HUNTER SYNDROME THERAPEUTIC AGENT AND TREATMENT METHOD
20180303914 ยท 2018-10-25
Assignee
- GREEN CROSS CORPORATION (Yongin-si, Gyeonggi-do, KR)
- MediGeneBio Corporation (Yongin-si, Gyeonggi-do, KR)
Inventors
- Jin-Kyung Lee (Yongin-si, KR)
- Han-Yeul Byun (Yongin-si, KR)
- Myung-Eun Jung (Yongin-si, KR)
- Kyu-Hyun Lee (Yongin-si, KR)
Cpc classification
A61K9/0019
HUMAN NECESSITIES
A61K38/16
HUMAN NECESSITIES
A61K38/465
HUMAN NECESSITIES
A61K47/26
HUMAN NECESSITIES
International classification
A61K47/18
HUMAN NECESSITIES
A61K47/26
HUMAN NECESSITIES
Abstract
A Hunter syndrome therapeutic agent contains a first composition to be intravenously injected and a second composition to be subcutaneously injected. The agent can reduce the number of visits to the hospital by patients with Hunter syndrome to twice a month or less. It maintains a medicinal effect equivalent to or greater than that of a conventional once-a-week IV injection, increases drug-taking compliance of patients in comparison to conventional therapeutic agents and treatment methods, and enables enhanced patient welfare and convenience.
Claims
1. A formulation for treating Hunter syndrome, comprising a first composition for an intravenous injection and a second composition for a subcutaneous injection.
2. The formulation for treating Hunter syndrome according to claim 1, wherein the first composition is intravenously injected once every two months to twice a month, and the second composition is subcutaneously injected once to seven times a week.
3. The formulation for treating Hunter syndrome according to claim 1, wherein the first composition is intravenously injected once a month, and the second composition is subcutaneously injected once a week.
4. The formulation for treating Hunter syndrome according to claim 1, wherein the first composition is injected at the first week of the month, and the second composition is injected 1 to 7 times per week from the next week to the last week.
5. The formulation for treating Hunter syndrome according to claim 1, wherein the first composition is injected at the first week of the two months, and the second composition is injected 1 to 7 times per week from the next week to the last week of the two months.
6. The formulation for treating Hunter syndrome according to claim 1, wherein the first composition comprises iduronate-2-sulfatase consisting of at least one of the amino acid sequences of SEQ ID NOS: 1 and 2.
7. The formulation for treating Hunter syndrome according to claim 1, wherein the second composition comprises iduronate-2-sulfatase consisting of at least one of the amino acid sequences of SEQ ID NOS: 1 and 2.
8. The formulation for treating Hunter syndrome according to claim 1, wherein the first composition is injected at an effective dose of 0.05 mg/kg to 20 mg/kg per week.
9. The formulation for treating Hunter syndrome according to claim 1, wherein the first composition is injected at an effective dose of 0.1 mg/kg to 5 mg/kg per week.
10. The formulation for treating Hunter syndrome according to claim 1, wherein the second composition is injected at an effective dose of 0.1 mg/kg to 40 mg/kg per week.
11. The formulation for treating Hunter syndrome according to claim 1, wherein the second composition is injected at an effective dose of 0.2 mg/kg to 10 mg/kg per week.
12. The formulation for treating Hunter syndrome according to claim 1, wherein the second composition comprises at least one buffer selected from the group consisting of sodium phosphate and L-histidine.
13. The formulation for treating Hunter syndrome according to claim 1, wherein the second composition comprises at least one stabilizer selected from the group consisting of Polysorbate 20 and arginine.
14. The formulation for treating Hunter syndrome according to claim 1, wherein the second composition comprises an absorption enhancer, which is hyaluronidase.
15. A method for treating Hunter syndrome, comprising intravenously injecting a first composition and subcutaneously injecting a second composition.
16. The method for treating Hunter syndrome according to claim 15, wherein the first composition is intravenously injected once every two months to twice a month, and the second composition is subcutaneously injected 1 to 7 times a week.
17. The method for treating Hunter syndrome according to claim 15, wherein the first composition is intravenously injected once a month, and the second composition is subcutaneously injected once a week.
18. The method for treating Hunter syndrome according to claim 15, wherein the first composition is injected at the first week of the month, and the second composition is injected 1 to 7 times per week from the next week to the last week.
19. The method for treating Hunter syndrome according to claim 15, wherein the first composition is injected at the first week of the two months, and the second composition is injected 1 to 7 times per week from the next week to the last week of the two months.
20. The method for treating Hunter syndrome according to claim 15, wherein the first composition comprises iduronate-2-sulfatase consisting of at least one of the amino acid sequences of SEQ ID NOS: 1 and 2.
21. The method for treating Hunter syndrome according to claim 15, wherein the second composition comprises iduronate-2-sulfatase consisting of at least one of the amino acid sequences of SEQ ID NOS: 1 and 2.
22. The method for treating Hunter syndrome according to claim 15, wherein the first composition is injected at an effective dose of 0.05 mg/kg to 20 mg/kg per week.
23. The method for treating Hunter syndrome according to claim 15, wherein the first composition is injected at an effective dose of 0.1 mg/kg to 5 mg/kg per week.
24. The method for treating Hunter syndrome according to claim 15, wherein the second composition is injected at an effective dose of 0.1 mg/kg to 40 mg/kg per week.
25. The method for treating Hunter syndrome according to claim 15, wherein the second composition is injected at an effective dose of 0.2 mg/kg to 10 mg/kg per week.
26. A formulation for treating Hunter syndrome, comprising a therapeutic composition subcutaneously administered to a patient at a dose of 0.001 mL/hour to 100 mL/hour.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
MODE FOR CARRYING OUT THE INVENTION
[0056] The present invention relates to a formulation for treating Hunter syndrome and more specifically to a formulation for treating Hunter syndrome, which comprises a first composition for an intravenous injection and a second composition for a subcutaneous injection and is capable of exhibiting equivalent or better drug efficacy as compared with the conventional IV administration once a week while reducing the number of visits of the patients suffering from Hunter syndrome to the hospital to twice a month or less; improving the compliance of the patients suffering from Hunter syndrome with the medicine as compared with the conventional therapeutic formulation and method; and enhancing the welfare and convenience of the patients suffering from Hunter syndrome. The method of combined IV/SC administrations according to the present invention replaces a certain number of IV administrations in the conventional method of IV administration once a week, which requires that the patients visit the hospital every week, with SC administrations that can be made by the patents by themselves at home. The method of the present invention requires that the patents visit the hospital less often than the conventional method of IV administration once a week, while exhibiting equivalent or better drug efficacy as compared with the conventional IV administration once a week. Thus, the present invention starkly contradicts the conventional common idea that the therapeutic effect of SC administrations will not be superior to the therapeutic effect of IV administrations. Accordingly, the present invention relates to a formulation and a method, which drastically improve the therapeutic effect on Hunter syndrome as compared with the conventional therapy.
[0057] The present invention relates to a formulation for treating Hunter syndrome, which comprises a first composition for an intravenous injection and a second composition for a subcutaneous injection; and a method for treating Hunter syndrome, which comprises combined administrations of intravenously injecting a first composition and subcutaneously injecting a second composition.
[0058] Hereinafter, the present invention will be described in detail.
[0059] The formulation for treating Hunter syndrome according to the present invention comprises a first composition for an intravenous injection and a second composition for a subcutaneous injection.
[0060] The first composition is a composition for an intravenous injection. A composition for an intravenous injection refers to a sterile composition, which allows a drug in liquid phase to be injected directly into the vein to act. A composition for injection covers all compositions that can be used in the preparation of a customary injection and includes, but is not limited to, aqueous injections, non-aqueous injections, suspension injections, and freeze-dried injections.
[0061] The first composition is intravenously injected once every two months to twice a month.
[0062] The administration once a month means that the interval between the previous intravenous injection and the next intravenous injection is one month or so. For example, the interval between intravenous injections may be 25 days, 26 days, 27 days, 28 days, 29 days, 30 days, 31 days, 32 days, or 33 days, depending on the conditions of the patient or those of the treatment.
[0063] The first composition comprises an active ingredient that is effective in treating Hunter syndrome.
[0064] Iduronate-2-sulfatase (IDS or I2S) may be used as an active ingredient in the first composition.
[0065] IDS in the present invention comprises, for example, a protein consisting of the amino acid sequence of SEQ ID NO: 1 or 2. The protein consisting of the amino acid sequence of SEQ ID NO: 2 has the 59.sup.th cysteine (Cys) of the protein consisting of the amino acid sequence of SEQ ID NO: 1 substituted by formylglycine (FGly).
[0066] IDS comprises proteins in which some amino acids have been inserted, deleted, substituted, or the like, in the protein consisting of the amino acid sequence of SEQ ID NO: 1 or 2, as long as the therapeutic activity for treating Hunter syndrome is maintained.
[0067] IDS may be a protein derived from an animal such as a human or may be a recombinant protein.
[0068] IDS may be a mixture of two or more proteins. For example, IDS may be a mixture of a protein consisting of the amino acid sequence of SEQ ID NO: 1 and a protein consisting of the amino acid sequence of SEQ ID NO: 2. In addition, IDS may be, for example, a mixture of 35% (by mole) or less of a protein consisting of the amino acid sequence of SEQ ID NO: 1 and 65% or more, 70% or more, 75% or more, or 80% (by mole in each occurrence) or more of a protein consisting of the amino acid sequence of SEQ ID NO: 2.
[0069] If the protein consisting of the amino acid sequence of SEQ ID NO: 2 is contained in an amount of 65% (by mole) or more, the therapeutic effect on Hunter syndrome is improved.
[0070] The protein consisting of the amino acid sequence of SEQ ID NO: 1 or 2 may have mannose-6-phosphate (M6P) in an amount of 2.0 to 4.0 moles, preferably 2.3 to 3.5 moles, more preferably 2.5 to 3.0 moles, per 1 mole of the protein. Since M6P contributes to the uptake of IDS into the cells and the targeting of lysosomes, it is possible to effectively decompose glycosaminoglycan accumulated in the lysosomes if the content of M6P is high.
[0071] The first composition may comprise various inactive ingredients required for the intravenous injection composition other than the active ingredient (i.e., effective ingredient).
[0072] For example, the first composition may further comprise buffers (such as sodium phosphate and L-histidine), carbohydrates (such as glucose, mannose, sucrose, and dextran), stabilizers (such as sodium hydrogen sulfite, sodium sulfite or ascorbic acid, Polysorbate 20, and arginine), antioxidants, bacteriostatic agents, chelating agents (such as EDTA and glutathione), adjuvants (such as aluminum hydroxide), suspensions, thickeners, and/or preservatives (such as benzalkonium chloride, methyl- or propyl-paraben, and chlorobutanol). In addition, it may further comprise various antibacterial agents and antifungal agents such as parabens, chlorobutanol, phenol, sorbic acid, and thimerosal.
[0073] The first composition may comprise a liquid suitable for an intravenous injection. This liquid may be, but is not limited to, solvents or dispersion media comprising water, ethanol, polyols (such as glycerol, propylene glycol, and liquid polyethylene glycol), mixtures thereof and/or vegetable oils. More preferably, an isotonic solution such as saline, a Hanks' solution, a ringer solution, PBS (phosphate buffered saline) containing triethanolamine, or sterilized water for injection, 10% ethanol, 40% propylene glycol, and 5% dextrose may be used. In addition, Other liquids suitable for intravenous administration may also be referenced to Remington's Pharmaceutical Sciences, 19.sup.th ed., Mack Publishing Company, Easton, Pa., 1995.
[0074] The second composition is a composition for a subcutaneous injection. A composition for a subcutaneous injection refers to a sterile composition, which allows a drug in liquid phase to be injected into the loose connective tissues below the dermis and absorbed through the capillary blood vessels to act.
[0075] The second composition is subcutaneously injected once to seven times a week.
[0076] The administration once to seven times a week means that the administration is performed at one time to seven times a week at regular intervals. For example, administration twice a week may be conducted on Monday and Thursday, on Tuesday and Friday, on Wednesday and Saturday, on Thursday and Sunday, on Friday and Monday, on Saturday and Tuesday, or on Sunday and Wednesday. Further, for example, administration three times a week may be performed on Monday, Wednesday, and Friday; on Tuesday, Thursday, and Saturday; on Wednesday, Friday, and Sunday; on Thursday, Saturday, and Monday; on Friday, Sunday, and Tuesday; or on Saturday, Monday, and Wednesday.
[0077] The second composition may be prepared basically by comprising components the same as, or similar to, those of the first composition (for example, the active ingredient (i.e., effective ingredient) and the inactive ingredients). These components may be changed for use as needed.
[0078] The second composition may comprise a liquid suitable for a subcutaneous injection. This liquid may be the same as, or similar to, that contained in the first composition and may be changed for use as needed.
[0079] The second composition may comprise sodium phosphate and L-histidine (20 mM, pH 6.0) as a buffer. The addition of a buffer can contribute to stabilization of the active pharmaceutical ingredient (API) in vivo even at a transient pH change.
[0080] The second composition may comprise Polysorbate 20 and arginine as a stabilizer. The concentration of Polysorbate 20 may be about 0.05 to 0.22 mg/mL.
[0081] Arginine may serve as a stabilizer and a solubilizer in addition to a buffer.
[0082] The second composition may comprise hyaluronidase as an absorption enhancer, which can enhance the absorption rate of the active ingredient in the body.
[0083] The second composition may comprise saline. The concentration of sodium chloride may be 2% or less, and the acidity (pH) may be from 3 to 8.
[0084] The order of injection of the first and second compositions may be such that the first composition is injected first, followed by injection of the second composition; or that the second composition is injected first, followed by injection of the first composition. For example, an intravenous injection may be administered at week 1, and subcutaneous injections may be administered at weeks 2 to 4; a subcutaneous injections may be administered at week 1, an intravenous injection may be administered at week 2, and subcutaneous injections may be administered at weeks 3 and 4; subcutaneous injections may be administered at weeks 1 and 2, an intravenous injection may be administered at week 3, and a subcutaneous injection may be administered at week 4; or subcutaneous injections may be administered at weeks 1-3 and an intravenous injection may be administered at week 4.
[0085] The first composition may be administered at various effective doses (i.e., the weight of the active ingredient administered per 1 kilogram of body weight to be treated in the unit of mg/kg or mpk) depending on the severity of the disease. Typically, it may be administered at an effect dose of 0.05 mg/kg to 20 mg/kg per week (for example, from 0.1 mg/kg to 5 mg/kg per week, from 0.5 mg/kg to 2 mg/kg per week, or from 0.5 mg/kg to 1 mg/kg per week). According to a more specific example, it may be administered at an effective dose of 0.5 mg/kg per week.
[0086] The second composition may be administered at various effective doses depending on the severity of the disease. Typically, it may be administered at an effect dose of 0.1 mg/kg to 40 mg/kg per week (for example, from 0.2 mg/kg to 20 mg/kg per week, from 0.5 mg/kg to 10 mg/kg per week, or from 0.5 mg/kg to 5 mg/kg per week). According to a more specific example, it may be administered at an effective dose of 1 mg/kg to 5 mg/kg per week (for example, from 2.5 mg/kg to 5 mg/kg per week). Also, the single dose volume of the second composition may be 2 mL/site or less (for example, 1 mL/site or less), and the concentration of IDS may be 1 to 300 mg/mL.
[0087] The weekly dose of the second composition may be such that the concentration of IDS in the patient's serum is 10 to 10,000 ng/mL within 24 hours after administration; that the average maximum serum concentration (C.sub.max) is 1.5 g/mL or more; and that the area under the concentration-time curve (AUC) is 200 to 1,000 min*g/mL or more.
[0088] The administration of the second composition may be such that IDS is delivered to tissues selected from the group consisting of muscle, skin, liver, kidney, spleen, joint, bone, lung, airway, tongue, upper respiratory tract, eye, ear, connective tissue, and heart; or that the concentration of IDS in the above-mentioned tissues may be increased. The administration of the second composition may cause the activity of IDS in the tissues to increase by at least 1 to 10 folds or more of the control group; that the increased activity is 10 to 600 nmole/hr/mg or more; and that the increased activity is 10 to 95% or more of the normal IDS activity.
[0089] The administration of the second composition may be such that the concentration of GAG in the serum, plasma, urine, and above-mentioned tissues is reduced by 10 to 100% of the difference in the concentration of GAG between the control group (i.e., control group before administration or untreated) and the normal group (i.e., normal tissues that are not affected by Hunter syndrome); and that the size of the liver or spleen may be reduced by 10 to 100% of the difference in size between the control group (i.e., control group before administration or untreated) and the normal group (i.e., normal tissues that are not affected by Hunter syndrome).
[0090] The administration of the second composition may be such that the result in a 6-minute gait test is improved by 10 to 250 meters or more over the control group (i.e., control group before administration or untreated) and by 10 to 1,000% or more over the control group (i.e., control group before administration or untreated).
[0091] Hereinafter, the present invention will be described in more detail with reference to the following examples and test examples. However, these examples and test examples are set forth to illustrate the present invention in detail, and the scope of the present invention is not limited thereto.
[0092] In the following test examples, IV or I.V stands for intravenous injection. SC or S.C stands for subcutaneous injection. PK refers to pharmacokinetics. PD stands for pharmacodynamics. Also, WT stands for wild-type, and KO stands for IDS knock-out.
Test Example 1
Pharmacokinetic Study on the Treatment of Hunter Syndrome with a Single IV or SC Administration
[0093] An IV composition and an SC composition were administered to mice to measure the serum concentration of IDS, and such pharmacokinetic analysis as AUC and bioavailability were carried out. Here, 6 to 8-week-old male mice were used. The experiment design is summarized in Table 1.
TABLE-US-00001 TABLE 1 Pharmacokinetic experiment design with single administration Dosing Group Subgroup Regimen (start age) (3/time point) Route (mg/kg) PK time points WT male N = 18 I.V 5 5 min, 30 min, 1 hr, 3 (n = 72) hr, 6 hr, 8 hr (6-8- N = 18 S.C 5 1 hr, 2 hr, 8 hr, 12 hr, week-old) 16 hr, 24 hr N = 18 S.C 10 1 hr, 2 hr, 8 hr, 12 hr, 16 hr, 24 hr N = 18 S.C 20 1 hr, 2 hr, 8 hr, 12 hr, 16 hr, 24 hr
[0094] Seventy-two normal mice were divided into four groups. One group was administered with an intravenous injection of 5 mg/kg corresponding to 10 times the clinical dose (0.5 mg/kg) of an intravenous injection (IV), and the other three groups were administered with a subcutaneous injection of 5, 10, and 20 mg/kg, respectively. The serum concentration of IDS was analyzed by ELISA. The results are shown in
TABLE-US-00002 TABLE 2 Results of pharmacokinetic analysis with single administration Intravenous injection Subcutaneous injection PK parameters 5 mg/kg 5 mg/kg 10 mg/kg 20 mg/kg C.sub.max (g/mL) 66.8 1.57 1.41 0.30 2.90 0.687 8.48 1.27 C.sub.max/D 0.281 0.06 0.290 0.0687 0.424 0.0636 (kg .Math. g/mL/mg) C.sub.0 (g/mL) 82.4 1.28 C.sub.last (g/mL) 0.176 0.0187 0.116 0.002 0.113 0.0474 0.393 0.0459 T.sub.max (hr) 1.00 0.00 1.00 0.00 1.00 0.00 T.sub.1/2 (hr, terminal phase) 1.80 0.218 6.89 0.952 5.25 0.501 5.60 0.567 AUC.sub.INF (hr .Math. g/mL) 48.2 3.61 10.6 0.958 19.2 4.02 53.9 0.444 AUC.sub.INF/D (hr .Math. kg .Math. 2.12 0.192 1.92 0.402 2.69 0.0222 g/mL/mg) AUC %_Extrap (%) 0.969 0.279 11.0 2.24 4.37 1.39 5.94 1.27 Cl (mL/hr/kg) 104.1 7.97 Vss (mL/kg) 83.3 3.99 MRT.sub.INF (hr) 0.801 0.0235 10.0 1.16 7.29 0.362 7.52 0.765 BA (%) 22.0 19.9 27.9
[0095] As shown in the table above, IDS reached the maximum serum concentration (C.sub.max, g/mL) at a rapid rate within 1 hour in the case of SC administration. The half-life (T.sub.1/2, hr) was 1.80 hr in the terminal phase in the case of IV administration, whereas the half-life was increased to 5.25 to 6.89 hr in the case of SC administration. The mean retention time (MRT, hr) was 0.801 hr in the group administered with an IV injection and 7.29 to 10.0 hr in the group administered with an SC injection. The concentration (C.sub.0, g/mL) immediately after an IV administration was 82.4 g/mL, which confirmed that most of the dose (5 mg/kg) was recovered. The C.sub.max and AUC.sub.INF values, which show the body's exposure to drugs upon an SC administration, increased dose-dependently. However, the increase was slightly greater in the group administered with 20 mg/kg than in the groups administered with 5 and 10 mg/kg. The AUC % _Extrap value was 0.969 to 11.0% in all treatment groups.
[0096] The bioavailability (BA, %) values were 22.0%, 19.9%, and 27.9% in the groups SC administered with 5, 10, and 20 mg/kg (with reference to AUC when 5 mg/kg was SC administered and with an assumption of linear PK), respectively. Overall, the BA values were approximately 20% when compared with the case of an IV administration. Therefore, it is expected that an SC administration at a dose of approximately 5 times (2.5 mg/kg) the IV dose will show a similar therapeutic effect to that of an IV administration.
Test Example 2
Pharmacodynamic Study on the Treatment of Hunter Syndrome with a Single IV or SC Administration
[0097] In consideration of the pharmacokinetic analysis (i.e., the BA value of an SC injection was about 20% of that of an IV injection), the effective dose of an SC injection was set to 2.5 mg/kg. After a single IV or SC injection, the effect thereof on reduction in the concentration of GAG was compared for 4 weeks. Urine samples were collected on the last day of Week 2 (i.e., Day 14) and on the last day of Week 4 (i.e., Day 28) counting from the day of dosing (Day 0). Samples of tissues (liver, brain, heart, kidney, spleen, and lung) were also collected on the last day of Week 4 (i.e., Day 28) for the measurement of GAG concentrations. A urine samples was collected once for three days prior to the drug administration for comparison. The pharmacodynamic experiment design is summarized in Table 3.
TABLE-US-00003 TABLE 3 Pharmacodynamic experiment design with single administration Group Dosing Regimen (start age) Test item Subgroup Route (mg/kg) WT (n = 6) Vehicle N = 6 S.C KO (n = 30) Vehicle N = 6 S.C (6-8-week- Formulation for N = 6 S.C 0.5 old) treating Hunter N = 6 S.C 2.5 syndrome N = 6 S.C 12.5 Formulation for N = 6 I.V 0.5 treating Hunter syndrome
[0098] The results of GAG concentration analysis of the urine samples according to the experiment design shown in Table 3 are summarized in Table 4 and
TABLE-US-00004 TABLE 4 Results of GAG concentration analysis of the urine samples with single administration (Day 28) GAG Group (g/g of creatinine) P-value Summary WT (n = 6) 0.577 0.155 <0.001 *** KO (n = 6) 1.29 0.0958 SC 0.5 mg/kg (n = 6) 1.07 0.0975 <0.05 * 2.5 mg/kg (n = 6) 0.867 0.101 <0.001 *** 12.5 mg/kg (n = 6) 0.815 0.113 <0.001 *** IV 0.5 mg/kg (n = 6) 0.923 0.136 <0.001 *** The GAG concentration values were expressed as Mean SEM. * p < 0.05, ** p < 0.01, *** p < 0.001 vs KO. One-way ANOVA and Dunnett's Multiple Comparison Test (GraphPad Prism)
[0099] The results of GAG concentration analysis of the spleen samples according to the experiment design shown in Table 3 are summarized in Table 5 and
TABLE-US-00005 TABLE 5 Results of GAG concentration analysis of the spleen samples with single administration (Day 28) GAG Group (g/mg of protein) P-value Summary WT (n = 6) 1.41 0.121 <0.001 *** KO (n = 6) 8.55 0.619 SC 0.5 mg/kg (n = 6) 5.88 0.329 <0.001 *** 2.5 mg/kg (n = 6) 5.89 0.524 <0.001 *** 12.5 mg/kg (n = 6) 4.03 0.362 <0.001 *** IV 0.5 mg/kg (n = 6) 4.80 0.470 <0.001 *** The GAG concentration values were expressed as Mean SEM. * p < 0.05, ** p < 0.01, *** p < 0.001 vs KO. One-way ANOVA and Dunnett's Multiple Comparison Test (GraphPad Prism)
[0100] The results of GAG concentration analysis of the heart samples according to the experiment design shown in Table 3 are summarized in Table 6 and
TABLE-US-00006 TABLE 6 Results of GAG concentration analysis of the heart samples with single administration (Day 28) GAG Group (g/mg of protein) P-value Summary WT (n = 6) 0.390 0.0594 <0.001 ### KO (n = 6) 11.1 0.560 SC 0.5 mg/kg (n = 6) 10.7 0.799 >0.05 2.5 mg/kg (n = 6) 6.75 0.405 >0.05 12.5 mg/kg (n = 6) 3.49 0.212 <0.01 ## IV 0.5 mg/kg (n = 6) 5.96 0.0613 >0.05 The GAG concentration values were expressed as Mean SEM. #: p < 0.05, ##: p < 0.01, ###: p < 0.001 vs KO. Kruskal-Wallis Test and Dunn's Multiple Comparison Test (GraphPad Prism)
[0101] The results of GAG concentration analysis of the kidney samples according to the experiment design shown in Table 3 are summarized in Table 7 and
TABLE-US-00007 TABLE 7 Results of GAG concentration analysis of the kidney samples with single administration (Day 28) GAG Group (g/mg of protein) P-value Summary WT (n = 6) 0.639 0.0593 <0.01 ## KO (n = 6) 25.0 0.957 SC 0.5 mg/kg (n = 6) 25.9 0.645 >0.05 2.5 mg/kg (n = 6) 23.8 0.821 >0.05 12.5 mg/kg (n = 6) 16.4 0.740 >0.05 IV 0.5 mg/kg (n = 6) 23.5 1.34 >0.05 The GAG concentration values were expressed as Mean SEM. #: p < 0.05, ##: p < 0.01, ###: p < 0.001 vs KO. Kruskal-Wallis Test and Dunn's Multiple Comparison Test (GraphPad Prism)
[0102] The results of GAG concentration analysis of the liver samples according to the experiment design shown in Table 3 are summarized in Table 8 and
TABLE-US-00008 TABLE 8 Results of GAG concentration analysis of the liver samples with single administration (Day 28) GAG Group (g/mg of protein) P-value Summary WT (n = 6) 0.676 0.0143 <0.001 ### KO (n = 6) 50.5 1.19 SC 0.5 mg/kg (n = 6) 23.7 0.159 >0.05 2.5 mg/kg (n = 6) 18.6 0.815 >0.05 12.5 mg/kg (n = 6) 10.3 0.799 <0.01 ## IV 0.5 mg/kg (n = 6) 16.0 0.762 >0.05 The GAG concentration values were expressed as Mean SEM. #: p < 0.05, ##: p < 0.01, ###: p < 0.001 vs KO. Kruskal-Wallis Test and Dunn's Multiple Comparison Test (GraphPad Prism)
[0103] The results of GAG concentration analysis of the lung samples according to the experiment design shown in Table 3 are summarized in Table 9 and
TABLE-US-00009 TABLE 9 Results of GAG concentration analysis of the lung samples with single administration (Day 28) GAG Group (g/mg of protein) P-value Summary WT (n = 6) 0.992 0.0951 <0.001 ### KO (n = 6) 34.4 2.43 SC 0.5 mg/kg (n = 6) 31.3 2.42 >0.05 2.5 mg/kg (n = 6) 28.8 2.10 >0.05 12.5 mg/kg (n = 6) 19.2 0.955 <0.05 # IV 0.5 mg/kg (n = 6) 29.1 2.11 >0.05 The GAG concentration values were expressed as Mean SEM. #: p < 0.05, ##: p < 0.01, ###: p < 0.001 vs KO. Kruskal-Wallis Test and Dunn's Multiple Comparison Test (GraphPad Prism)
[0104] The results of GAG concentration analysis of the brain samples according to the experiment design shown in Table 3 are summarized in Table 10 and
TABLE-US-00010 TABLE 10 Results of GAG concentration analysis of the brain samples with single administration (Day 28) GAG Group (g/mg of protein) P-value Summary WT (n = 6) 0.558 0.0369 <0.001 *** KO (n = 6) 1.27 0.0651 SC 0.5 mg/kg (n = 6) 1.27 0.0868 >0.05 2.5 mg/kg (n = 6) 1.19 0.0602 >0.05 12.5 mg/kg (n = 6) 1.16 0.0756 >0.05 IV 0.5 mg/kg (n = 6) 1.12 0.0798 >0.05 The GAG concentration values were expressed as Mean SEM. * p < 0.05, ** p < 0.01, *** p < 0.001 vs KO. One-way ANOVA and Dunnett's Multiple Comparison Test (GraphPad Prism)
[0105] Taking all the results shown in Tables 4 to 10 into consideration, it can be seen that the formulation for treating Hunter syndrome of the present invention generally exhibits the effect of reducing GAG dose-dependently when administered by a single subcutaneous (SC) injection. Further, when 2.5 mg/kg is administered by a subcutaneous (SC) injection, the effect of reducing GAG is similar to that of the clinical dose of 0.5 mg/kg of an intravenous (IV) injection.
Test Example 3
Determination of SC Infusion Rate of the Formulation for Treating Hunter Syndrome
[0106] A commercially marketed vial for an intravenous injection of IDS has a size of 3.0 mL, which contains a solution that comprises 6.0 mg of an IDS enzyme in a concentration of 2.0 mg/mL. This medicine is for one-time use. The recommended dose to the patients is 0.5 mg per 1 kg of the body weight, which is gradually administered to the patients intravenously when the patient visits the hospital once a week. The amount corresponding to the patient's body weight is diluted in 100 mL of 0.9% sodium chloride water for injection, which is administered intravenously. The total dose should be gradually administered over 1 to 3 hours or longer. The infusion time may be extended due to any infusion related reactions. However, the infusion time should not exceed 8 hours. The initial infusion rate should be 8 mL/hour for 15 minutes from the beginning of infusion, and the infusion rate may then be increased by 8 mL/hour at 15-minute intervals to allow the total dose to be administered within the expected time if no toxicity appears. However, doctors and nurses are instructed that the infusion rate should not exceed a maximum of 100 mL/hour.
[0107] For a subcutaneous injection, a relatively small volume is generally administered at once. However, a drug may be administered in a continuous SC or SC infusion if there is a limit that the drug is concentrated to reduce the total volume of the drug. In the case where a drug originally developed for an intravenous injection is changed for a subcutaneous injection as in the present invention, whether the drug is suitable for a continuous SC or SC infusion should be clearly confirmed. According to the present invention, a subcutaneous administration may be carried out at a volume of 2 mL/site or less. According to a more specific example, the dosage may be 1 mL/site or less.
Test Example 4
Pharmacodynamic Study on the Treatment of Hunter Syndrome with Repeated and Combined IV and SC Administrations
[0108] The active ingredient of Idursulfase beta according to one embodiment of the present invention was used. The effective dose for IV was 0.5 mg/kg, and the effective dose for SC was 0.5 mg/kg, 1 mg/kg, 2.5 mg/kg, or 5 mg/kg. Mice were subjected to repeated IV administrations, repeated SC administrations, and repeated IV and SC administrations in accordance with the experiment design as shown in Table 11 below. In the case where the effective dose for IV and SC is 0 mg/kg in Table 11, it means a control group in which only saline was administered.
TABLE-US-00011 TABLE 11 Weekly dosing scheme Mouse Substance Day 0 Day 7 Day 14 Day 21 Day 28 Day 35 Day 42 Day 49 WT Saline IV SC SC SC IV SC SC SC (0) (0) (0) (0) (0) (0) (0) (0) IDS Saline IV SC SC SC IV SC SC SC KO (0) (0) (0) (0) (0) (0) (0) (0) Idursulfase IV SC SC SC IV SC SC SC beta (0.5) (0.5) (0.5) (0.5) (0.5) (0.5) (0.5) (0.5) IV SC SC SC IV SC SC SC (0.5) (1) (1) (1) (0.5) (1) (1) (1) IV SC SC SC IV SC SC SC (0.5) (2.5) (2.5) (2.5) (0.5) (2.5) (2.5) (2.5) IV SC SC SC IV SC SC SC (0.5) (5) (5) (5) (0.5) (5) (5) (5) IV IV IV IV IV IV IV IV (0.5) (0.5) (0.5) (0.5) (0.5) (0.5) (0.5) (0.5) SC SC SC SC SC SC S SC (2.5) (2.5) (2.5) (2.5) (2.5) (2.5) (2.5) (2.5) Idursulfase IV IV IV IV IV IV IV IV (0.5) (0.5) (0.5) (0.5) (0.5) (0.5) (0.5) (0.5) * Day 0 refers to the first administration day, and Day 7, Day 14, Day 21, Day 28, Day 35, Day 42, and Day 49 refer to the 7.sup.th, 14.sup.th, 21.sup.st, 28.sup.th, 35.sup.th, 42.sup.nd, and 49.sup.th days from the first administration day, respectively. * Urine samples were collected on Day 3, Day 14, Day 28, and Day 56; and Day 3 refers to 3 days before the first administration day. * Tissue samples were collected on Day 56. * IV or SC stands for the administration route on the corresponding administration day (IV: intravenous injection, SC: subcutaneous injection). * The number in parentheses after IV or SC indicates the effective dose of the formulation for treating Hunter syndrome per administration in the unit of mg/kg. * Idursulfase beta is the active ingredient according to one embodiment of the present invention. * Idursulfase was used as a control group.
[0109] In accordance with the above experiment design, repeated IV administrations, repeated SC administrations, and repeated IV and SC administrations were carried out in a total of 8 times in each test at intervals of one week. Urine samples were collected on three days before the first administration day, the 14.sup.th day, 28.sup.th day, and 56.sup.th day from the first administration day, respectively. Tissue samples were collected on the 56.sup.th day (D 56). The effect of reducing GAG was then compared.
[0110] The results of GAG concentration analysis of the kidney, liver, and spleen samples according to the experiment design shown in Table 11 are summarized in Tables 12 to 14 and
TABLE-US-00012 TABLE 12 Results of GAG concentration analysis of the kidney samples with combined administrations (Day 56) Concen- GAG (g/mg Mouse Substance tration of protein) P-value Summary WT Saline 0.25 0.25 <0.001 *** (n = 4) IDS KO Saline 20.65 0.30 (n = 4) Idursulfase 0.5 IV .fwdarw. 13.66 1.40 <0.05 * beta 0.5 SC 0.5 IV .fwdarw. 13.98 0.94 <0.05 * 1.0 SC 0.5 IV .fwdarw. 10.86 1.22 <0.01 ** 2.5 SC 0.5 IV .fwdarw. 6.61 2.66 <0.001 *** 5.0 SC 2.5 SC 14.83 0.90 >0.05 0.5 IV 8.01 2.92 <0.001 *** Idursulfase 0.5 IV 10.47 1.92 <0.001 *** The GAG concentration values were expressed as Mean SEM. * p < 0.05, ** p < 0.01, *** p < 0.001 vs KO. One-way ANOVA and Dunnett's Multiple Comparison Test (GraphPad Prism)
[0111] As shown in Table 12 and
TABLE-US-00013 TABLE 13 Results of GAG concentration analysis of the liver samples with combined administrations (Day 56) Concen- GAG (g/mg Mouse Substance tration of protein) P-value Summary WT Saline 0.94 0.09 <0.001 *** (n = 4) IDS KO Saline 30.05 0.65 (n = 4) Idursulfase 0.5 IV .fwdarw. 1.60 0.43 <0.001 *** beta 0.5 SC 0.5 IV .fwdarw. 1.31 0.38 <0.001 *** 1.0 SC 0.5 IV .fwdarw. 1.58 0.42 <0.001 *** 2.5 SC 0.5 IV .fwdarw. 0.81 0.18 <0.001 *** 5.0 SC 2.5 SC 2.75 0.66 <0.001 *** 0.5 IV 0.91 0.17 <0.001 *** Idursulfase 0.5 IV 1.07 0.21 <0.001 *** The GAG concentration values were expressed as Mean SEM. * p < 0.05, ** p < 0.01, *** p < 0.001 vs KO. One-way ANOVA and Dunnett's Multiple Comparison Test (GraphPad Prism)
[0112] As shown in Table 13 and
TABLE-US-00014 TABLE 14 Results of GAG concentration analysis of the spleen samples with combined administrations (Day 56) Concen- GAG (g/mg Mouse Substance tration of protein) P-value Summary WT Saline 0.00 0.00 <0.001 *** (n = 4) IDS KO Saline 4.64 0.43 (n = 4) Idursulfase 0.5 IV .fwdarw. 1.20 0.44 <0.001 *** beta 0.5 SC 0.5 IV .fwdarw. 0.77 0.27 <0.001 *** 1.0 SC 0.5 IV .fwdarw. 0.85 0.53 <0.001 *** 2.5 SC 0.5 IV .fwdarw. 0.45 0.27 <0.001 *** 5.0 SC 2.5 SC 1.43 0.15 <0.001 *** 0.5 IV 0.68 0.31 <0.001 *** Idursulfase 0.5 IV 0.65 0.23 <0.001 *** The GAG concentration values were expressed as Mean SEM. * p < 0.05, ** p < 0.01, *** p < 0.001 vs KO. One-way ANOVA and Dunnett's Multiple Comparison Test (GraphPad Prism)
[0113] As shown in Table 14 and
[0114] In accordance with the experiment design shown in Table 11, urine samples were collected on Day 0, Day 14, Day 28, and Day 56. The results of GAG concentration analysis are summarized in Table 15 and
TABLE-US-00015 TABLE 15 Results of GAG concentration analysis of the urine samples with combined administrations (Day 56) Concen- GAG (g/mg Mouse Substance tration of protein) P-value Summary WT Saline 0.14 0.02 <0.01 ** (n = 4) IDS KO Saline 0.49 0.04 (n = 4) Idursulfase 0.5 IV .fwdarw. 0.27 0.06 >0.05 beta 0.5 SC 0.5 IV .fwdarw. 0.26 0.07 <0.05 * 1.0 SC 0.5 IV .fwdarw. 0.31 0.06 >0.05 2.5 SC 0.5 IV .fwdarw. 0.24 0.02 <0.05 * 5.0 SC 2.5 SC 0.39 0.09 >0.05 0.5 IV 0.32 0.01 >0.05 Idursulfase 0.5 IV 0.25 0.03 <0.05 * The GAG concentration values were expressed as Mean SEM. * p < 0.05, ** p < 0.01, *** p < 0.001 vs KO. One-way ANOVA and Dunnett's Multiple Comparison Test (GraphPad Prism)
[0115] As shown in Table 15 and
[0116] Taking into consideration all the results of experiments conducted in accordance with the experiment design shown in Table 11, it can be seen that the method of combined IV/SC administrations according to the present invention, particularly the combined administrations of an effective IV dose of 0.5 mg/kg and an effective SC dose of 2.5 mg/kg to 5 mg/kg, had an effect in treating Hunter syndrome equivalent to, or better than, that of the conventional IV administration (i.e., IV administrations at intervals of 7 days).
[0117] Therefore, the formulation for combined IV/SC administrations and the method of combined IV/SC administrations according to the present invention replace a certain number of IV administrations in the conventional method of IV administration once a week, which requires that the patients visit the hospital every week and takes 3 to 4 hours or longer per administration, with SC administrations that can be made by the patents by themselves at home. The formulation and the method of the present invention require that the patents visit the hospital less often than the conventional method of IV administration once a week, thereby eliminating the chances that the patients fail to visit the hospital for treatment, which drastically improves the compliance of the patients suffering from Hunter syndrome with the medicine. In addition, since the formulation and the method of the present invention exhibit drug efficacy equivalent to, or better than, that of the conventional IV administration once a week, it is possible to treat Hunter syndrome more effectively as compared with the conventional therapy.
Test Example 5
Active Ingredient of the Formulation for Treating Hunter Syndrome
[0118] The active ingredient that can be employed in the formulation and the method for treating Hunter syndrome according to an embodiment of the present invention may comprise, for example, SEQ ID NO: 1 and SEQ ID NO: 2.
TABLE-US-00016 SequenceListingFreeText SEQ.IDNO:1 IDSaminoacidsequence 525a.a. SETQANSTTDALNVLLIIVDDLRPSLGCYGDKLVRSPNID QLASHSLLFQNAFAQQAVCAPSRVSFLTGRRPDTTRLYDF NSYWRVHAGNFSTIPQYFKENGYVTMSVGKVFHPGISSNH TDDSPYSWSFPPYHPSSEKYENTKTCRGPDGELHANLLCP VDVLDVPEGTLPDKQSTEQAIQLLEKMKTSASPFFLAVGY HKPHIPFRYPKEFQKLYPLENITLAPDPEVPDGLPPVAYN PWMDIRQREDVQALNISVPYGPIPVDFQRKIRQSYFASVS YLDTQVGRLLSALDDLQLANSTIIAFTSDHGWALGEHGEW AKYSNFDVATHVPLIFYVPGRTASLPEAGEKLFPYLDPFD SASQLMEPGRQSMDLVELVSLFPTLAGLAGLQVPPRCPVP SFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIAYSQ YPRPSDIPQWNSDKPSLKDIKIMGYSIRTIDYRYTVWVGF NPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLF QLLMP SEQ.IDNO:2 IDSaminoacidsequence 525a.a. SETQANSTTDALNVLLIIVDDLRPSLGCYGDKLVRSPNID QLASHSLLFQNAFAQQAVG*APSRVSFLTGRRPDTTRLYDF NSYWRVHAGNFSTIPQYFKENGYVTMSVGKVFHPGISSNH TDDSPYSWSFPPYHPSSEKYENTKTCRGPDGELHANLLCP VDVLDVPEGTLPDKQSTEQAIQLLEKMKTSASPFFLAVGY HKPHIPFRYPKEFQKLYPLENITLAPDPEVPDGLPPVAYN PWMDIRQREDVQALNISVPYGPIPVDFQRKIRQSYFASVS YLDTQVGRLLSALDDLQLANSTIIAFTSDHGWALGEHGEW AKYSNFDVATHVPLIFYVPGRTASLPEAGEKLFPYLDPFD SASQLMEPGRQSMDLVELVSLFPTLAGLAGLQVPPRCPVP SFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIAYSQ YPRPSDIPQWNSDKPSLKDIKIMGYSIRTIDYRYTVWVGF NPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLF QLLMP (G* at position 59 of SEQ ID NO: 2 above refers to formlglycine (FGly).