/II human clinical trials assessing gp350-induced IgG responses, is by itself a relatively weak immunogen relative to proteins that are expressed in a multimeric manner or that are aggregated [20-25]. Without intending to be bound by any theory, increased immunogenicity of multimeric proteins is most likely due, at least in part, to their more avid binding to, and crosslinking of the B cell receptor followed by more potent signaling and enhanced uptake of antigen by the B cell.
[0070] Gp350/220. The EBV glycoprotein gp350 and the related splice variant gp220 are responsible for attachment of EBV with high affinity to CR2 on B cells. Antibodies to gp350/220 that block EBV binding neutralize B-cell infection. gp350/220 is a highly glycosylated single-pass membrane protein. As a result of alternative splicing, the viral glycoprotein appears in two forms, with approximate masses of 350 and 220 kDa. The 200 kDa splice form lacks residues 500-757 of the full length gp350. Both gp350 and gp220 retain the CR2 binding domain at the amino terminus. A truncated version of gp350/220 having amino acids 1-470 of gp350 retains the ability to bind CR2 and can inhibit the binding of EBV to CR2 [29]. In addition, portions of the gp350/220 protein between amino acids 21-26 or between amino acids 372-378 of the gp350 sequence have been linked to CR2 binding. Tanner et al., Cell 203-213 (1987) and Nemerow et al. 61:1416-20 (1987). Thus, the term gp350/220 protein or gp350/220 antigen refers to the full length gp.sup.350 or gp220 proteins as well as fragments or modified versions thereof that retain the ability to bind the CR2.
[0071] The amino acid and nucleic acid sequence of gp350, set forth in GenBank under Accession Number M10593, Version M10593.1, GI 330360, is hereby incorporated by reference. The amino acid sequence of gp350 is:
TABLE-US-00001 (SEQIDNO:1) MEAALLVCQYTIQSLIHLTGEDPGFFNVEIPEFPFYPTCNVCTADVNVTI 50 NFDVGGKKHQLDLDFGQLTPHTKAVYQPRGAFGGSENATNLFLLELLGAG 100 ELALTMRSKKLPINVTTGEEQQVSLESVDVYFQDVFGTMWCHHAEMQNPV 150 YLIPETVPYIKWDNCNSTNITAVVRAQGLDVTLPLSLPTSAQDSNFSVKT 200 EMLGNEIDIECIMEDGEISQVLPGDNKFNITCSGYESHVPSGGILTSTSP 250 VATPIPGTGYAYSLRLTPRPVSRFLGNNSILYVFYSGNGPKASGGDYCIQ 300 SNIVFSDEIPASQDMPTNTTDITYVGDNATYSVPMVTSEDANSPNVTVTA 350 FWAWPNNTETDFKCKWTLTSGTPSGCENISGAFASNRTFDITVSGLGTAP 400 KTLIITRTATNATTTTHKVIFSKAPESTTTSPTLNTTGFADPNTTTGLPS 450 STHVPTNLTAPASTGPTVSTADVTSPTPAGTTSGAGPVTPSPSPWDNGTE 500 SKAPDMTSSTSPVTTPTPNATSPTPAVTTPTPNATSPTPAVTTPTPNATS 550 PTLGKTSPTSAVTTPTPNATSPTLGKTSPTSAVTTPTPNATSPTLGKTSP 600 TSAVTTPTPNATGPTVGETSPQANATNHTLGGTSPTPVVTSQPKNATSAV 650 TTGQHNITSSSTSSMSLRPSSNPETLSPSTSDNSTSHMPLLTSAHPTGGE 700 NITQVTPASISTHHVSTSSPEPRPGTTSQASGPGNSSTSTKPGEVNVTKG 750 TPPQNATSPQAPSGQKTAVPTVTSTGGKANSTTGGKHTTGHGARTSTEPT 800 TDYGGDSTTPRPRYNATTYLPPSTSSKLRPRWTFTSPPVTTAQATVPVPP 850 TSQPRFSNLSMLVLQSASLAVLTLLLLLVMADCAFRRNLSTSHTYTTPPY 900 DDAETYV 907
[0072] The amino acid sequence of gp220, set forth in GenBank under Accession Number M10593, Version M10593.1, GI 330360, and hereby incorporated by reference, is:
TABLE-US-00002 (SEQIDNO:2) MEAALLVCQYTIQSLIHLTGEDPGFFNVEIPEFPFYPTCNVCTADVNVTI 50 NFDVGGKKHQLDLDFGQLTPHTKAVYQPRGAFGGSENATNLFLLELLGAG 100 ELALTMRSKKLPINVTTGEEQQVSLESVDVYFQDVFGTMWCHHAEMQNPV 150 YLIPETVPYIKWDNCNSTNITAVVRAQGLDVTLPLSLPTSAQDSNFSVKT 200 EMLGNEIDIECIMEDGEISQVLPGDNKFNITCSGYESHVPSGGILTSTSP 250 VATPIPGTGYAYSLRLTPRPVSRFLGNNSILYVFYSGNGPKASGGDYCIQ 300 SNIVFSDEIPASQDMPTNTTDITYVGDNATYSVPMVTSEDANSPNVTVTA 350 FWAWPNNTETDFKCKSTLTSGTPSGCENISGAFASNRTFDITVSGLGTAP 400 KTLIITRTATNATTTTHKVIFSKAPESTTTSPTLNTTGFADPNTTTGLPS 450 STHVPTNLTAPASTGPTVSTADVTSPTPAGTTSGASPVTPSPSPWDNGTE 500 STPPQNATSPQAPSGQKTAVPTVTSTGGKANSTTGGKHTTGHGARTSTEP 550 TTDYGGDSTTPRPRYNATTYLPPSTSSKLRPRWTFTSPPVTTAQATVPVP 600 PTSQPRFSNLSMLVLQWASLAVLTLLLLLVMADCAFRRNLSTSHTYTTPP 650 YDDAETYV 658
[0073] EBVgH, gL, gB, and gp42. EBV is an enveloped virus that gains entry into host cells by fusing its own lipid membrane with the host cell membrane. EBV can infect both B cells and epithelial cells. The minimal requirement for viral fusion with B cells includes EBV glycoproteins gH, gL, gB, and gp42. For infection of B cells, gp42 binds to the host cell MHC class II molecules to trigger viral cell membrane fusion. On the other hand, for infection of epithelial cells, gp42 is not required. Rather, the EB3V gHl, gL, and gB proteins are sufficient for viral fusion with epithelial cells. EBV gH/gL exists as a noncovalently associated complex. EBV gI, can be expressed independently of gH, but in order for EBV gHl to fold properly and traffic to the cell surface, gL must also be present.
[0074] The amino acid sequence of EBV gH is:
TABLE-US-00003 (SEQIDNO:16) MQLLCVFCLVLLWEVGAASLSEVKLHLDIEGHASHYTIPWTELMAKVPGL 50 SPEALWREANVTEDLASMLNRYKLIYKTSGTLGIALAEPVDIAPVSEGSM 100 QVDASKVHPGVISGLNSPACMLSAPLEKQLFYYIGTMLPNTRPHSYVFYQ 150 LRCHLSYVALSINGDKFQYTGAMTSKFLMGTYKRVTEKGDEHVLSLIFGK 200 TKDLPDLRGPFSYPSLTSAQSGDYSLVIVTTFVHYANFHNYFVPNLKDMF 250 SRAVTMTAASYARYVLQKLVLLEMKGGCREPELDTETLTTMFEVSVAFEK 300 VGHAVGETGNGCVDLRWLAKSFFELTVLKDIIGICYGATVKGMQSYGLER 350 LAAVLMATVKMEELGHLTTEKQEYALRLATVGYPKAGVYSGLIGGATSVL 400 LSAYNRHPLFQPLHTVMRETLFIGSHVVLRELRLNVTTQGPNLALYQLLS 450 TALCSALEIGEVLRGLALGTESGLFSPCYLSLRFDLTRDKLLSMAPQEAM 500 LDQAAVSNAVDGFLGRLSLEREDRDAWHLPAYKCVDRLDKVLMIIPLINV 550 TFIISSDREVRGSALYEASTTYLSSSLFLSPVIMNKCSQGAVAGEPRQIP 600 KIQNFTRTQKSCIFCGFALLSYDEKEGLETTTYITSQEVQNSILSSNYFD 650 FDNLHVHYLLLTTNGTVMEIAGLYEERAHVVLAIILYFIAFALGIFLVHK 700 IVMFFL 706
[0075] The amino acid sequence of EBV gL is:
TABLE-US-00004 (SEQIDNO:17) MRTVGVFLATCLVTIFVLPTWGNWAYPCCHVTQLRAQHLLALENISDIYL 50 VSNQTCDGFSLASLNSPKNGSNQLVISRCANGLNVVSFFISILKRSSSAL 100 TGHLRELLTTLETLYGSFSVEDLFGANLNRYAWHRGG 137
[0076] The amino acid sequence of EBV gB is:
TABLE-US-00005 (SEQIDNO:18) MTRRRVLSVVVLLAALACRLGAQTPEQPAPPATTVQPTATRQQTSFPFRV 50 CELSSHGDLFRFSSDIQCPSFGTRENHTEGLLMVFKDNIIPYSFKVRSYT 100 KIVTNILIYNGWYADSVTNRHEEKFSVDSYETDQMDTIYQCYNAVKMTKD 150 GLTRVYVDRDGVNITVNLKPTGGLANGVRRYASQTELYDAPGWLIWTYRT 200 RTTVNCLITDMMAKSNSPFDFFVTTTGQTVEMSPFYDGKNKETFHERADS 250 FHVRTNYKIVDYDNRGTNPQGERRAFLDKGTYTLSWKLENRTAYCPLQHW 300 QTFDSTIATETGKSIHFVTDEGTSSFVTNTTVGIELPDAFKCIEEQVNKT 350 MHEKYEAVQDRYTKGQEAITYFITSGGLLLAQLPLTPRSLATVKNLTELT 400 TPTSSPPSSPSPPAPPAARGSTSAAVLRRRRRDAGNATTPVPPAAPGKSL 450 GTLNNPATVQIQFAYDSLRRQINRMLGDLARAWCLEQKRQNMVLRELTKI 500 NPTTVMSSIYGKAVAAKRLGDVISVSQCVPVNQATVTLRKSMRVPGSETM 550 CYSRPLVSFSFINDTKTYEGQLGTDNEIFLTKKMTEVCQATSQYYGQSGN 600 EIHVYNDYHHFKTIELDGIATLQTFISLNTSLIENIDFASLELYSRDEQR 650 ASNVFDLEGIFREYNFQAQNIAGLRKDLDNAVSNGRNQFVDGLGELMDSL 700 GSVGQSITNLVSTVGGLFSSLVSGFISFFKNPFGGMLILVLVAGVVILVI 750 SLTRRTRQMSQQPVQMLYPGIDELAQQHASGEGPGINPISKTELQAIMLA 800 LHEQNQEQKRAAQRAAGPSVASRALQAARDRFPGLRRRRYHDPETAAALL 850 GEAETEF 857
[0077] The amino acid sequence of EBV gp42 is:
TABLE-US-00006 (SEQIDNO:19) MVSFKQVRVPLFTAIALVIVLLLAYFLPPRVRGGGRVSAAAITWVPKPNV 50 EVWPVDPPPPVNFNKTAEQEYGDKEIKLPHWTPTLHTFQVPKNYTKANCT 100 YCNTREYTFSYKERCFYFTKKKHTWNGCFQACAELYPCTYFYGPTPDILP 150 VVTRNLNAIESLWVGVYRGVEGNWTSLDGGTFKVYQIFGSHCTYVSKFST 200 VPVSHHECSFLKPCLCVSQRSNS 223
[0078] Modified gp350/220 polypeptides that bind to CR2 include naturally-occurring or synthetically programmed variant polypeptides substantially identical to either the gp350 or gp220 polypeptides (e.g., SEQ ID Nos: 1 and 2), but which have an amino acid sequence different from that of gp350 or gp220 because of one or more deletions, insertions or substitutions. Some gp350/220 variant sequences have already been identified by sequencing the DNA of different strains of EBV, and are readily available to one of ordinary skill in the art (Beiscl et al., J. Viriol. 1985, 54(3):665-74). Similarly, modified gH, gL, gB, and gp42 polypeptides include naturally-occurring or synthetically programmed variant polypeptides substantially identical to either the gH, gL, gB, or gp42 polypeptides (e.g., SEQ ID Nos: 16, 17, 18, or 19), but which have an amino acid sequence different from that of gH, gL, gB, or gp42 because of one or more deletions, insertions or substitutions.
[0079] The variant amino acid sequence preferably is at least 60%, 65%, 70%, or 80%, identical to a gp350/220 polypeptide of SEQ ID Nos. 1 or 2 or a gH, gL, gB, or gp42 polypeptide of SEQ ID Nos. 16, 17, 18, or 19, more preferably at least 85% identical, still more preferably at least 90% identical, and most preferably at least 95% identical. The percent identity can be determined, for example, by comparing sequence information using the GAP computer program, version 6.0 described by Devereux et al. (Nucl. Acids Res. 12:387, 1984) and available from the University of Wisconsin Genetics Computer Group (UWGCG). The GAP program utilizes the alignment method of Needleman and Wunsch (J. Mol. Biol. 48:443, 1970), as revised by Smith and Waterman (Adv. Appl. Math 2:482, 1981). The preferred default parameters for the GAP program include: (1) a unary comparison matrix (containing a value of 1 for identities and 0 for non-identities) for nucleotides, and the weighted comparison matrix of Gribskov and Burgess, Nucl. Acids Res. 14:6745, 1986, as described by Schwartz and Dayhoff, eds., Atlas of Protein Seauence and Structure, National Biomedical Research Foundation, pp. 353-358, 1979; (2) a penalty of 3.0 for each gap and an additional 0.10 penalty for each symbol in each gap; and (3) no penalty for end gaps.
[0080] Variant polypeptides can be obtained by mutation of nucleotide sequences encoding the gp350/220, gH, gL, gB, or gp42 polypeptides. Alterations of the amino acid sequence can occur naturally, or be accomplished by any of a number of conventional methods. Mutations can be introduced at particular loci by synthesizing oligonucleotides containing a mutant sequence, flanked by restriction sites enabling ligation to fragments of the native sequence. Following ligation, the resulting reconstructed sequence encodes an analog having the desired amino acid insertion, substitution, or deletion.
[0081] Alternatively, oligonucleotide-directed site-specific mutagenesis procedures can be employed to provide an altered gene wherein predetermined codons can be altered by substitution, deletion or insertion. Exemplary methods of making the alterations set forth above are disclosed by Walder et al. (Gene 42:133, 1986); Bauer et al. (Gene 37:73, 1985); Craik, (BioTechniques, Jan. 12-19, 1985); Smith et al. (Genetic Engineering: Principles and Methods, Plenum Press, 1981); Kunkel (Proc. Natl. Acad. Sci. USA 82:488, 1985); Kunkel et al. (Methods in Enzymol. 154:367, 1987); and U.S. Pat. Nos. 4,518,584 and 4,737,462, all of which are incorporated by reference.
[0082] Oligomerization Domain. Oligomerization domains are polypeptides that cause polypeptides comprising them to oligomerize, i.e., to form covalent and/or non-covalent associations with another polypeptide comprising a corresponding oligomerization domain. Thus, two or more polypeptides are oligomerized if they are bound to each other via their oligomerization domains. Any oligomerization domain known in the art can be used. Examples include leucine zipper domains and fibritin domains. The polypeptides in an oligomer can have identical polypeptide sequences, similar polypeptide sequences, or different polypeptide sequences.
[0083] Homodimerization and homo-oligomerization refer to the association of the same polypeptide components to form dimers or oligomers. Heterodimerization and hetero-oligomerization refer to the association of different polypeptides to form dimers or oligomers. Homo-oligomers thus comprise an association of multiple copies of a particular polypeptide, while hetero-oligomers comprise an association of copies of different polypeptides. Oligomcrization, oligomerize, and oligomer, with or without prefixes, are intended to encompass dimerization, dimerize, and dimer. Thus, in one embodiment, the oligomerization domain is a dimerization domain that mediates the self-association of two fusion proteins. In another embodiment, the oligomcrization domain is a trimerization domain that mediates the self-association of three fusion proteins. In another embodiment, the oligomerization domain is a tetramerization domain that mediates the self-association of four fusion proteins. In one embodiment, the trimerization domain is fibritin motif or a eukaryotic GCN4 transcription factor motif or derivative thereof.
[0084] In one embodiment, the oligomerization domain comprises a leucine zipper domain. Leucine zipper domains are peptides that promote oligomerization of the proteins in which they are found. Leucine zippers were originally identified in several DNA-binding proteins (Landschulz et al., Science 240:1759, 1988), and have since been found in a variety of different proteins. Among the known leucine zippers are naturally occurring peptides and derivatives thereof that dimerize or trimerize. For example, the yeast GCN4 leucine zipper can be used to dimerize polypeptides of interest [27, 28]. Other examples of leucine zipper domains suitable for producing soluble multimeric proteins are described in PCT application WO 94/10308, and the leucine zipper derived from lung surfactant protein D (SPD) described in Hoppe et al. FEBS Lett. 344:191, 1994. The use of a modified leucine zipper that allows for stable trimerization of a heterologous protein fused thereto is described in Fanslow et al., Semin. Immunol. 6:267, 1994.
[0085] In yet another embodiment, the oligomerization domain is a fibritin trimerization motif, particularly a bacteriophage fibritin trimerization motif, more particularly a fibritin trimerization domain from bacteriophage T4 or phage RB69 or phage AR1 or a derivative thereof. The T4 fibritin trimerization domain and variants thereof are described in U.S. Pat. No. 6,911,205; U.S. Pat. No. 8,147,843, and WO 01/19958, which are hereby incorporated by reference in their entirety.
[0086] Linker Sequences. Linker sequences are used in the fusion proteins to separate different components of the fusion protein. Thus, the amino terminal end of the linker sequence is joined by a peptide bond to a first polypeptide and the carboxy terminal end of the linker sequence is joined by a peptide bind to a second polypeptide. The first or second polypeptide may be an antigen, an oligomerization domain, an adjuvanting protein, a cell surface targeting domain, a molecule that mediates immune suppression, or a cellular activation domain. Such a linker sequence joins the first polypeptide and the second polypeptide, in contrast to a first polypeptide and a second polypeptide that are joined together without an intervening polypeptide sequence. Thus, the linker sequence can join two antigens, an antigen and an oligomerization domain, an antigen and an adjuvanting protein, an antigen and a cell surface targeting domain, an antigen and a molecule that mediates immune suppression, and an antigen and a cellular activation domain, an adjuvanting protein and an oligomerization domain, etc. It is understood that the linker sequence is not a sequence that naturally separates a first and second polypeptide, if the first and second polypeptide happen to naturally exist in combination together.
[0087] In one embodiment, the linker sequence is a polypeptide having 5-25 amino acids, particularly a length of 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 amino acids. In another embodiment, the linker sequence is a polypeptide having 10-25 amino acids. The linker sequence preferably comprises glycine and serine amino acids. In one embodiment, the linker sequence is 15 amino acids in length and has the amino acid sequence (Gly.sub.4Ser).sub.3 (SEQ ID NO:3).
[0088] Other suitable peptide linkers are those described in U.S. Pat. Nos. 4,751,180, 4,935,233, and 5,073,627, each of which is hereby incorporated by reference in its entirety. A DNA sequence encoding a desired linker sequence may be inserted between, and in the same reading frame as, for example, DNA sequences encoding the first and second polypeptide using conventional techniques known in the art. For example, a chemically synthesized oligonucleotide encoding the linker may be ligated between sequences encoding the first and second polypeptide.
[0089] Nucleic Acids, Cloning and Expression Systems. The present disclosure further provides isolated nucleic acids encoding the disclosed fusion proteins. The nucleic acids may comprise DNA or RNA and may be wholly or partially synthetic or recombinant. Reference to a nucleotide sequence as set out herein encompasses a DNA molecule with the specified sequence, and encompasses a RNA molecule with the specified sequence in which U is substituted for T, unless context requires otherwise.
[0090] The present disclosure also provides constructs in the form of plasmids, vectors, phagemids, transcription or expression cassettes which comprise at least one nucleic acid encoding a fusion protein or a portion thereof. The disclosure further provides a host cell which comprises one or more constructs as above.
[0091] Also provided are methods of making the fusion proteins encoded by these nucleic acids. The fusion proteins may be produced using recombinant techniques. The production and expression of recombinant proteins is well known in the art and can be carried out using conventional procedures, such as those disclosed in Sambrook et al., Molecular Cloning: A Laboratory Manual (4th Ed. 2012), Cold Spring Harbor Press. For example, expression of the fusion protein may be achieved by culturing under appropriate conditions recombinant host cells containing the nucleic acid encoding the fusion protein. Following production by expression a fusion protein may be isolated and/or purified using any suitable technique, then used as appropriate.
[0092] Systems for cloning and expression of a polypeptide in a variety of different host cells are well known in the art. Any protein expression system compatible with the constructs disclosed in this application may be used to produce the disclosed fusion protein.
[0093] Suitable vectors can be chosen or constructed, so that they contain appropriate regulatory sequences, including promoter sequences, terminator sequences, polyadenylation sequences, enhancer sequences, marker genes and other sequences as appropriate.
[0094] A further aspect of the disclosure provides a host cell comprising a nucleic acid as disclosed herein. A still further aspect provides a method comprising introducing such nucleic acid into a host cell. The introduction may employ any available technique. For eukaryotic cells, suitable techniques may include calcium phosphate transfection, DEAE-Dextran, electroporation, liposome-mediated transfection and transduction using retrovirus or other virus, e.g., vaccinia or, for insect cells, baculovirus. For bacterial cells, suitable techniques may include calcium chloride transformation, electroporation and transfection using bacteriophage. These techniques are well known in the art. See e.g., Current Protocols in Molecular Biology, Ausubel et al. eds., John Wiley & Sons (2010). DNA introduction may be followed by a selection method (e.g., antibiotic resistance) to select cells that contain the vector.
[0095] Vaccine Compositions. The fusion proteins and nucleic acids encoding the same that are described in this application provide an improved platform for developing a vaccine that achieves enhanced immunogenicity in a subject.
[0096] Thus, one aspect is directed to a composition comprising the nucleic acid encoding the fusion protein or the fusion protein, at least one pharmaceutically acceptable excipient, and optionally an adjuvant (hereinafter referred to as vaccine composition). In certain embodiments, the vaccine composition does not include an adjuvant.
[0097] The pharmaceutically acceptable excipient can be chosen from, for example, diluents such as starch, microcrystalline cellulose, dicalcium phosphate, lactose, sorbitol, mannitol, sucrose, methyl dextrins; binders such as povidone, hydroxypropyl methylcellulose, dihydroxy propylcellulose, and sodium carboxylmethylcellulose; and disintegrants such as crospovidone, sodium starch glycolate, croscarmellose sodium, and mixtures of any of the foregoing. The pharmaceutically acceptable excipient can further be chosen from lubricants such as magnesium stearate, calcium stearate, stearic acid, glyceryl behenate, hygrogenated vegetable oil, glycerine fumerate and glidants such as colloidal silicon dioxide, and mixtures thereof. In some embodiments, the pharmaceutically acceptable excipient is chosen from microcrystalline cellulose, starch, talc, povidone, crospovidone, magnesium stearate, colloidal silicon dioxide, sodium dodecyl sulfate, and mixtures of any of the foregoing. The excipients can be intragranular, intergranular, or mixtures thereof.
[0098] The vaccine composition can be formulated as freeze-dried or liquid preparations according to any means suitable in the art. Non-limiting examples of liquid form preparations include solutions, suspensions, syrups, slurries, and emulsions. Suitable liquid carriers include any suitable organic or inorganic solvent, for example, water, alcohol, saline solution, buffered saline solution, physiological saline solution, dextrose solution, water propylene glycol solutions, and the like, preferably in sterile form. After formulation, the vaccine composition can be incorporated into a sterile container which is then sealed and stored at a low temperature (e.g., 4? C.), or it can be freeze dried.
[0099] The vaccine composition can be formulated in either neutral or salt forms. Pharmaceutically acceptable salts include the acid addition salts (formed with the free amino groups of the active polypeptides) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or organic acids such as acetic, oxalic, tartaric, mandelic, and the like. Salts formed from free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, 2-ethylamino ethanol, histidine, procaine, and the like.
[0100] The vaccine composition can optionally comprise agents that enhance the protective efficacy of the vaccine, such as adjuvants. Adjuvants include any compound or compounds that act to increase an immune response to an antigen delivered by the fusion protein, thereby reducing the quantity of fusion protein (or nucleic acid encoding the same) necessary in the vaccine, and/or the frequency of administration necessary to generate a protective immune response. Adjuvants can include for example, emulsifiers, muramyl dipeptides, avridine, aqueous adjuvants such as aluminum hydroxide, chitosan-based adjuvants, and any of the various saponins, oils, and other substances known in the art, such as Amphigen, LPS, bacterial cell wall extracts, bacterial DNA, CpG sequences, synthetic oligonucleotides and combinations thereof (Schijns et al. (2000) Curr. Opin. Immunol. 12:456), Mycobacterialphlei (M. phlei) cell wall extract (MCWE) (U.S. Pat. No. 4,744,984), M. phlei DNA (M-DNA), and M. phlei cell wall complex (MCC). Compounds which can serve as emulsifiers include natural and synthetic emulsifying agents, as well as anionic, cationic and nonionic compounds. Among the synthetic compounds, anionic emulsifying agents include, for example, the potassium, sodium and ammonium salts of lauric and oleic acid, the calcium, magnesium and aluminum salts of fatty acids, and organic sulfonates such as sodium lauryl sulfate. Synthetic cationic agents include, for example, cetyltrhethylammonlum bromide, while synthetic nonionic agents are exemplified by glycerylesters (e.g., glyceryl monostearate), polyoxyethylene glycol esters and ethers, and the sorbitan fatty acid esters (e.g., sorbitan monopalmitate) and their polyoxyethylene derivatives (e.g., polyoxyethylene sorbitan monopalmitate). Natural emulsifying agents include acacia, gelatin, lecithin and cholesterol.
[0101] Other suitable adjuvants can be formed with an oil component, such as a single oil, a mixture of oils, a water-in-oil emulsion, or an oil-in-water emulsion. The oil can be a mineral oil, a vegetable oil, or an animal oil. Mineral oils are liquid hydrocarbons obtained from petrolatum via a distillation technique, and are also referred to in the art as liquid paraffin, liquid petrolatum, or white mineral oil. Suitable animal oils include, for example, cod liver oil, halibut oil, menhaden oil, orange roughy oil and shark liver oil, all of which are available commercially. Suitable vegetable oils, include, for example, canola oil, almond oil, cottonseed oil, corn oil, olive oil, peanut oil, safflower oil, sesame oil, soybean oil, and the like. Freund's Complete Adjuvant (PCA) and Freund's Incomplete Adjuvant (FIA) are two common adjuvants that are commonly used in vaccine preparations, and are also suitable for use in the present invention. Both FCA and FIA are water-in-mineral oil emulsions; however, FCA also contains a killed Mycobacterium sp.
[0102] Immunomodulatory cytokines can also be used in the vaccine compositions to enhance vaccine efficacy, for example, as an adjuvant. Non-limiting examples of such cytokines include interferon alpha (IFN-?), interleukin-2 (IL-2), and granulocyte macrophage-colony stimulating factor (GM-CSF), or combinations thereof.
[0103] The vaccine composition can be prepared using techniques well known to those skilled in the art including, but not limited to, mixing, sonication and microfluidation. The adjuvant can comprise from about 10% to about 80% (v/v) of the vaccine composition, more preferably about 20% to about 50% (v/v), and more preferably about 20% to about 30% (v/v), or any integer within these ranges.
[0104] The vaccine composition can be administered to any animal, and preferably is a mammal such as a human, mouse, rat, hamster, guinea pig, rabbit, cat, dog, monkey, cow, horse, pig, and the like. Humans are most preferred.
[0105] Administration of the vaccine composition can be by infusion or injection (e.g., intravenously, intramuscularly, intracutaneously, subcutaneously, intrathecal, intraduodenally, intraperitoneally, and the like). The vaccine composition can also be administered intranasally, vaginally, rectally, orally, intratonsilar, or transdermally. Additionally, the vaccine composition can be administered by needle-free delivery systems.
[0106] The effective amount of the vaccine composition may be dependent on any number of variables, including without limitation, the species, breed, size, height, weight, age, overall health of the patient, the type of formulation, or the mode or manner or administration. The appropriate effective amount can be routinely determined by those of skill in the art using routine optimization techniques and the skilled and informed judgment of the practitioner and other factors evident to those skilled in the art. Preferably, a therapeutically effective dose of the vaccine composition described herein will provide the therapeutic preventive benefit without causing substantial toxicity to the subject.
[0107] The vaccine composition can be administered to a patient on any schedule appropriate to induce and/or sustain an immune response against EBV Gp350/220 or any other protein of interest. For example, patients can be administered a vaccine composition as a primary immunization as described and exemplified herein, followed by administration of a secondary immunization, or booster, to bolster and/or maintain protective immunity.
[0108] The vaccine administration schedule, including primary immunization and booster administration, can continue as long as needed for the patient, for example, over the course of several years, to over the lifetime of the patient. The frequency of primary vaccine and booster administration and dose administered can be tailored and/or adjusted to meet the particular needs of individual patients, as determined by the administering physician according to any means suitable in the art.
[0109] The vaccine composition may be administered prophylactically (before exposure to the antigen or pathogen of interest) or therapeutically (after exposure to the antigen or pathogen of interest).
[0110] Methods of Inducing or Suppressing an Immune Response.
[0111] In another aspect, the vaccine composition comprising the fusion protein (or nucleic acid encoding the same) can be used in a method of inducing or suppressing an immune response. The immune response can be induced in a na?ve subject who has not previously been exposed to EBV, CMV, or HIV (or some other foreign pathogen). Alternatively, the immune response can be induced or suppressed in a subject who has been previously exposed to EBV, CMV, or HIV (or some other foreign pathogen) and used to enhance an existing immune response.
[0112] In one embodiment, the method of enhancing or suppressing an immune response comprises administering to a subject a vaccine composition comprising a fusion protein, as described in this application, wherein the fusion protein induces or suppresses an immune response against an antigen in the fusion protein in the subject. In another embodiment, the method of enhancing or suppressing an immune response comprises administering to a subject a vaccine composition comprising a nucleic acid construct that encodes a fusion protein, as described in this application, wherein the fusion protein is expressed in the subject and induces or suppresses an immune response against an antigen in the fusion protein in the subject.
[0113] In these methods of inducing or suppressing an immune response, the immune response can be measured using routine methods in the art, such as those disclosed in this application. These routine methods include, but are not limited to, measuring an antibody response, such as an antibody response directed against a protein encoded by the recombinant vector, and measuring cellular proliferation, including, for example, by measuring tritiated thymidine incorporation or cytokine (e.g., IFN-?) production.
[0114] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.
EXAMPLES
[0115] To test whether protein multimerization can provide a cost-effective and reproducible means for enhancing immune responses to target antigens of interest, a recombinant nucleic acid plasmid was designed to encode a fusion protein comprising a first and second antigen, separated by a linker sequence and an oligomerization domain. In the test construct prepared to validate the system, two identical gp350 sequences are separated by a (Gly.sub.4Ser).sub.3 (SEQ ID NO:3) linker to allow for proper protein folding [26], followed by a Saccharomyces cerevisiae GCN4 leucine zipper sequence [27, 28] to mediate self-association of the gp350 dimer, and thus formation of a tetrameric gp350. Immunization of mice with either the plasmid DNA itself or the resulting tetrameric protein results in markedly higher titers of gp350-specific IgG relative to the gp350 monomer, even in the presence of a strong adjuvant. Most importantly, the gp350 subunits that comprise the tetrameric protein are conformationally intact and elicit serum titers of neutralizing antibody that are more than 19-fold higher than that induced by monomer. These data strongly suggest a promising, new prophylactic EBV vaccine for future clinical testing, as well as a more general approach to enhance the immunogenicity of other proteins of vaccine interest.
[0116] Materials and Methods
[0117] Construction of plasmids for production of monomeric and tetrameric gp350.
[0118] A gp350 cDNA fragment encoding amino acids 1-470 was cloned by PCR amplification of the DNA isolated from a recombinant baculovirus that expressed the truncated gp350 [29]. The following primer set was used:
TABLE-US-00007 (SEQIDNO:4) forward 5-CACCATGGAGGCAGCCTTGCTTGT-3 and reverse 5-AGATCTTTAGGATACAGTGGGGCCTGTGC-3,
denatured at 94? C. for 30 sec, annealed at 52? C. for 30 sec, extended at 68? C. for 2 min, total 25 cycles. The cDNA fragment was inserted into the pENTR/SD/D-TOPO directional cloning vector (Invitrogen, Grand Island, N.Y.) and verified by sequencing.
[0119] Gp350 Monomer Construct:
[0120] To make the construct expressing gp350 monomer, PCR amplification was performed under the conditions as described above using the primer sets designated
TABLE-US-00008 GF1: (SEQIDNO:6) 5-GCCACCATGGAGACAGACACACTCCTGCTATGGGTACTGCTGCTCT GGGTTCCAGGTTCCACTGGTGACGCGGCCCAGCCGGCCAGGCGCGCGCG CCGTACGAAGCTCGCCCTT-3 and GR6: (SEQIDNO:7) 5-TCAATGGTGATGGTGATGATGGGTGGATACAGTGGGGCCTGT-3.
GF1 contained an IgGix leader sequence and GR6 contained the sequence coding for a His.sub.6 tag (SEQ ID NO: 14). The PCR product was cloned into the pOptiVEC-TOPO vector (Invitrogen), and verified by sequencing.
[0121] G35 tetramer construct with TT epitopes:
[0122] The construct expressing gp350 tetramer was made by creating two separate gp350 units: gp350F1R1 and gp350F2R5, followed by ligating the two units together. The gp350F1R1 was made via PCR using the primer sets GF1 (as above) and GR1: 5-CCATCGATGGCTAGCTAGCGGTGGATACAGTGGGGCCTGT-3 (SEQ ID NO:8). GR1 contained a linker sequence (Gly.sub.4Ser).sub.3 (SEQ ID NO:3) and sequences specific for the restriction enzymes Nhe I and Cla I. The PCR product was cloned into the pOptiVEC-TOPO vector, and was verified by sequencing. Gp350F2R5 contained sequences encoding the universal tetanus toxoid (TT)-specific CD4+ T cell epitopes P.sub.2 and P.sub.30 [30], a leucine zipper [27, 28] and a His6 tag (SEQ ID NO: 14), and was created by 3 rounds of PCR, adding the coding sequences sequentially. The first 2 rounds of PCR were done using the same forward primer designated GF: 5-ATGGAGGCAGCCTTGCTTGT-3 (SEQ ID NO:9) and reverse primers GR2: 5-TCAACCAAAAGCTAACGTAAAATTATTAAATTTTAGTTCAGTTATACCT ATAAATTTAGAATTGCTTTTATATACTGGGTGGATACAGTGGGGCCTGT-3 (SEQ ID NO:10) and GR3: 5-TTTGCTCAACAGCTCTTCCACTTTATCTTCCAGCTGTTTCATG CGTTCTAAATGACTAGCAGATACTTAGGAACCCTCAACCAAAAGCTAACOGTA A-3 (SEQ ID NO: 1), respectively. The last PCR was performed using the forward primer designated GF2: 5-CTAGCAGC GGT GGC GGA GGG AGT GGT GGC GGA GGG AGC GGT GC GGA GGG AGT ATGGAGGCAGCCTGCTTGT-3 (SEQ ID NO:12) and reverse primer GR5: 5-CCATCGATTCAATGGTGATGGTGATGATGGCTAGTGCGTTCGCCCACCAGC TTTTTCAGACGCGCCACTTCGTTTTCCAGATGATAGTTTTTGCTCAACAGCTCTTC C-3 (SEQ ID NO: 13). GF2 and GR5 contained the sequences for the restriction enzymes Nhe I and Cla I, respectively. The PCR product was cloned into the PCRII-TOPO vector (Invitrogen), and was verified by sequencing. The plasmids gp350F1R1 and gp350F2R5 were digested with Nhe I and Cla I, the fragments containing gp350 were gel-purified and ligated with T4 DNA ligase at 4? C. overnight, followed by transformation of Top 10 F E. coli (Invitrogen) with the ligation mixture. Two clones were selected for further study following verification by sequencing.
[0123] Gp350 Tetramer Construct without TT Epitope.
[0124] The plasmid was constructed using a similar approach as described above, but the sequences encoding P.sub.2 and P.sub.30 were deleted.
[0125] Transfection of Chinese Hamster Ovary (CHO) Cells (Clone DG44).
[0126] DG44 cells were maintained in CD DG44 medium (Invitrogen), and 2?10.sup.7 cells were used for transfection. 30 ?g of gp350 monomeric or tetrameric construct was re-suspended in 1.2 ml OptiPro SFM medium after linearization with PvuI, followed by adding 30 ?l of FreeStyle Max Reagent, mixed gently and incubated for 10 min at room temperature. The DNA-Freestyle Max Reagent complex was slowly added into the flask containing 2?10.sup.7 DG44 cells with gentle shaking. The cells were incubated at 37? C., 5% CO.sub.2 for 48 hours. Cells were centrifuged at 1,200 rpm and maintained in CD OptiCHO serum-free medium. Methotrexate (MTX, Sigma, St. Louis, Mo.) was used to select high recombinant protein-secreting cells, with the concentration of MTX gradually increased from 50 nM to 4 ?M.
[0127] CHO Culture in Hollow Fiber Bioreactors and Purification of Recombinant Gp350 Proteins.
[0128] After MTX selection, gp350 monomer- and tetramer-expressing CHO cells were loaded into Fibercell cartridges (C2008 [5 kD MW cut-off] and C2011 [20 kD MW cut-off], respectively, FiberCell Systems, Inc., Frederick, Md.), and concentrated supernatants were collected daily. Supernatants were further concentrated by centrifugation at 3,000 rpm for 30 min using a Centriprep Centrifugal Filter Unit, 30,000 MW cut-off (Thermo Scientific, Waltham, Mass.). Affinity purification was performed using a cobalt column (Thermo Scientific), according to manufacturer's instructions. Briefly, concentrated supernatants were mixed with an equal volume of equilibration buffer, and added to the cobalt purification column. The column was incubated with gentle agitation for 60 min at 4? C. and washed 3? with washing buffer. The gp350 recombinant proteins were eluted with elution buffer and analyzed by electrophoresis on 3-8% NuPAGE Tris-Acetate Mini Gels, under denaturing or native conditions, and stained with Simple Blue (Invitrogen). The gp350 proteins were also transferred onto nitrocellulose membranes and analyzed by Western Blot using anti-His antibody (Invitrogen). Gp350 proteins were further analyzed by immunoblotting with the g350-specific mAb, 72A1 [31], incubated overnight at 4? C. The nitrocellulose membranes were then incubated with HRP-labeled goat anti-mouse IgG, followed by development with chemiluminescent substrate (Thermo Scientific) for 10 min, and signal was detected on X-ray film. The 72A1 B cell hybridoma was a kind gift from Dr. Jonathan Hannan (University of Edinburgh, Edinburgh, UK). 72A1 mAb was purified on a protein G column from culture supernatant.
[0129] Mice.
[0130] Female BALB/c mice, purchased from the National Cancer Institute (Frederick, Md.) were used at 7-10 weeks of age for all protein immunizations. Female BALB/c mice purchased from Harlan Laboratories (Indianapolis, Ind.), were used at 4-6 weeks of age for all plasmid DNA vaccinations. These studies were conducted in accordance with the principles set forth in the Guide for Care and Use of Laboratory Animals (Institute of Laboratory Animal Resources, National Research Council, revised 1996), and were approved by the Uniformed Services University of the Health Sciences and the University of Washington Institutional Animal Care and Use Committees.
[0131] Antigens and Immunizations.
[0132] Purified pneumococcal capsular polysaccharide, type 14 (PPS14) was purchased from ATCC (Manassas, Va.). Gp350-PPS14 and TT-PPS14 conjugates were synthesized in a similar fashion, as previously described [32]. The molar ratios of gp350 and TT to PPS14 were about 8:1. Alum (Allhydrogel 2%) was obtained from Brenntag Biosector (Denmark). A stimulatory 30 mer CpG-containing oligodeoxynucleotide (CpG-ODN) was synthesized as previously described [33]. Mice were immunized i.p. with conjugates adsorbed on 13 ?g of alum mixed with 25 ?g of CpG-ODN. Monomeric and tetrameric Gp350 proteins were injected i.p. in alum+/?CpG-ODN. Serum samples for ELISA assay were obtained from blood taken from the tail vein.
[0133] Particle-Mediated Epidermal Delivery (PMED).
[0134] Mice were vaccinated by particle-mediated epidermal delivery (PMED) in the abdominal skin using the PowderJoct XR-1 DNA vaccine delivery system as previously described [34]. Each immunization consisted of two tandem deliveries of 0.5 mg 1-3 ?m-diameter gold particles coated with 1.0 ?g DNA vaccine for a total dose of 4.0 pig DNA, formulated as previously described [34]. DNA vaccines were administered by PMED at a helium pressure of 350 psi at zero and four weeks.
[0135] Measurement of Serum Titers of Antigen-Specific IgG and IgG Isotypes by ELISA.
[0136] Immulon 4 ELISA plates (Dynex Technologies, Inc., Chantilly, Va.) were coated (50 ?L/well) with monomeric gp350, TT, or PPSI4 (5 ?g/ml) in PBS overnight at 4? C. Plates were washed 3? with PBS+0.1% Tween 20 and were blocked with PBS+1% BSA for 1 h at 37? C. Threefold dilutions of serum samples, starting at a 1/50 serum dilution, in PBS+1% BSA were then added overnight at 4? C. and plates were washed 3? with PBS+0.1% Tween 20. Alkaline phosphatase-conjugated polyclonal goat anti-mouse IgG, lgC3, IgG1, IgG2b, or IgG2a Abs (SouthernBiotech, Birmingham, Ala.) (200 ng/ml final concentration) in PBS+1% BSA were then added, and plates were incubated at 37? C. for 1 h. Plates were washed 5? with PBS+0.1% Tween 20. Substrate (p-nitrophenyl phosphate, disodium; Sigma) at 1 mg/ml in TM buffer (1 M Tris+0.3 mM MgCl.sub.2, pH 9.8) was then added for color development. Color was read at an absorbance of 405 nm on a Multiskan Ascent ELISA reader (Labsystems, Finland).
[0137] Measurement of Serum Gp350-Specific Neutralizing Antibody.
[0138] Gp350 monomeric protein was labeled with Dylight 633 (Thermo Scientific). 25 ?l of mouse serum from na?ve or immunized mice, were incubated with 2.5 ?l of DyLight 633-labeled gp350 monomer, for a final concentration of monomer of 1 ?g/ml, for 30 min at room temperature. A pellet of 5?10.sup.5 CR2M1? cells was resuspended in the serum/gp350 monomer mixture for 30 min on ice, washed 3? with 0.5% BSA-PBS, and fixed in 4% para-formaldehyde. The CR2M a cell line was made by transfecting the K562 human erythroleukemia line with human CD21 [35]. To create a standard curve, varying concentrations of 72A1 mAb (final concentrations of 1-256 ?g/ml) were incubated with Dylight 633-labeled monomeric gp350 (final concentration of 1 ?g/ml) for 30 min at room temperature, followed by incubation with 5?10.sup.5 CR2M1? cells as described above. CR2M1? cells were then analyzed on a BD LSRII Flow Cytometer Cell Analyzer.
[0139] Detection of Intracellular IL-4 and IL-5 by Flow Cytometry.
[0140] Spleen cells were isolated from mice, 21 d following i.p. immunization with gp350 monomer or tetramer in alum, and cultured for 5 h in 6-well plates at 2?10.sup.6 cells/well in 1 ml of RPMI-1640+10% fetal calf serum, containing 10 U/ml rmlL-2 and 5 ?g/ml of P.sub.2 and P.sub.30 TT-specific peptides. Golgi Stop (BD Biosciences, San Jose, Calif.) was added 1 h after initiation of culture. Cells were then stained with FTTC-rat IgG2b anti-mouse CD4 (clone GK1.5) in the presence of rat IgG2b anti-mouse CDI6/CD32 (clone 2.402) for 30 min on ice. Cells were washed, fixed, and permeabilized using cytofix/cytoperm solution (BD Biosciences). Following washing 2? in perm/wash buffer, cells were incubated with APC-labeled rat IgG2b anti-mouse IL-4 (clone BVD4-ID11) or PE-labeled rat IgG1 anti-mouse IL-5 (clone TRFKS) for 30 min on ice, followed by washing twice in perm/wash buffer. Cells were analyzed on a BD LSRII Flow Cytometer Cell Analyzer, using FlowJo software.
[0141] Binding of Monomeric and Tetrameric Gp350 Proteins to Human CD21.
[0142] CR2M1? cells were incubated for 30 min on ice with gp350 monomer or tetramer (0.05-30 ?g/ml), washed 3? with 0.5% BSA-PBS and incubated further with mouse anti-gp350 mAb (2L10, Thermo Scientific) for 30 minutes. 2L10 mAb binds to a non-neutralizing epitope on gp350, distinct from the neutralizing epitope recognized by 72A1 [36, 37]. Cells were then washed 3? in 0.5% BSA-PBS, followed by incubation with DyLight 633-labeled goat anti-mouse IgG. Cells were fixed in 4% paraformaldehyde and analyzed on a BD LSRII Flow Cytometer Cell Analyzer.
[0143] Analysis of Human B Cell Activation.
[0144] Peripheral blood mononuclear cells (PBMC) were isolated by Ficoll-Hypaque (Roche, Indianapolis, Ind.) density gradient centrifugation from donor huffy coats (Blood Bank, National Institutes of Health, Bethesda, Md.) and washed twice in 1?PBS. B cells were purified from a starting population of 3?10.sup.8 PBMC by magnetic bead cell separation (B cell isolation kit II, Miltenyi Biotec, Auburn, Calif.), yielding >94% purified CD19+ B cells as assessed by flow cytometry. Sorted B cells were resuspended at 1?10.sup.6 cells/ml in complete RPMI 1640 medium (Lonza, Walkersville, Md.) containing 10% fetal calf serum (FCS, Lonza), 2 mM glutamine, and 100 U/ml each of penicillin and streptomycin (Invitrogen). B cells were aliquoted (0.5-1?10.sup.6 cells/well) in a 24 well plate and incubated for 24 or 72 h in a 37? C. incubator (5% CO.sub.2) with monomeric or tetrameric gp350 (10 g/ml), recombinant PspA (10 ?g/ml), goat anti-human IgM F(ab).sub.2 (Jackson ImmunoResearch, West Grove, Pa., 20 ?g/ml), or protein A from heat killed Staphylococcus aureus Cowan strain 1 (SAC, Sigma, St. Louis, Mo., 1:100 dilution)+recombinant human IL-2 (Peprotech, Rocky Hill, N.J., 200 IU/ml). Upregulation of cell surface activation markers was subsequently measured by staining cells with PE-conjugated anti-CD69 mAb (24 h post-stimulation) or PE-conjugated anti-CD25 mAb+FITC-conjugated anti-CD86 mAb (72 h post-stimulation). All antibodies were purchased from BD Biosciences. Cells (3?10.sup.5) were incubated with 5 ?l of each antibody in 100 ?l FACS buffer (1?PBS, 1% FCS, 0.1% sodium azide) for 30 min, washed in 2 ml FACS buffer, and collected on an LSR II flow cytometer (Becton Dickinson, Franklin Lakes, N.J.). Data analysis was performed using FlowJo software (TreeStar, Ashland, Oreg.).
[0145] Statistics.
[0146] Serum titers of antigen-specific Ig were expressed as the geometric means t SEM of the individual serum titers. Percentages of CD4+ T cells expressing cytoplasmic IL-4 or IL-5 were expressed as the arithmetic means+/?SEM of the individual samples. Significance was determined by the Student t test, p-values of ?0.05 were considered statistically significant.
Example 1: DNA Plasmid and Production of a Tetrameric gp350 Protein Containing 77-Specific CD4+ T Cell Epitopes
[0147] Optimal antibody responses to protein antigens require both dominant B and T cell epitopes. Although the EBV gp350 envelope protein is a potential target for an antibody-based prophylactic EBV vaccine, the relative strength and dominance of its T cell epitopes are unknown. Highly immunogenic carrier proteins, such as tetanus toxoid (TT), are utilized in polysaccharide conjugate vaccines to recruit CD4+ T cell help for the associated IgG anti-polysaccharide response. Initially, it was believed that adding TT to the EBV construct would help enhance and optimize the antibody response to the gp350 proteins. This initial belief was reinforced with early experiments comparing the relative ability of gp350 versus TT to promote an IgG response specific for pneumococcal polysaccharide, serotype 14 (PPS14), and thus indirectly to recruit CD4+ T cell help. Mice were immunized i.p. with either 1 or 5 ?g of gp350-PPS14 or TT-PPS14 in alum+CpG-ODN as adjuvant and similarly boosted on day 14. Serum titers of PPSI4-specific IgG, measured on day 21, were significantly higher using TT-PPS14 relative to gp350-PPS14 using either 1 or 5 ?g of conjugate (
[0148] Multimerization of proteins can confer increased immunogenicity [21, 22, 25, 38, 39]. Therefore, a DNA construct that would direct the production of a tetrameric g350 was designed. EBV neutralizing antibody, required for a successful prophylactic vaccine, is specific for the conformational epitope of gp350 that mediates binding to CD21 on human B cells, mediating EBV entry. Thus, proper folding of the individual gp350 molecules in the tetramer was considered important. Given the known properties of TT as a potent inducer of CD4 T helper cells and the data illustrated in
[0149] To produce protein, Chinese hamster ovary (CHO) cells were stably transfected with either tetrameric or monomeric gp350 DNA, and high-producing CHO cells were selected using increasing concentrations of methotrexate in the culture medium. Protein was purified from culture supernatant and detected by SDS-PAGE (denaturing) and PAGE (native) using the gp350-specific 72A1 mAb that recognizes the CD21-binding, conformational epitope [31] (
Example 2: Tetrameric gp350 is Markedly More Immunogenic than Monomeric Gp350 Protein, Even in the Presence of a Strong Adjuvant and Following DNA Vaccination
[0150] The relative ability of tetrameric versus monomeric gp350 to induce a gp350-specific IgG response was determined. Mice were injected i.p. with 25, 1.0, or 0.2 ?g of tetrameric or monomeric gp350 per mouse in the presence of alum adjuvant and boosted in a similar fashion on day 21. Serum titers of gp350-specific IgG were measured by ELISA on the indicated days (
[0151] Next the effects of an adjuvant more potent than alum were tested to determine whether the differences observed between the immunogenicity of tetrameric and monomeric gp350 would still be manifest in the presence of the more potent adjuvant. Mice were immunized i.p. with 25 or 1.0 ?g of tetrameric or monomeric gp350 per mouse in the presence of alum and 25 ?g of a stimulatory 30-mer CpG-containing oligodeoxynuclcotide (CpG-ODN), a ligand for Toll-like receptor (TLR)9 [40]. Addition of CpG-ODN to alum resulted in a 21-fold enhancement in the secondary serum gp350-specific IgG titers in response to 25 ?g of tetrameric gp350 relative to that observed using only alum as adjuvant (
[0152] Vaccination with plasmid DNA may confer a number of advantages over protein immunization [41], including the ability to elicit both humoral and cell-mediated immunity in a safe and cost-effective manner. Thus, the level of induction of gp350-specific IgG following primary immunization, and boost at 4 weeks, of equal amounts of DNA encoding monomer versus tetramer was compared. DNA was introduced into the epidermis on microscopic gold particles (i.e. particle-mediated epidermal delivery [PMED]) [42, 43]. Primary immunization with either plasmid induced minimal serum titers of gp350-specific IgG by 4 weeks (
Example 3: The Enhanced gp350-Specific IgG Response Requires Both Priming and Boosting with the Tetrameric Form of gp350
[0153] The stimulatory requirements for elicitation of a T cell-dependent secondary response are typically less stringent than that for induction of a primary [44, 45]. The substantially higher secondary gp350-specific IgG responses observed following priming and boosting with tetrameric gp350 relative to monomer, could have been caused by the tetrameric gp350 during the primary and/or secondary immunization. To determine this, four groups of mice were established in which various combinations of priming and boosting with tetrameric and monomer gp350 were performed, using alum as adjuvant. As illustrated in
Example 4: Immunization with Tetrameric Gp350 Protein Induces Markedly Higher Levels of Neutralizing Gp350-Specific Ig Relative to Monomer
[0154] Binding of EBV gp350 to CD21 is necessary for viral entry into the B cell [5, 6], an event that is critical for infectivity and B cell neoplastic transformation [2]. Thus, elicitation of antibody that blocks this interaction (i.e. neutralizing antibody) [7] may serve as the basis for an effective prophylactic EBV vaccine [17, 18]. In this regard, a gp350-specific mAb was previously produced (clone 72A1), that can specifically block gp350 binding to human CD21 [31]. To measure the amount of neutralizing antibody in sera from gp350-immunized mice, an erythroleukemia cell line transfected with human CD21 (CR2M1?) was used. Initially, monomeric gp350 was directly labeled with the fluorochrome DyLight 633 and mixed with varying amounts of 72A1 mAb prior to incubation with CR2M1? cells. A standard neutralization curve was generated that related the amount of 72A1 mAb added with a fixed amount of gp350-DyLight 633, and the subsequent mean fluorescence intensity (MFI) of staining of CR2M1? cells. Monomeric gp350-DyLight 633 was then mixed with undiluted pre-immune sera or sera from mice following priming and boosting with 25 ?g of tetrameric or monomeric gp350 and subsequently incubated with CR2M1? cells. As illustrated in FIG. 5, pre-immune sera contained <4.0 ?g/ml of 72A1 mAb-equivalents of neutralizing activity. Whereas, monomeric gp350 induced 13 ?g/ml of neutralizing activity, tetramer induced 253 ?g/ml, a 19-fold greater level of activity than monomer. Of interest the difference in neutralizing activity between sera obtained from monomer-versus tetramer-immunized mice closely mirrored the difference observed for total (neutralizing and non-neutralizing) serum titers of gp350-specific IgG (see
Example 5. Priming with TT Protein can Inhibit the Gp350-Specific IgG Response to Tetrameric, but not Monomeric Gp350
[0155] Two universal TT-specific TT epitopes were introduced into the tetrameric gp350 vaccine with the expectation that this would contribute to the enhancement of the gp350-specific IgG response relative to monomeric gp350. In this regard, children typically receive TT as a vaccine for protection against Clostridium tetani, and thus are likely to have TT-primed CD4+ T cells. It has been demonstrated that pre-immunization of mice with TT suppressed a subsequent antibody response to synthetic peptides conjugated to TT [46] and that this was due to clonal dominance [47] and required CD4+ T cells for its induction [48]. Thus, it was first determined whether tetrameric gp350 primed TT-specific CD4+ T cells in vivo, and if initial priming of mice with whole TT protein would impact on the subsequent gp350-specific IgG response to tetramer. Mice were immunized with 25 ?g of tetrameric or monomeric gp350 in alum. On day 21 spleen cells were isolated and cultured with the P.sub.2 and P.sub.30 TT peptides, followed by flow cytometric analysis of gated CD4+ T cells for intracytoplasmic expression of IL-4 and IL-5. CD4+ T cells from mice primed with tetrameric gp350, but not monomer-primed or na?ve mice, exhibited a significant increase in CD4+ T cells expressing cytoplasmic IL-4 and IL-5 following elicitation with TT peptide in vitro, but not in the presence of medium alone (
Example 6: The TT-Specific T Cell Epitopes in Tetrameric Gp350 do not Contribute to the Gp350-Specific IgG Response in Na?ve Mice
[0156] To determine the extent, if any, to which the TT epitopes contributed to the more potent immunogenicity of tetrameric versus monomeric gp350 in na?ve mice, a new DNA plasmid was constructed in which the TT-specific T cell epitopes were deleted in the DNA encoding tetrameric TT (referred to as tetramer.sup.?tt). The new plasmid was validated by sequencing, and immunoelectrophoresis of CHO cell-expressed protein using 72A1 mAb. A new set of mice were immunized with 25 or 1.0 ?g of monomer, tetramer, or tetramer.sup.?tt in alum and boosted in a similar fashion on day 21. As illustrated in
Example 7: Tetrameric Gp350 Binds More Avidly to Human CD21 than Monomer
[0157] The capacity of B cells to bind cognate antigen via their B cell receptor (BCR) and present the resulting peptide/MHC-II to CD4+ T cells is a critical event in the evolution of a T cell-dependent humoral immune response. In this regard, multimerization of antigen may boost immunogenicity, at least in part, by promoting more avid BCR binding to specific B cells. Gp350 is a ligand for human, although not mouse, CD21. Thus, human CD21, expressed by the CR2M1?, was used as a surrogate for BCR binding to gp350, to compare the efficiency of binding of tetrameric versus monomeric gp350. To accomplish this, CR2M1? cells were incubated with increasing concentrations of unlabeled monomer or tetramer (0.05-30 ?g/ml), followed by unlabeled 2L10 mAb (mouse IgG anti-gp350). This mAb binds to gp350 at a site distinct from the CD21-binding site, and hence is not blocked upon gp350/CD21 binding. This was followed by staining with DyLight 633-labeled goat anti-mouse IgG and analysis by flow cytometry. Incubation of CR2M1? cells with increasing concentrations of monomeric and tetrameric gp350 resulted in a dose-dependent progressive increase in MFI staining in both cases (
Example 8: Neither Monomeric Nor Tetrameric Gp350 Polyclonally Activates Human B Cells
[0158] Purified, recombinant gp350 has been shown to upregulate IL-6 mRNA synthesis in human B cells in a CD21-dependent manner [49]. This suggests that tetrameric gp350, which is predicted to induce CD21 crosslinking on human B cells, could potentially act as a polyclonal B cell activator, with possible unwanted side-effects when used as a vaccine. To determine this, purified peripheral blood human B cells were incubated with 10 ?g/ml of monomeric or tetrameric gp350, or a negative control protein (pneumococcal surface protein A [PspA]). As positive controls we used anti-IgM antibody or SAC+IL-2 for B cell activation. As illustrated in
Example 9: Tetrameric Gp350 Immunization in a Permissive Rabbit Model
[0159] The rabbit, in contrast to the mouse, is a permissive model for EBV infection, and thus ideal for pre-clinical testing of an EBV vaccine [67]. This likely reflects, in part, our own observation that rabbit B cells, in contrast to mouse B cells, bind gp350, most likely by binding to B cell CD21. Thus, flow cytometric analysis using Dylight-labeled gp350 and FITC-anti-rabbit IgM mAb to stain B cells was conducted to determine whether gp350 binds to rabbit B cells. Both peripheral blood and splenic B cells, isolated from New Zealand white rabbits, showed strong double staining. No staining was observed using a negative control, Dylight-labeled pneumococcal surface protein A (PspA) (data not shown).
[0160] Next a series of dose response immunization studies of tetrameric versus monomeric gp350 were performed to determine the relative immunogenicity of monomeric gp350 and tetrameric gp350 in rabbits. Rabbits (4 per group) were immunized s.c. with 5.0, 1.0, or 0.2 jtg of monomeric or tetrameric gp350 in alum and boosted in a similar fashion on day 14. Sera were collected at day 0, 14, and 28 for measurement of gp350-specific IgG titers by ELISA (
Example 10: Construction of Other EBV Multimeric Constructs
[0161] EBV infection and persistence is critically dependent upon viral entry into B cells and nasopharyngeal epithelial cells. B cell infection involves initial binding of EBV gp350 to B cell CD21 followed by binding of EBV gp42 to B cell MHC class II molecules. This results in viral fusion and entry mediated by EBV gH/gL heterodimer and gB. Epithelial cell infection by EBV also involves gH/gL and gB, but not gp350 or gp42. The multimerization technique described in this application has been used to produce an EBV gH/gL heterodimer with a trimerization domain. The multimerization techniques can be similarly used to produce multimeric gB or gp42 constructs.
[0162] Discussion:
[0163] In this study, a tetramer of the EBV envelope protein gp350 was created by constructing a plasmid in which two copies of a truncated gp350, containing the CD21-binding neutralization epitope, were separated by a linker, to allow for conformational folding. This dimeric gp350 underwent further dimerization to form a tetramer following translation within transfected CHO cells, via homotypic binding of 3 leucine zipper motifs. This protein multimerization strategy resulted in a marked enhancement in elicitation of gp350-specific IgG, including neutralizing antibody, relative to monomeric gp350. Enhanced immunogenicity of tetrameric versus monomeric gp350 was observed following direct immunization with plasmid, or with protein in the presence of even a strong adjuvant such as alum+CpG-ODN. Tetrameric gp350 bound much more efficiently to human CD21 but did not polyclonally activate human B cells. Furthermore, when the immunogenicity of the multimeric construct was tested in the permissive rabbit model, the difference in serum titers of gp350-specific IgG between tetramer and monomer in the rabbit were up to 100-fold, compared to the 20-fold differences observed in the mouse. Thus, these data support the value of testing tetrameric gp350 in clinical trials for its potential to elicit more protective immunity against such EBV-mediated diseases as infectious mononucleosis, and perhaps neoplastic transformation, as opposed to monomeric gp350 used in previous, small-scale human studies [16-19]. These data also support the use of this multimerization strategy to enhance humoral immune responses to other proteins of vaccine interest, in a reproducible and cost-effective manner.
[0164] Multimerization of proteins/peptides has been shown to enhance their immunogenicity. Thus, a plasmid encoding green fluorescent protein (GFP) fused to a long poly-glutamine tail that mediates aggregation, induced significantly higher serum GFP-specific Ig titers and enhanced GFP-specific CD8+CTL activity following prime/boost immunization in mice, relative to non-aggregating GFP [21]. Multimerization of bovine serum albumin (BSA) by covalent attachment of BSA or haptenated BSA to dextran at a ratio of 20-30 BSA/2?10.sup.6 MW dextran resulted in strong enhancements in elicited murine serum titers of BSA- or hapten-specific IgG1, respectively, relative to unconjugated protein [25]. Rabbits immunized with glutathione S-transferease (GST) fusion proteins with increasing copy number of a peptide epitope (M2e) of the influenza virus M2 protein elicited M2e-specific IgG in response to GST-(M2e).sub.8 with an average affinity constant (K.sub.A) of up to two orders of magnitude greater than that induced by GST-(M2c).sub.t[20]. Covalent attachment of increasing copy number of peptides onto virus-like particles (VLPs) resulted in a positive correlation between epitope density and the magnitude of the peptide-specific murine IgG, although not IgM, response following immunization [23]. Higher epitope densities also allowed for efficient IgG responses in the absence of complement receptor type 2 (CD21). An unwanted consequence of protein multimerization has been observed with the use of therapeutic proteins such as human growth hormone, intravenous immune globulin (IVIG), human serum albumin, human interleukin-2, and human interferon-0 in which aggregated proteins within the preparation preferentially induced immune responses, including neutralizing antibody that decreased therapeutic efficacy [22, 24]. Finally, alum, a commonly used adjuvant in clinical vaccines, itself forms aggregates that trap antigen at the site of injection [51]. Of note, in this study, tetrameric gp350 in alum with or without additional adjuvanting with CpG-ODN was nevertheless markedly more immunogenic than monomeric gp350 delivered in the same adjuvants. Although direct evidence in vivo is limited, and without intending to be bound by any theory, the increased immunogenicity of multimeric proteins likely arises from more efficient activation of complement, enhanced binding to the BCR, more efficient BCR-mediated signaling, enhanced B cell uptake and presentation of protein-derived peptide to CD4+ T cells and/or enhanced trapping of multimeric proteins on the surface of follicular dendritic cells [24, 52].
[0165] The presence of strong CD4+ T cell, in addition to B cell, epitopes is important for robust T cell-dependent (TD) IgG responses to protein antigens. In this regard, TT was shown to be a significantly more potent carrier protein than gp350 for eliciting a TD IgG response specific for a pneumococcal polysaccharide, as part of a conjugate vaccine. This strongly suggested that TT contained more potent CD4+ T cell epitopes than gp350 for delivery of helper function to B cells. Accordingly, the initial gp350 tetramer design incorporated two known universal TT-specific CD4+ T cell epitopes. However, the data in this study unexpectedly show that not only did the TT epitopes not contribute to the immunogenicity of the tetramer in na?ve mice, but they actually mediated inhibition of antibody responses in TT-primed mice. This latter observation was relevant in light of the widespread use of TT as a clinical vaccine. In this regard, it has been demonstrated that pre-immunization of mice with TT suppressed a subsequent antibody response to synthetic peptides conjugated to TT [46] and that this was due to clonal dominance [47] and required CD4+ T cells for its induction [48]. However, it is possible that inclusion of other universal human CD4+ T cell epitopes such as N19 [53, 54] or PADRE [55, 56] might prove more successful.
[0166] EBV gp350 binds to human (and rabbit), but not mouse, CD21 [57]. Physiologically, CD21 expressed on B cells and follicular dendritic cells (FDC) binds the complement fragment C3d that in association with antigen, promotes immunogenicity [26, 58, 59]. This likely occurs via co-crosslinking of BCR and CD21, leading to highly synergistic B cell signaling [60], and trapping of antigen via CD21 on FDC to promote germinal center formation [61]. A previous study further demonstrated that gp350 could potentially substitute for C3d as an adjuvant, by promoting human B cell signaling via BCR/CD21 co-crosslinking [62]. Enhancement of antigen-specific antibody responses via C3d, involves at least 2 copies of C3d per molecule of antigen. Thus, in humans, gp350-specific B cells binding to tetrameric but not monomeric, gp350 via a single BCR would potentially have access to 2-3 gp350 molecules for CD21 binding, that could facilitate specific BCR/CD21 co-crosslinking and synergistic B cell signaling. In light of this data demonstrating a marked increase in the efficiency of binding of tetramer versus monomer to human CD21, we predict that tetrameric gp350 will also bind to specific BCR, as well CD21-expressing human FDC with greater avidity than monomeric gp350. Collectively, these observations strongly suggest that gp350, expressed as a tetramer, will act as both a molecular adjuvant as well as a specific target antigen for a clinical EBV vaccine. Importantly, tetrameric gp350 by itself did not polyclonally activate human B cells, thus obviating concerns for unwanted non-specific immune stimulation in vivo.
[0167] The molecular strategy described herein for creating tetrameric gp350 could also be applied to boost humoral immune responses to other proteins of vaccine interest, including other EBV proteins, such as gH/gL, gp42, and gB. Further, gp350 might be of value as a molecular adjuvant for another target protein, through creation of a heterodimer linked to a leucine zipper for dimerization, or a trimerization motif such as the T4 bacteriophage fibritin (FT) [63] or the eukaryotic GCN4 transcription factor motif (GCN4) [64]. Finally, heterodimers comprising a target protein and an additional protein possessing adjuvant activity, such as flagellin [65], or for example to an scFv fragment that targets an antigen-presenting cell or innate receptor [66], may generate additional, highly immunogenic multimeric proteins for vaccination.
REFERENCES
[0168] The following references are cited in the application and provide general information on the field of the invention and provide assays and other details discussed in the application. The following references are incorporated herein by reference in their entirety. [0169] [1] Cohen J I. The biology of Epstein-Barr virus: lessons learned from the virus and the host. Current opinion in immunology 1999 August; 11(4):365-70. [0170] [2] Thorley-Lawson D A. EBV the prototypical human tumor virusjust how bad is it? J Allergy Clin Immunol 2005 August; 116(2):251-61; quiz 62. [0171] [3] Vetsika E K, Callan M. Infectious mononucleosis and Epstein-Barr virus. Expert Rev Mol Med 2004 Nov. 5; 6(23):1-16. [0172] [4] Babcock G J, Decker L L, Volk M, Thorley-Lawson D A. EBV persistence in memory B cells in vivo. Immunity 1998 September; 9(3):395-404. [0173] [5] Tanner J, Weis J, Fearon D, Whang Y, Kieff E. Epstein-Barr virus gp350/220 binding to the B lymphocyte C3d receptor mediates adsorption, capping, and endocytosis. Cell 1987 Jul. 17; 50(2):203-13. [0174] [6] Tanner J, Whang Y, Sample J, Sears A, Kieff E. Soluble gp350/220 and deletion mutant glycoproteins block Epstein-Barr virus adsorption to lymphocytes. Journal of virology 1988; 62(12):4452-64. [0175] [7] Thorley-Lawson D A, Poodry C A. Identification and isolation of the main component (gp350-gp220) of Epstein-Barr virus responsible for generating neutralizing antibodies in vivo. Journal of virology 1982 August; 43(2):730-6. [0176] [8] Morgan A J, Epstein M A, North J R. Comparative immunogenicity studies on Epstein-Barr virus membrane antigen (MA) gp340 with novel adjuvants in mice, rabbits, and cottontop tamarins. J Med Virol 1984; 13(3):281-92. [0177] [9] Morgan A J, Allison A C, Finerty S, Scullion F T, Byars N E, Epstein M A. Validation of a first-generation Epstein-Barr virus vaccine preparation suitable for human use. J Med Virol 1989 September; 29(1):74-8. [0178] [10] Finerty S, Tarlton J, Mackett M, Conway M, Arrand J R, Watkins P E, et al. Protective immunization against Epstein-Barr virus-induced disease in cottontop tamarins using the virus envelope glycoprotein gp340 produced from a bovine papillomavirus expression vector. J Gen Virol 1992 February; 73 (Pt 2):449-53. [0179] [11] Finerty S, Mackett M, Arrand J R, Watkins P E, Tarlton 3, Morgan A J. Immunization of cottontop tamarins and rabbits with a candidate vaccine against the Epstein-Barr virus based on the major viral envelope glycoprotein gp340 and alum. Vaccine 1994 October; 12(13): 1180-4. [0180] [12] Cox C, Naylor B A, Mackett M, Arrand J R, Griffin B E, Wedderburn N. Immunization of common marmosets with Epstein-Barr virus (EBV) envelope glycoprotein gp340: effect on viral shedding following EBV challenge. J Med Virol 1998 August; 55(4):255-61. [0181] [13] Mackett M, Cox C, Pepper S D, Lees J F, Naylor B A, Wedderburn N, et al. Immunisation of common marmosets with vaccinia virus expressing Epstein-Barr virus (EBV) gp340 and challenge with EBV. J Med Virol 1996 November; 50(3):263-71. [0182] [14] Ragot T, Finerty S, Watkins P E, Perricaudet M, Morgan A J. Replication-defective recombinant adenovirus expressing the Epstein-Barr virus (EBV) envelope glycoprotein gp340/220 induces protective immunity against EBV-induced lymphomas in the cottontop tamarin. J Gen Virol 1993 March; 74 (Pt 3):501-7. [0183] [15] Morgan A J, Mackett M, Finerty S, Arrand J R, Scullion F T, Epstein M A. Recombinant vaccinia virus expressing Epstein-Barr virus glycoprotein gp340 protects cottontop tamarins against EB virus-induced malignant lymphomas. J Med Virol 1988 June; 25(2):189-95. [0184] [16] Go S Y, Huang T M, Ruan L, Miao Y H, Lu H, Chu C M, et al. First EBV vaccine trial in humans using recombinant vaccinia virus expressing the major membrane antigen. Dcv Biol Stand 1995; 84:171-7. [0185] [17] Sokal E M, Hoppenbrouwers K, Vandermeulen C, Moutscbhen M, Leonard P, Moreels A, et al. Recombinant gp350 vaccine for infectious mononucleosis: a phase 2, randomized, double-blind, placebo-controlled trial to evaluate the safety, immunogenicity, and efficacy of an Epstein-Barr virus vaccine in healthy young adults. The Journal of infectious diseases 2007 Dec. 15; 196(12):1749-53. [0186] [18] Moutschen M, Leonard P, Sokal E M, Smets F, Haumont M, Mazzu P, et al. Phase/II studies to evaluate safety and immunogenicity of a recombinant gp350 Epstein-Barr virus vaccine in healthy adults. Vaccine 2007 Jun. 11; 25(24):4697-705. [0187] [19] Rees L, Tizard E J, Morgan A J, Cubitt W D, Finerty S, Oyewole-Eletu T A, et al. A phase I trial of epstein-barr virus gp350 vaccine for children with chronic kidney disease awaiting transplantation. Transplantation 2009 Oct. 27; 88(8):1025-9. [0188] [20] Liu W, Chen Y H. High epitope density in a single protein molecule significantly enhances antigenicity as well as immunogenicity: a novel strategy for modern vaccine development and a preliminary investigation about B cell discrimination of monomeric proteins. European journal of immunology 2005 February; 35(2):505-14. [0189] [21] Ilyinskii P O, Thoidis G, Sherman M Y, Shneider A. Adjuvant potential of aggregate-forming polyglutamine domains. Vaccine 2008 Jun. 19; 26(26):3223-6. [0190] [22] van Beers M M, Jiskoot W, Schellekens H. On the role of aggregates in the immunogenicity of recombinant human interferon beta in patients with multiple sclerosis. J Interferon Cytokine Res 2010 October; 30(10):767-75. [0191] [23] Jegerlehner A, Stomi T, Lipowsky G, Schmid M, Pumpens P, Bachmann M F. Regulation of igG antibody responses by epitope density and CD21-mediated costimulation. European journal of immunology 2002 November; 32(11):3305-14. [0192] [24] Rosenberg A S. Effects of protein aggregates: an immunologic perspective. AAPS J 2006; 8(3):E501-7. [0193] [25] Lees A, Finkelman F, Inman J K, Witherspoon K, Johnson P, Kennedy J, et al. Enhanced immunogenicity of protein-dextran conjugates: I. Rapid stimulation of enhanced antibody responses to poorly immunogenic molecules. Vaccine 1994 October; 12(13): 1160-6. [0194] [26] Dempsey P W, Allison M E, Akkaraju S, Goodnow C C, Fearon D T. C3d of complement as a molecular adjuvant: bridging innate and acquired immunity. Science 1996 Jan. 19; 271(5247):348-50. [0195] [27] Czerwinski M, Siegel D L, Moore J S, Spitalnik P F, Spitalnik S L. Construction of bacteriophage expressing mouse monoclonal Fab fragments directed against the human MN glycophorin blood group antigens. Transfusion 1995 February; 35(2): 137-44. [0196] [28] O'Shea E K, Rutkowski R, Kim P S. Evidence that the leucine zipper is a coiled coil. Science 1989 Jan. 27; 243(4890):538-42. [0197] [29] Sarrias M R, Franchini S, Canziani G, Argyropoulos E, Moore W T, Sahu A, et al. Kinetic analysis of the interactions of complement receptor 2 (CR2, CD21) with its ligands C3d, iC3b, and the EBV glycoprotein gp350/220. J Immunol 2001 August; 167(3):1490-9. [0198] [30] Valmori D, Pessi A, Bianchi E, Corradin G. Use of human universally antigenic tetanus toxin T cell epitopes as carriers for human vaccination. J Immunol 1992 Jul. 15; 149(2):717-21. [0199] [31] Hoffman G J, Lazarowitz S G, Hayward S D. Monoclonal antibody against a 250,000-dalton glycoprotein of Epstein-Barr virus identifies a membrane antigen and a neutralizing antigen. Proceedings of the National Academy of Sciences of the United States of America 1980 May; 77(S):2979-83. [0200] [32] Khan A Q, Lees A, Snapper C M. Differential regulation of IgG anti-capsular polysaccharide and antiprotein responses to intact Streptococcus pneumoniae in the presence of cognate CD4+ T cell help. J Immunol 2004 Jan. 1; 172(1):532-9. [0201] [33] Sen G, Flora M, Chattopadhyay G, Klinman D M, Lees A, Mond J J, et al. The critical DNA flanking sequences of a CpG oligodeoxynucleotide, but not the 6 base CpG motif, can be replaced with RNA without quantitative or qualitative changes in Toll-like receptor 9-mediated activity. Cell Immunol 2004 November-December; 232(1-2):64-74. [0202] [34] Pertmer T M, Eisenbraun M D, McCabe D, Prayaga S K, Fuller D H, Haynes J R. Gene gun-based nucleic acid immunization: elicitation of humoral and cytotoxic T lymphocyte responses following epidermal delivery of nanogram quantities of DNA. Vaccine 1995; 13(15):1427-30. [0203] [35] Carel J C, Frazier B, Ley T J, Holers V M. Analysis of epitope expression and the functional repertoire of recombinant complement receptor 2 (CR2/CD21) in mouse and human cells. J Immunol 1989 Aug. 1; 143(3):923-30. [0204] [36] Nemerow G R, Houghten R A, Moore M D, Cooper N R. Identification of an epitope in the major envelope protein of Epstein-Barr virus that mediates viral binding to the B lymphocyte EBV receptor (CR2). Cell 1989 Feb. 10; 56(3):369-77. [0205] [37] Nemerow G R, Cooper N R. Early events in the infection of human B lymphocytes by Epstein-Barr virus: the internalization process. Virology 1984 Jan. 15; 132(1):186-98. [0206] [38] Zaborsky N, Brunner M, Wallner M, Himly M, Karl T, Schwarzenbacher R, et al. Antigen aggregation decides the fate of the allergic immune response. J Immunol 2010 Jan. 15; 184(2):725-35. [0207] [39] Fradkin A H, Carpenter J F, Randolph T W. Immunogenicity of aggregates of recombinant human growth hormone in mouse models. J Pharm Sci 2009 September; 98(9):3247-64. [0208] [40] Hemmi H, Takeuchi O, Kawai T, Kaisho T, Sato S, Sanjo H, et al. A Toll-like receptor recognizes bacterial DNA. Nature 2000; 408(6813):740-5. [0209] [41] Ferraro B, Morrow M P, Hutnick N A, Shin T H, Lucke C E, Weiner D B. Clinical applications of DNA vaccines: current progress. Clinical infectious diseases: an official publication of the Infectious Diseases Society of America 2011 Aug. 1; 53(3):296-302. [0210] [42] Yager E J, Dean H J, Fuller D H. Prospects for developing an effective particle-mediated DNA vaccine against influenza. Expert review of vaccines 2009 September; 8(9):1205-20. [0211] [43] Roy M J, Wu M S, Barr L J, Fuller J T, Tussey L G, Speller S, et al. Induction of antigen-specific CD8+ T cells, T helper cells, and protective levels of antibody in humans by particle-mediated administration of a hepatitis B virus DNA vaccine. Vaccine 2000 Nov. 22; 19(7-8):764-78. [0212] [44] Luqman M, Bottomly K. Activation requirements for CD4+ T cells differing in CD45R expression. J Immunol 1992 Oct. 1; 149(7):2300-6. [0213] [45] Ronchese F, Hausmann B. B lymphocytes in vivo fail to prime na?ve T cells but can stimulate antigen-experienced T lymphocytes. The Journal of experimental medicine 1993 Mar. 1; 177(3):679-90. [0214] [46] Schutze M P, Leclerc C, Jolivet M, Audibert F, Chedid L. Carrier-induced epitopic suppression, a major issue for future synthetic vaccines. J Immunol 1985 October; 135(4):2319-22. [0215] [47] Schutze M P, Deriaud E, Przewlocki G, LeClere C. Carrier-induced opitopic suppression is initiated through clonal dominance. J Immunol 1989 Apr. 15; 142(8):2635-40. [0216] [48] Leclerc C, Schutze M P, Deriaud E, Przewlocki G. The in vivo elimination of CD4+ T cells prevents the induction but not the expression of carrier-induced epitopic suppression. J Immunol 1990 Sen 1:145(5: 1343-9. [0217] [49] D'Addario M, Libermann T A, Xu J, Ahmad A, Menezes J. Epstein-Barr Virus and its glycoprotein-350 upregulate IL-6 in human B-lymphocytes via CD21, involving activation of NF-kappaB and different signaling pathways. Journal of molecular biology 2001; 308(3):501-14. [0218] [50] Bohnsack J F, Cooper N R. CR2 ligands modulate human B cell activation. J Immunol 1988 Oct. 15; 141(8):2569-76. [0219] [51] Shirodkar S, Hutchinson R L, Perry D L, White J L, Hem S L. Aluminum compounds used as adjuvants in vaccines. Pharmaceutical research 1990 December; 7(12):1282-8. [0220] [52] Bachmann M F, Jennings G T. Vaccine delivery: a matter of size, geometry, kinetics and molecular patterns. Nature reviews Immunology 2010 November; 10(11):787-96. [0221] [53] Baraldo K, Mori E, Bartoloni A, Norelli F, Grandi G, Rappuoli R, et al. Combined conjugate vaccines: enhanced immunogenicity with the N19 polyepitope as a carrier protein. Infection and immunity 2005 September; 73(9):5835-41. [0222] [54] Falugi F, Petracca R, Mariani M, Luzzi E, Mancianti S, Carinci V, et al. Rationally designed strings of promiscuous CD4(+) T cell epitopes provide help to Haemophilus influenzae type b oligosaccharide: a model for new conjugate vaccines. European journal of immunology 2001 December; 31(12):3816-24. [0223] [55] del Guercio M F, Alexander J., Kubo R T, Arrhenius T, Maewal A, Appella E, et al. Potent immunogenic short linear peptide constructs composed of B cell epitopes and Pan D R T helper epitopes (PADRE) for antibody responses in vivo. Vaccine 1997 March; 15(4):441-8. [0224] [56] Alexander J, del Guercio M F, Maewal A, Qiao L, Fikes J, Chesnut R W, et al. Linear PADRE T helper epitope and carbohydrate B cell epitope conjugates induce specific high titer IgG antibody responses. J Immunol 2000 Feb. 1; 164(3):1625-33. [0225] [57] Martin D R, Yuryev A, Kalli K R, Fearon D T, Ahearn J M. Determination of the structural basis for selective binding of Epstein-Barr virus to human complement receptor type 2. The Journal of experimental medicine 1991 Dec. 1; 174(6):1299-311. [0226] [58] Test S T, Mitsuyoshi J, Connolly C C, Lucas A H. Increased immunogenicity and induction of class switching by conjugation of complement C3d to pneumococcal serotype 14 capsular polysaccharide. Infection and immunity 2001 May; 69(5):3031-40. [0227] [59] Ross T M, Xu Y, Bright R A, Robinson H L. C3d enhancement of antibodies to bemagglutinin accelerates protection against influenza virus challenge. Nature immunology 2000 August; 1(2):127-31. [0228] [60] Fearon D T, Carter R H. The CDI9/CR2/TAPA-1 complex of B lymphocytes: linking natural to acquired immunity. Annual review of immunology 1995; 13:127-49. [0229] [61] Allen C D, Cyster J G. Follicular dendritic cell networks of primary follicles and germinal centers: phenotype and function. Semin Immunol 2008 February; 20(1):14-25. [0230] [62] Goeckeritz B E, Lees A, Vos Q. Tsokos G C, Kuhlbusch K, Mond J J. Enhanced and sustained activation of human B cells by anti-immunoglobulin conjugated to the EBV glycoprotein gp350. European journal of immunology 2000; 30(3):969-73. [0231] [63] Bower J F, Yang X, Sodroski J, Ross T M. Elicitation of neutralizing antibodies with DNA vaccines expressing soluble stabilized human immunodeficiency virus type 1 envelope glycoprotein trimers conjugated to C3d. Journal of virology 2004 May; 78(9):4710-9. [0232] [64] Zhang P F, Cham F, Dong M, Choudhary A, Bouma P, Zhang 7, et al. Extensively cross-reactive anti-HIV-1 neutralizing antibodies induced by gp140 immunization. Proceedings of the National Academy of Sciences of the United States of America 2007 Jun. 12; 104(24): 10193-8. [0233] [65] McSorley S J, Ehst B D, Yu Y, Gewirtz A T. Bacterial flagellin is an effective adjuvant for CD4(+) T cells in vivo. J Immunol 2002 Oct. 1; 169(7):3914-9. [0234] [66] Tunheim G, Thompson K M, Fredriksen A B, Espevik T, Schjetne K W, Bogen B. Human receptors of innate immunity (CDI4, TLR2) are promising targets for novel recombinant immunoglobulin-based vaccine candidates. Vaccine 2007 Jun. 11; 25(24):4723-34. [0235] [67] Okuno K, et al., Epstein-Barr virus can infect rabbits by the intranasal or peroral route: an animal model for natural primary EBV infection in humans. J. Med. Virol. 2010 82: 977.