ROLE OF CITRULLINATION IN DIAGNOSING DISEASES
20180299467 ยท 2018-10-18
Assignee
Inventors
- Jennifer Van Eyk (Los Angeles, CA)
- Justyna Fert-Bober (Sherman Oaks, CA, US)
- Erin Crowgey (Newark, DE, US)
- Ronald Holewinski (Sherman Oaks, CA, US)
- Benjamin Phillip Berman (Culver City, CA, US)
Cpc classification
G01N2800/2835
PHYSICS
International classification
Abstract
Provided herein are methods and markers for diagnosing cardiovascular disease and/or neurodegenearative diseases in a subject. The methods include obtaining a biological sample from a subject in need of diagnosis and detecting the amount of a citrullinated protein or a citrullinated peptide in the biological sample obtained from said subject.
Claims
1. A method for diagnosing a disease-state in a subject in need thereof, comprising: obtaining a biological sample from the subject; and detecting the amount of a citrullinated protein or a citrullinated peptide in the biological sample obtained from said subject; wherein a change in the level of the citrullinated protein or the citrullinated peptide relative to a reference value is indicative of increased risk of the disease-state in the subject.
2. The method of claim 1, wherein the citrullinated protein or the citrullinated peptide is increased relative to the reference value.
3. The method of claim 1, wherein the disease-state is any one or more of chronic neurodegenerative disease, acquired brain injury, cardiovascular disease, or a combination thereof.
4. The method of claim 3, wherein the cardiovascular disease is ischemic heart disease or idiopathic cardiomyopathy.
5. The method of claim 3, wherein the chronic neurodegenerative disease is Alzheimer's disease (AD) and other dementias, Parkinson's disease (PD) and PD-related disorders, Prion disease, Motor neurone diseases (MND), Huntington's Disease (HD), Spinocerebellar ataxia (SCA), Spinal muscular atrophy (SMA) or combinations thereof.
6. The method of claim 3, wherein the acquired brain injury is any one or more of traumatic brain injuries (TBI's), strokes, brain illness, tumor, hemorrhage, or combinations thereof.
7. The method of claim 1, wherein the citrullinated protein or the citrullinated peptide is secreted.
8. The method of claim 1, wherein the citrullinated protein or the citrullinated peptide is not secreted.
9. The method of claim 1, wherein the disease-state is cardiovascular disease and the citrullinated peptide is, or is at least 80% identical to, any one or more of NIDALSGMEGRK (SEQ ID NO: 18), PRSFMPNLVPPK (SEQ ID NO: 20), ESLDLRAHLK (SEQ ID NO: 19), AEETQRSVNDLTSQRAK (SEQ ID NO: 24), FADLSEAANRNNDALRQAK (SEQ ID NO: 22) or combinations thereof.
10. The method of claim 1, wherein the disease-state is ALS and the citrullinated peptide is, or is at least 80% identical to, any one or more of PSGVQMDPCCRALYDFEPENEGELGFK (SEQ ID NO: 306), QYMRRSTCTINYSK (SEQ ID NO: 307), LILIARNK (SEQ ID NO: 308), VIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAK (SEQ ID NO: 309), EVDVGLAADVGTLQRLPK (SEQ ID NO: 310), HEEAPGHRPTTNPNASK (SEQ ID NO: 311), GETPVNSTMSIGQARK (SEQ ID NO: 312), VRIQTQPGYANTLRDAAPK (SEQ ID NO: 313), NVGCLQEALQLATSFAQLRLGDVK (SEQ ID NO: 314) or combinations thereof.
11. The method of claim 5, wherein the disease-state is chronic neurodegenerative disease and the citrullinated peptide is, or is 80% identical to, any one or more of the peptides having the sequence set forth inSEQ ID NO.: 355, SEQ ID NO.: 402, SEQ ID NO.: 1, SEQ ID NO.: 348, SEQ ID NO.: 363, SEQ ID NO.: 428, SEQ ID NO.: 373, SEQ ID NO.: 315, SEQ ID NO.: 316, SEQ ID NO.: 340, SEQ ID NO.: 377, SEQ ID NO.: 331, SEQ ID NO.: 332, SEQ ID NO.: 325, SEQ ID NO.: 375, SEQ ID NO.: 429, SEQ ID NO.: 414, SEQ ID NO.: 313, SEQ ID NO.: 366, SEQ ID NO.: 360, SEQ ID NO.: 423, SEQ ID NO.: 405, SEQ ID NO.: 439, SEQ ID NO.: 321, SEQ ID NO.: 475, SEQ ID NO.: 476, SEQ ID NO.: 477, SEQ ID NO.: 478, SEQ ID NO.: 479, SEQ ID NO.: 480, SEQ ID NO.: 481, SEQ ID NO.: 482, SEQ ID NO.: 483, SEQ ID NO.: 484, SEQ ID NO.: 485, SEQ ID NO.: 486, SEQ ID NO.: 487, SEQ ID NO.: 488, SEQ ID NO.: 489, SEQ ID NO.: 490, SEQ ID NO.: 491, SEQ ID NO.: 492, SEQ ID NO.: 493, SEQ ID NO.: 494, SEQ ID NO.: 495, SEQ ID NO.: 496, SEQ ID NO.: 497, SEQ ID NO.: 498, SEQ ID NO.: 499, SEQ ID NO.: 500, SEQ ID NO.: 501, SEQ ID NO.: 502, SEQ ID NO.: 503, SEQ ID NO.: 504 or combinations thereof.
12. The method of claim 5, wherein the disease-state is acquired brain injury and the citrullinated peptide is, or is 80% identical to, any one or more of the peptides having the sequence set forth in SEQ ID NO.: 125, SEQ ID NO.: 265, SEQ ID NO.: 285, SEQ ID NO.: 505, SEQ ID NO.: 506, SEQ ID NO.: 507, SEQ ID NO.: 508, SEQ ID NO.: 509, SEQ ID NO.: 510, SEQ ID NO.: 511, SEQ ID NO.: 512, SEQ ID NO.: 513, SEQ ID NO.: 514, SEQ ID NO.: 515, SEQ ID NO.: 516, SEQ ID NO.: 517, SEQ ID NO.: 518, SEQ ID NO.: 519, SEQ ID NO.: 520, SEQ ID NO.: 521, SEQ ID NO.: 522, SEQ ID NO.: 523, SEQ ID NO.: 524, SEQ ID NO.: 525, SEQ ID NO.: 526, SEQ ID NO.: 527, SEQ ID NO.: 528, SEQ ID NO.: 529, SEQ ID NO.: 530, SEQ ID NO.: 531, SEQ ID NO.: 532, SEQ ID NO.: 533, SEQ ID NO.: 534, SEQ ID NO.: 535, SEQ ID NO.: 536, SEQ ID NO.: 537, SEQ ID NO.: 538, SEQ ID NO.: 539, SEQ ID NO.: 540, SEQ ID NO.: 541, SEQ ID NO.: 542, SEQ ID NO.: 543, SEQ ID NO.: 544, SEQ ID NO.: 545, SEQ ID NO.: 546, SEQ ID NO.: 547 or combinations thereof.
13. The method of claim 1, wherein the biological sample is any one or more of blood, plasma, serum, tissue biopsy or a combination thereof.
14. The method of claim 1, wherein the level of the citrullinated protein or citrullinated peptide is detected using mass spectrometry, high resolution mass spectrometry, tandem mass spectrometry, binding assay, immunoassay, antibody binding or immunohistochemistry.
15. The method of claim 3, further comprising prescribing treatment to the subject diagnosed any one or more of cardiovascular disease, chronic neurodegenerative disease, acquired brain injury or a combination thereof.
16. The method of claim 12, the treatment comprises any one or more of any one or more of therapeutic lifestyle changes, therapeutic agents, surgical treatments or a combination thereof.
17. The method of claim 3, wherein the presence of the citrullinated protein or the citrullinated peptide is indicative of the generation of autoantibodies during the pathogenesis of the chronic neurodegenerative disease, acquired brain injury or a combination thereof.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0017] Exemplary embodiments are illustrated in referenced figures. It is intended that the embodiments and figures disclosed herein are to be considered illustrative rather than restrictive
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
DETAILED DESCRIPTION
[0027] All references cited herein are incorporated by reference in their entirety as though fully set forth. Unless defined otherwise, technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Allen et al., Remington: The Science and Practice of Pharmacy 22nd ed., Pharmaceutical Press (Sep. 15, 2012); Hornyak et al., Introduction to Nanoscience and Nanotechnology, CRC Press (2008); Singleton and Sainsbury, Dictionary of Microbiology and Molecular Biology 3rd ed., revised ed., J. Wiley & Sons (New York, N.Y. 2006); Smith, March's Advanced Organic Chemistry Reactions, Mechanisms and Structure 7th ed., J. Wiley & Sons (New York, N.Y. 2013); Singleton, Dictionary of DNA and Genome Technology 3rd ed., Wiley-Blackwell (Nov. 28, 2012); and Green and Sambrook, Molecular Cloning: A Laboratory Manual 4th ed., Cold Spring Harbor Laboratory Press (Cold Spring Harbor, N.Y. 2012), provide one skilled in the art with a general guide to many of the terms used in the present application. For references on how to prepare antibodies, see Greenfield, Antibodies A Laboratory Manual 2nd ed., Cold Spring Harbor Press (Cold Spring Harbor N.Y., 2013); Kohler and Milstein, Derivation of specific antibody-producing tissue culture and tumor lines by cell fusion, Eur. J. Immunol. 1976 July, 6(7):511-9; Queen and Selick, Humanized immunoglobulins, U.S. Pat. No. 5,585,089 (1996 December); and Riechmann et al., Reshaping human antibodies for therapy, Nature 1988 Mar. 24, 332(6162):323-7.
[0028] One skilled in the art will recognize many methods and materials similar or equivalent to those described herein, which could be used in the practice of the present invention. Other features and advantages of the invention will become apparent from the following detailed description, taken in conjunction with the accompanying drawings, which illustrate, by way of example, various features of embodiments of the invention. Indeed, the present invention is in no way limited to the methods and materials described. For convenience, certain terms employed herein, in the specification, examples and appended claims are collected here.
[0029] Unless stated otherwise, or implicit from context, the following terms and phrases include the meanings provided below. Unless explicitly stated otherwise, or apparent from context, the terms and phrases below do not exclude the meaning that the term or phrase has acquired in the art to which it pertains. The definitions are provided to aid in describing particular embodiments, and are not intended to limit the claimed invention, because the scope of the invention is limited only by the claims. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs.
[0030] The terms marker or biomarker are used interchangeably herein, and in the context of the present invention refer to a protein or peptide that has specific citrullinated amino acid residues or the enzyme itself, PAD 1, PAD2, PAD3 or PAD4 (of a particular specific identity or apparent molecular weight) which is differentially present in a sample taken from patients having a specific disease or disorder as compared to a control value, the control value consisting of, for example, average or mean values in comparable samples taken from control subjects (e.g., a person with a negative diagnosis, normal or healthy subject). Biomarkers may be determined as specific peptides or proteins (Tables 1-10) which may be detected by antibodies or mass spectroscopy. In some applications, for example, a mass spectroscopy or other profile or multiple antibodies may be used to determine multiple biomarkers, and differences between individual biomarkers and/or the partial or complete profile may be used for diagnosis. This can include detection of the enzyme or a protein it has citrullinated, alone or in combination.
[0031] The term differentially present or change in level refers to differences in the quantity and/or the frequency of a marker present in a sample taken from patients having a specific disease or disorder as compared to a control subject. For example, a marker can be present at an elevated level or at a decreased level in samples of patients with the disease or disorder compared to a control value (e.g. determined from samples of control subjects). Alternatively, a marker can be detected at a higher frequency or at a lower frequency in samples of patients compared to samples of control subjects. A marker can be differentially present in terms of quantity, frequency or both as well as a ratio of differences between two or more specific modified amino acid residues and/or the enzyme itself. In one embodiment, an increase in the ratio of modified to unmodified proteins and peptides described herein is diagnostic of any one or more of the diseases described herein. In an embodiment, an increase in citrullination of proteins and peptides as described herein refers to an increase in ratio of modified (citrullinated) to unmodified (non-citrullinated) proteins and/or peptides described herein. In one embodiment, a decrease in the ratio of modified to unmodified proteins and peptides described herein is diagnostic of any one or more of the diseases described herein. In an embodiment, a decrease in citrullination of proteins and peptides as described herein refers to a decrease in ratio of modified (citrullinated) to unmodified (non-citrullinated) proteins and/or peptides described herein.
[0032] A marker, compound, composition or substance is differentially present in a sample if the amount of the marker, compound, composition or substance in the sample is statistically significantly different from the amount of the marker, compound, composition or substance in another sample, or from a control value. For example, a compound is differentially present if it is present at least about 120%, at least about 130%, at least about 150%, at least about 180%, at least about 200%, at least about 300%, at least about 500%, at least about 700%, at least about 900%, or at least about 1000% greater or less than it is present in the other sample (e.g. control), or if it is detectable in one sample and not detectable in the other.
[0033] Alternatively or additionally, a marker, compound, composition or substance is differentially present between samples if the frequency of detecting the marker, etc. in samples of patients suffering from a particular disease or disorder, is statistically significantly higher or lower than in the control samples or control values obtained from healthy individuals. For example, a biomarker is differentially present between the two sets of samples if it is detected at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or at least about 100% more frequently or less frequently observed in one set of samples than the other set of samples. These exemplary values notwithstanding, it is expected that a skilled practitioner can determine cut-off points, etc. that represent a statistically significant difference to determine whether the marker is differentially present.
[0034] Diagnostic means identifying the presence or nature of a pathologic condition and includes identifying patients who are at risk of developing a specific disease or disorder. Diagnostic methods differ in their sensitivity and specificity. The sensitivity of a diagnostic assay is the percentage of diseased individuals who test positive (percent of true positives). Diseased individuals not detected by the assay are false negatives. Subjects who are not diseased and who test negative in the assay, are termed true negatives. The specificity of a diagnostic assay is 1 minus the false positive rate, where the false positive rate is defined as the proportion of those without the disease who test positive. While a particular diagnostic method may not provide a definitive diagnosis of a condition, it suffices if the method provides a positive indication that aids in diagnosis.
[0035] The terms detection, detecting and the like, may be used in the context of detecting biomarkers, or of detecting a disease or disorder (e.g. when positive assay results are obtained). In the latter context, detecting and diagnosing are considered synonymous.
[0036] By indicative of or at risk of is intended to mean at increased risk of, compared to a normal subject, or compared to a control group, e.g. a patient population. Thus a subject carrying a particular marker may have an increased risk for a specific disease or disorder, and be identified as needing further testing. Increased risk or elevated risk mean any statistically significant increase in the probability, e.g., that the subject has the disorder. The risk is preferably increased by at least 10%, more preferably at least 20%, and even more preferably at least 50% over the control group with which the comparison is being made.
[0037] A test amount of a marker refers to an amount of a marker present in a sample being tested. A test amount can be either in absolute amount (e.g., .mu.g/ml) or a relative amount (e.g., relative intensity of signals).
[0038] A diagnostic amount of a marker refers to an amount of a marker in a subject's sample that is consistent with a diagnosis of a particular disease or disorder. A diagnostic amount can be either in absolute amount (e.g., g/ml) or a relative amount (e.g., relative intensity of signals).
[0039] A control amount of a marker can be any amount or a range of amount which is to be compared against a test amount of a marker. For example, a control amount of a marker can be the amount of a marker in a person who does not suffer from the disease or disorder sought to be diagnosed. A control amount can be either in absolute amount (e.g., g/ml) or a relative amount (e.g., relative intensity of signals).
[0040] The terms polypeptide, peptide and protein are used interchangeably herein to refer to a polymer of .alpha.-amino acid residues, in particular, of naturally-occurring .alpha.-amino acids. The terms apply to amino acid polymers in which one or more amino acid residue is an analog or mimetic of a corresponding naturally-occurring amino acid, as well as to naturally-occurring amino acid polymers. Polypeptides can be modified, e.g., by the addition of carbohydrate residues to form glycoproteins, phosphorylation to form phosphoproteins, and a large number of chemical modifications (oxidation, deamidation, amidation, methylation, formylation, hydroxymethylation, guanidination, for example) as well as degraded, reduced, or crosslinked. The terms polypeptide, peptide and protein include all unmodified and modified forms of the protein. A peptide would have a citrullinated residue or is part of the PAD enzyme.
[0041] Detectable moiety or a label refers to a composition detectable by spectroscopic, photochemical, biochemical, immunochemical, or chemical means. For example, useful labels include .sup.32P, .sup.35S, fluorescent dyes, electron-dense reagents, enzymes (e.g., as commonly used in an ELISA), biotin-streptavidin, digoxigenin, haptens and proteins for which antisera or monoclonal antibodies are available, or nucleic acid molecules with a sequence complementary to a target. The detectable moiety often generates a measurable signal, such as a radioactive, chromogenic, or fluorescent signal, that can be used to quantify the amount of bound detectable moiety in a sample. Quantitation of the signal is achieved by, e.g., scintillation counting, densitometry, flow cytometry, or direct analysis by mass spectrometry of intact protein or peptides (one or more peptide can be assessed) that has a potential citrullinated residue or part of the PAD enzyme. Citrullinated Arg as part of a protein or peptide can be detected directly by MS or via chemical derivatization. Any capture reagent including but not limited to antibodies and aptamers may be used to detect cirullinated peptides described herein.
[0042] Antibody refers to a polypeptide ligand substantially encoded by an immunoglobulin gene or immunoglobulin genes, or fragments thereof, which specifically binds and recognizes an epitope (e.g., an antigen). The recognized immunoglobulin genes include the kappa and lambda light chain constant region genes, the alpha, gamma, delta, epsilon and mu heavy chain constant region genes, and the myriad immunoglobulin variable region genes. Antibodies exist, e.g., as intact immunoglobulins or as a number of well characterized fragments produced by digestion with various peptidases. This includes, e.g., Fab and F(ab).sub.2 fragments. The term antibody, as used herein, also includes antibody fragments either produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA methodologies. It also includes polyclonal antibodies, monoclonal antibodies, chimeric antibodies, humanized antibodies, or single chain antibodies. Fc portion of an antibody refers to that portion of an immunoglobulin heavy chain that comprises one or more heavy chain constant region domains, CH1, CH2 and CH3, but does not include the heavy chain variable region.
[0043] By binding assay is meant a biochemical assay wherein the biomarkers are detected by binding to an agent, such as an antibody, through which the detection process is carried out. The detection process may involve radioactive or fluorescent labels, and the like. The assay may involve immobilization of the biomarker, or may take place in solution. Further, chemical binding to the citrullinated residue can occur directly.
[0044] Immunoassay is an assay that uses an antibody to specifically bind an antigen (e.g., a marker). The immunoassay is characterized by the use of specific binding properties of a particular antibody to isolate, target, and/or quantify the antigen.
[0045] The phrase specifically (or selectively) binds to an antibody or specifically (or selectively) immunoreactive with, when referring to a protein or peptide, refers to a binding reaction that is determinative of the presence of the protein in a heterogeneous population of proteins and other biologics. Thus, under designated immunoassay conditions, the specified antibodies bind to a particular protein at least two times the background and do not substantially bind in a significant amount to other proteins present in the sample. Specific binding to an antibody under such conditions may require an antibody that is selected for its specificity for a particular protein. A variety of immunoassay formats may be used to select antibodies specifically immunoreactive with a particular protein. For example, solid-phase ELISA immunoassays are routinely used to select antibodies specifically immunoreactive with a protein (see, e.g., Harlow & Lane, Antibodies, A Laboratory Manual (1988), for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity).
[0046] Methods for detecting citrullination refer to the mass spectrometry (MS) based methods used to detect citrullinated peptides, polypeptides and proteins. The methods include but are not restricted to neutral loss of 1 Da when deimination occurs on Arg; neutral loss of isocyanic acid from unmodified citrulline and used this ion as a diagnostic marker for detecting protein citrullination; derivatization when chemical modification of 238 Da or 239 Da occurs on Cit residue (can be monitored at the peptide and protein level); enrichment of citrullinated peptides (or proteins) that is based on the specific reaction of glyoxal derivatives that is immobilized on beads/column/matrix reacts exclusively with the ureido group of the citrulline residue at low pH. As well, MS using a targeted method like multiple or selective reaction monitoring can be used to quantify the modified peptide directly. In some embodiments, a labeled (e.g. labeled with .sup.15N or chemically labeled with additional stable isotopes) peptide of known concentration is added to the sample and compared directly to the endogenous (unlabeled) corresponding peptide allowing for quantification (based on a ratio of the endogenous peptide to the isotopic labeled peptides or absolute concentration if the exact amount of the isotopic labeled peptide is known).
[0047] The terms subject, patient or individual generally refer to a human, although the methods of the invention are not limited to humans, and should be useful in other animals (e.g. birds, reptiles, amphibians, mammals), particularly in mammals, since albumin is homologous among species.
[0048] Sample is used herein in its broadest sense. A sample may comprise a bodily fluid including blood, serum, plasma, tears, aqueous and vitreous humor, spinal fluid; a soluble fraction of a cell or tissue preparation, or media in which cells were grown; or membrane isolated or extracted from a cell or tissue; polypeptides, or peptides in solution or bound to a substrate; a cell; a tissue; a tissue print; a fingerprint, skin or hair; fragments and derivatives thereof. Subject samples usually comprise derivatives of blood products, including blood, plasma and serum.
[0049] The term modulation of specific PAD isoforms includes but is not limited to, increasing or decreasing the activity of endogenous PAD isoforms using gene therapy, siRNA, known inhibitors of PADs, or site-directed mutagenesis.
[0050] The term peptide as used herein refers to a polymer of amino acid residues typically ranging in length from 2 to about 30, or to about 40, or to about 50, or to about 60, or to about 70 residues. In certain embodiments the peptide ranges in length from about 2, 3, 4, 5, 7, 9, 10, or 11 residues to about 60, 50, 45, 40, 45, 30, 25, 20, or 15 residues. In certain embodiments the peptide ranges in length from about 8, 9, 10, 11, or 12 residues to about 15, 20 or 25 residues. In certain embodiments the amino acid residues comprising the peptide are L-form amino acid residues, however, it is recognized that in various embodiments, D amino acids can be incorporated into the peptide. Peptides also include amino acid polymers in which one or more amino acid residues are an artificial chemical analogue of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers. In addition, the term applies to amino acids joined by a peptide linkage or by other, modified linkages (e.g., where the peptide bond is replaced by an a-ester, a f3-ester, a thioamide, phosphonamide, carbamate, hydroxylate, and the like (see, e.g., Spatola, (1983) Chern. Biochem. Amino Acids and Proteins 7: 267-357), where the amide is replaced with a saturated amine (see, e.g., Skiles et al., U.S. Pat. No. 4,496,542, which is incorporated herein by reference, and Kaltenbronn et al., (1990) Pp. 969-970 in Proc. 11th American Peptide Symposium, ESCOM Science Publishers, The Netherlands, and the like)).
[0051] Citrullination (also called deimination) is a post-translational protein modification catalyzed by PADs that involves conversion of the amino acid arginine to citrulline within proteins. The involvement of citrullinated proteins in the pathogenesis of a number of autoimmune diseases has been established. For example, protein citrullination has been directly linked to the generation of autoantibodies contributing to rheumatoid arthritis (RA). However, the exact circumstances and underlying purpose of PAD activation and consequent protein citrullination within cells are not fully understood. In addition, the production of autoantibodies targeting citrullinated proteins has been implicated in many other autoimmune diseases such as multiple sclerosis, psoriasis, sporadic Creutzfeld-Jakob disease, Parkinson's disease and Alzheimer's disease (AD). The knowledge of citrullinated proteins and citrullinated sites in protein sequences can provide invaluable information about the etiological importance and function of these citrullinated proteins. Provided herein are new biomarkers predictive of cardiovascular diseases and neurodegenerative diseases which include citrullinated proteins and peptides.
[0052] Citrullination is linked to autoantigen and autoantibody response which may be used for detection or measurement of ratios of autoantigen (unmodified/not-citrullinated) to autoantigen (modified/citrullinated) to detect heart disease (citrullinated autoantibody/autoantigens as biomarker). Further, detection of citrullinated auoantibody can be used as risk stratification factor. Risk of developing heart failure (HF) and succumbing to myocardial infraction increases with age. Citrullination is known to increase with age and an increase in citrullination may be predictive of heart failure. Inhibition (eg. drug inhibition) of PAD enzyme responsible for citrullination may be a therapeutic target.
[0053] Protein citrullination plays a role in the generation of autoantibodies during the pathogenesis of specific neurodegenerative diseases such as Alzheimer's disease (AD). Since citrullination alters the overall charge distribution within a protein, potentially modifying tertiary structure, many citrullinated proteins in these PAD-expressing cells may be in a non-native conformation that is potentially immunogenic, especially if they are released from the cell and thus become accessible to immune surveillance.
[0054] Citrullination is linked to autoantigen and autoantibody response which may be used for detection or measurement of ratios of autoantigen (unmodified/not-citrullinated) to autoantigen (modified/citrullinated) to detect neurodegenerative disease (citrullinated autoantibody/autoantigens as biomarker). Citrullination is known to increase with age and an increase in citrullination may be predictive of neurodegenerative diseases. Inhibition (eg. drug inhibition) of PAD enzyme responsible for citrullination may be a therapeutic target.
Detection of Peptidyl-CitrullineComparison with Other Methods
[0055] Current research on citrullination focuses on its role in auto-immune diseases such as multiple sclerosis and rheumatoid arthritis (RA) [Baka Z, et al. Citrullination under physiological and pathological conditions. Joint Bone Spine 2012, 79:431-436; De Ceuleneer M, et al. In vivo relevance of citrullinated proteins and the challenges in their detection. Proteomics 2012, 12:752-760]. In this context, the exact knowledge of citrullination sites in a protein can provide invaluable information about the etiological importance of these citrullinated proteins. However, few techniques exist that can accurately detect citrullination at the peptide level in a high-throughput format.
[0056] In general analysis of PTMs by MS is a difficult task and dependent on PTM profound effect on local peptide characteristics, like: (i) the mass shift in the peptide molecular weight induced by the PTM, (ii) the overall abundance of the modified peptide, (iii) the stability of the modification during MS and MS/MS analysis, and (iv) the effect of the modification on the peptide's ionization efficiency. Citrullination is complicated as citrullinated proteins/peptides are difficult to discern from their non-PTM forms because citrullination leads to an additional mass of nominally 0.9802 Dalton compared to regular arginine residues, which prone to false positives. The commonly applied shotgun type liquid chromatography tandem MS (LC-MS/MS) methods depend on automated database screening which in this case may cause misidentification of .sup.13C isotopes or misidentification of other modifications that lead to a similar mass increase (in particular the commonly occurring deamidation of glutamine or asparagine residues). Misidentification of 13C isotopes can be avoided by searching the database that has a small enough parent mass tolerance (<5 ppm), because .sup.13C leads to a slightly larger mass increase (1.0036 Da) than the conversion of arginine into citrulline (0.9802 Da) [De Ceuleneer M, et al. In vivo relevance of citrullinated proteins and the challenges in their detection. Proteomics 2012, 12:752-760; Raijmakers R, et al. Elevated levels of fibrinogen-derived endogenous citrullinated peptides in synovial fluid of rheumatoid arthritis patients. Arthritis Res Ther 2012, 14:R114]. Deamidation, however, cannot be discriminated from citrullination based on mass alone. Deamidation does not change the number of charged residues in the peptide (under the acidic conditions used for LC-MS), whereas the conversion of arginine to citrulline neutralizes a positive charge. Citrullination results in a loss of positive charge that causing a shift in the isoelectric point from 11.41 for arginine to 5.91 for citrulline. Therefore, citrullination increases the overall hydrophobicity of a peptide compared to the non-modified and/or deamidated peptide resulting in a shift in retention time, which is a proof for a peptide being citrullinated rather than deamidated [Raijmakers R, et al. Elevated levels of fibrinogen-derived endogenous citrullinated peptides in synovial fluid of rheumatoid arthritis patients. Arthritis Res Ther 2012, 14:R114.]. However, with the current methods it remains challenging to rapidly, consistently, reproducibly, accurately, and sensitively detect and quantify citrullinated peptides across multiple samples.
Advantages of SWATH MS Over Other Strategies for Citrullinated-Targeted Protein Detection
[0057] The most commonly used mass spectrometry-based method for high-throughput protein citrullination analysis is data-dependent acquisition (DDA) [tahl D C, S et al. Data-controlled automation of liquid chromatography/tandem mass spectrometry analysis of peptide mixtures. J Am Soc Mass Spectrom 1996, 7:532-540; Yates J R, 3rd, Eng J K, McCormack A L, Schieltz D. Method to correlate tandem mass spectra of modified peptides to amino acid sequences in the protein database. Anal Chem 1995, 67:1426-1436]. However, stochastic precursor selection and dependence on MS1 ions for quantification impede comprehensive. To overcome this limitation a few years ago Aebersold's group came up with SWATH MS as a targeting method similar to multiple reaction monitoring (MRM). SWATH MS is a technique that combines data-independent acquisition (DIA) with targeted data extraction, which together gives quantitative accuracy, reproducibility, dynamic range, and extends the number of quantifiable peptides [Gillet LC1 NP TS, Rst H, Selevsek N, Reiter L, Bonner R, Aebersold R. Targeted data extraction of the MS/MS spectra generated by data-independent acquisition: a new concept for consistent and accurate proteome analysis. Mol Cell Proteomics 2012; Liu Y, et al. Mass spectrometric protein maps for biomarker discovery and clinical research. Expert Rev Mol Diagn 2013, 13:811-825]. Creation of highly citrullinated library improves the sensitivity and quantitative accuracy.
Cardiovascular Diseases
[0058] Provided herein are method for diagnosing and/or predicting cardiovascular diseases. The methods include obtaining a biological sample from a subject in need of diagnosing cardiovascular disease and detecting the amount of a citrullinated protein or a citrullinated peptide in the biological sample obtained from said subject. In some embodiments a change in the level of the citrullinated protein or the citrullinated peptide relative to a reference value is indicative of increased risk of cardiovascular disease. In one embodiment, an increase in the levels of the citrullinated protein or the citrullinated peptide relative to a reference value is indicative of increased risk of cardiovascular disease. In another embodiment, a decrease in the levels of the citrullinated protein or the citrullinated peptide relative to a reference value is indicative of increased risk of cardiovascular disease. In exemplary embodiments, change in cirullination levels of one or more proteins or peptides shown in Tables 1A, 1B, 1C, 1D and/or 1E is indicative of increased risk of cardiovascular diseases. In some embodiments, an increase in citrullination of the proteins shown in Table 1C, 1D, 1E and 1F as indicated by up in Table 1C, 1D, 1E and 1F is indicative of increased risk of cardiovascular disease. In some embodiments, a decrease in citrullination of the proteins shown in Table 1C, 1D, 1E and 1F as indicated by down in Table 1C, 1D, 1E and 1F is indicative of increased risk of cardiovascular disease. In some embodiments, change in citrullination refers to differentially present citrullunation as defined herein
[0059] In some embodiments, a subject has ischemic heart disease (ISHD) or is at an increased risk of ISHD if the sample from the subject has an increase in citrullination in any one or more of the proteins in Table 1C, as indicated by up in ischemic heart disease column (I). In some embodiments, the subject has or is at increased risk of ISHD if the sample from the subject has the presence of citrullination or an increase in citrullination of any one or more of the peptides in Table 1A. In some embodiments, the subject has or is at an increased risk of ISHD if the sample from the subject has the absence of citrullination or a decrease in citrullination of any one or more of the peptides in Table 1A. In some embodiments, a subject has or is at an increased risk of ISHD if the sample from the subject has an increase in cirullination in any one or more of ES1 protein homolog, aconitate hydratase or citrullinated fragments thereof, glyceraldehyde-3-phosphate dehydrogenase or citrullinated fragments thereof, delta-1-pyrroline-5-carboxylate dehydrogenase or citrullinated fragments thereof, vimentin or citrullinated fragments thereof, neuroblast differentiation-associated protein AHNAK or citrullinated fragments thereof, serum deprivation-response protein or citrullinated fragments thereof, enoyl-CoA hydratase or citrullinated fragments thereof, aconitate hydratase or citrullinated fragments thereof, or combinations thereof.
[0060] In some embodiments, a subject has idiopathic cardiomyopathy (IDCM) or is at increased risk of IDCM if the sample from the subject has an increase in citrullination in any one or more of the proteins in Table 1D, as indicated by up in IDCM column (ID). In some embodiments, the subject has or is at increased risk of IDCM if the sample from the subject has the presence of citrullination or an increase in citrullination of any one or more of the peptides in Table 1A. In some embodiments, the subject has or is at an increased risk of IDCM if the sample from the subject has the absence of citrullination or a decrease in citrullination of any one or more of the peptides in Table 1A. In some exemplary embodiments, a subject has or is at an increased risk of IDCM if the sample from the subject has an increase in citrullination in any one or more of ATP synthase subunit alpha or citrullinated fragments thereof, Myozenin-2 or citrullinated fragments thereof, Glyceraldehyde-3-phosphate dehydrogenase or citrullinated fragments thereof, ES1 protein homolog or citrullinated fragments thereof and/or combinations thereof.
[0061] In some embodiments, the subject has or is at increased risk of having cardiovascular disease (ISHD, IDCM or both ISHD and IDCM) if the sample from the subject has an increase in citrullination in any one or more of the proteins or peptides set forth in Tables 1A-1F. In some embodiments, the subject has or is at increased risk of having cardiovascular disease (ISHD, IDCM or both ISHD and IDCM) if the sample from the subject has an increase in citrullination in any one or more of ATP synthase subunit alpha or citrullinated fragments thereof, glyceraldehyde-3-phosphate dehydrogenase or citrullinated fragments thereof, ES1 protein homolog or citrullinated fragments thereof, delta-1-pyrroline-5-carboxylate dehydrogenase or citrullinated fragments thereof, enoyl-CoA hydratase or citrullinated fragments thereof, voltage-dependent anion-selective channel protein 1 or citrullinated fragments thereof, aconitate hydratase or citrullinated fragments thereof, pyruvate dehydrogenase E1 component subunit alpha, somatic form or citrullinated fragments thereof, vimentin or citrullinated fragments thereof, trifunctional enzyme subunit beta or citrullinated fragments thereof, myosin-binding protein C, cardiac-type or citrullinated fragments thereof, chloride intracellular channel protein 4 or citrullinated fragments thereof, heat shock protein HSP 90-alpha or citrullinated fragments thereof, serum deprivation-response protein or citrullinated fragments thereof, alcohol dehydrogenase 1B or citrullinated fragments thereof, succinate dehydrogenase [ubiquinone] iron-sulfur subunit or citrullinated fragments thereof, dual specificity protein phosphatase 3 or citrullinated fragments thereof or combinations thereof (Table 1E). In some embodiments, the subject has or is at increased risk of having cardiovascular disease (ISHD, IDCM or both ISHD and IDCM) if the sample from the subject has a decrease in citrullination in any one or more of Troponin I, Alpha-crystalline B chain, ATP-synthase-coupling factor 6, beta-enolase, adenylate kinase isoenzyne I or combination thereof (Table 1F). In some embodiments, change in citrullination refers to differentially present citrullination as defined herein.
[0062] Also provided herein is a method comprising obtaining a biological sample from a subject in need of diagnosing cardiovascular disease, using a peptide to assay the biological sample to detect the presence or absence of an antibody capable of binding specifically to the peptide, determining the presence of cardiovascular disease when the presence of the antibody capable of binding specifically to the peptide is detected and directing the subject to treatment of cardiovascular disease when the presence of the antibody capable of binding specifically to the peptide is detected. In various embodiments, presence of the antibody capable of binding specifically to the peptide is indicative of any one or more of ISHD, IDCM, heart failure or a combination thereof. In some embodiments, the peptide is a fragment of Troponin I, Vimentin, Myosin-7 or a combination thereof. In various embodiments, the peptide is citrullinated. In exemplary embodiments, the peptide comprises, consists of or consists essentially of the amino acid sequence NIDALSGMEGRK (SEQ ID NO: 18), PRSFMPNLVPPK (SEQ ID NO: 20), ESLDLRAHLK (SEQ ID NO: 19), AEETQRSVNDLTSQRAK (SEQ ID NO: 24) or FADLSEAANRNNDALRQAK (SEQ ID NO: 22). In exemplary embodiments, the peptide sequence of the citrullinated peptides in the sample from the subject is at least 95%, 90%, 80%, 70% or 60% identical to peptides set forth in any of Table 1A-1F. In exemplary embodiments, the peptide sequence of the citrullinated peptides in the sample from the subject is at least 95%, 90%, 80%, 70% or 60% identical to NIDALSGMEGRK (SEQ ID NO: 18), PRSFMPNLVPPK (SEQ ID NO: 20), ESLDLRAHLK (SEQ ID NO: 19), AEETQRSVNDLTSQRAK (SEQ ID NO: 24) or FADLSEAANRNNDALRQAK (SEQ ID NO: 22). In various embodiments, the length of the peptide is optimized to bind the antibody in the sample. In various embodiments, citrullinated peptides are detected using mass spectrometry, high resolution mass spectrometry, tandem mass spectrometry, binding assay, immunoassay, SDS page electrophoresis, Western blot analysis, conformation on mass spectrometry, including SWATH.
[0063] In various embodiments, the methods further comprise prescribing treatment to the subject diagnosed with cardiovascular disease. In various embodiments, treatments include but are not limited to any one or more of therapeutic lifestyle changes, therapeutic agents, surgical treatments or a combination thereof. In exemplary embodiments, lifestyle changes include any one or more of healthy diet, physical activity, weight management, stress management, not smoking or a combination thereof. In exemplary embodiments, therapeutic agents include any one or more of Angiotensin-converting enzyme (ACE) inhibitors, Angiotensin II receptor blockers (ARBs), Beta-blockers, Aldosterone antagonists, Cardiac glycosides, Diuretics, Vasodilators, Antiarrhythmics, Human B-type natriuretic peptide, Inotropic agent, Anticoagulants, inhibitors of peptidyl arginine deiminase (PAD) enzymes or a combination thereof. In exemplary embodiments, surgical treatments include any one or more of use of left ventricular assist devices, cardiac resynchronization therapy (biventricular pacing), automatic implantable cardioverter-defibrillators, ventricular restoration surgery, heart transplantation, angioplasty, stents, atherectomy, radiation therapy, coronary artery bypass grafting or a combination thereof. Appropriate therapies will be apparent to one skilled in the art.
[0064] In various embodiments of the processes, assays and methods described herein, the reference value is based on the change in the level of citrullinated proteins or citrullinated peptides, as set forth in, for example, Tables 1A, 1B, 1C, 1D, 1E and/or 1F. In one embodiment, the change in the level of citrullinated proteins or citrullinated peptides is in a cardiomyocyte. In another embodiment, the change in the level of citrullinated proteins or citrullinated peptides is in a non-cardiac cell. In an additional embodiment, the change in the level of citrullinated proteins or citrullinated peptidesis in any cell. In an additional embodiment, the change in the level of citrullinated proteins or citrullinated peptidesis in any bodily fluid. In some embodiments, the reference value is the mean or median change in level of citrullinated proteins or citrullinated peptides in a population of subjects that do not have cardiovascular disease. In other embodiments, the reference value is the mean or median change in level of citrullinated proteins or citrullinated peptides in a population of subjects that have cardiovascular diseases but have undergone treatment and show no or reduced expression of citrullinated proteins or citrullinated peptides. In additional embodiments, the reference value is the change in expression level of citrullinated proteins or citrullinated peptides in a sample obtained from the subject from a different (for example, an earlier) time point, such as during diagnosis, before treatment, after treatment or a combination thereof. In some embodiments, cardiovascular disease is any one or more of ISHD, IDCM, heart failure or a combination thereof. In some embodiments, change in citrullination refers to differentially present citrullination as defined herein.
[0065] In various embodiments, the change in the level of citrullinated proteins or citrullinated peptides in the subject having or suspected of having cardiovascular disease compared to the reference value is increased by at least or about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100%. In various embodiments, the change in the level of citrullinated proteins or citrullinated peptides in the subject having or suspected of having cardiovascular disease compared to the reference value is increased by at least or about 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, 15-fold, 20-fold, 25-fold, 30-fold, 35-fold, 40-fold, 45-fold, 50-fold, 55-fold, 60-fold, 65-fold, 70-fold, 75-fold, 80-fold, 85-fold, 90-fold, 95-fold, 100-fold or a combination thereof.
[0066] In various embodiments, the change in the level of citrullinated proteins or citrullinated peptides in the subject having or suspected of having cardiovascular disease compared to the reference value is decreased by at least or about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100%. In various embodiments, the change in the level of citrullinated proteins or citrullinated peptides in the subject having or suspected of having cardiovascular disease compared to the reference value is decreased by at least or about 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, 15-fold, 20-fold, 25-fold, 30-fold, 35-fold, 40-fold, 45-fold, 50-fold, 55-fold, 60-fold, 65-fold, 70-fold, 75-fold, 80-fold, 85-fold, 90-fold, 95-fold, 100-fold or a combination thereof.
Neurodegenerative Diseases
[0067] Provided herein are methods for diagnosing and/or predicting chronic neurodegenerative diseases and/or acquired brain injury and/or acute brain disease. The methods include obtaining a biological sample from a subject in need of a diagnosis and detecting citrullinated protein or citrullinated peptide in the biological sample obtained from said subject. In some embodiments, presence of citrullinated proteins or citrullinated peptides is indicative of neurodegenerative diseases. In some embodiments a change in the level of the citrullinated protein or the citrullinated peptide relative to a reference value is indicative of neurodegenerative disease and/or acquired brain injury and/or acute brain disease. In one embodiment, an increase in the levels of the citrullinated protein or the citrullinated peptide relative to a reference value is indicative of neurodegenerative disease and/or acquired brain injury and/or acute brain disease. In another embodiment, a decrease in the levels of the citrullinated protein or the citrullinated peptide relative to a reference value is indicative of neurodegenerative disease and/or acquired brain injury and/or acute brain disease. In exemplary embodiments, a change in the levels of one or more citrullinated peptides or citrullinated proteins shown in Tables 2-10 is indicative of neurodegenerative diseases. In exemplary embodiments, a change in the amount of citrullination of one or more peptides or proteins shown in Tables 2-10 is indicative of neurodegenerative diseases. In some embodiments, the change in the level is an increase in the level of one or more citrullinated peptides or citrullinated proteins shown in Tables 2-10 which is indicative of chronic neurodegenerative disease. In some embodiments, the change in the level is a decrease in the level of one or more citrullinated peptides or citrullinated proteins shown in Tables 2-10 which is indicative of chronic neurodegenerative disease. In some embodiments, change in citrullination refers to differentially present citrullination as defined herein.
[0068] In exemplary embodiments, examples of neurodegenerative diseases include but are not limited to Alzheimer disease, Parkinson disease, Lewy body dementia, frontotemporal dementia, amyotrophic lateral sclerosis, Huntington disease, Friedreich's ataxia, spinal muscular atrophy, prion diseases, multiple sclerosis, stroke, degenerative nerve diseases, encephalitis, Motor neurone diseases (MND, Spinocerebellar ataxia (SCA), Spinal muscular atrophy (SMA) or Creutzfeld-Jacob disease.
[0069] In some embodiments, the biological sample is any one or more of blood, plasma, serum, urine or tissue (tissue biopsy).
[0070] In various embodiments, the level of the citrullinated protein or citrullinated peptide is detected using mass spectrometry, high resolution mass spectrometry, tandem mass spectrometry, binding assay, immunoassay, antibody binding or immunohistochemistry.
[0071] Provided herein is a method for diagnosing ALS in a subject in need thereof. The method includes obtaining a biological sample from a subject in need of a diagnosis and detecting citrullinated protein or citrullinated peptide in the biological sample obtained from the said subject. In some embodiments, presence of citrullinated proteins or citrullinated peptides is indicative of ALS. In some embodiments a change in the level of the citrullinated protein or the citrullinated peptide relative to a reference value is indicative of ALS. In one embodiment, an increase in the levels of citrullination of protein or citrullination of peptide relative to a reference value is indicative of ALS. In one embodiment, the subject has ALS or is at increased risk of having ALS if the sample from the subject has an increase in citrullination in any one or more of the proteins in Table 2, Table 3 or Table 4. In another embodiment, the subject has ALS or is at increased risk of having ALS if the sample from the subject has an increase in citrullination in any one or more of the peptides PSGVQMDPCCRALYDFEPENEGELGFK (SEQ ID NO: 306), QYMRRSTCTINYSK (SEQ ID NO: 307), LILIARNK (SEQ ID NO: 308), VIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAK (SEQ ID NO: 309), EVDVGLAADVGTLQRLPK (SEQ ID NO: 310), HEEAPGHRPTTNPNASK (SEQ ID NO: 311), GETPVNSTMSIGQARK (SEQ ID NO: 312), VRIQTQPGYANTLRDAAPK (SEQ ID NO: 313), NVGCLQEALQLATSFAQLRLGDVK (SEQ ID NO: 314) or combinations thereof. In exemplary embodiments, the citrullination sites in peptides having the sequence set forth in SEQ ID Nos. 306-314 are shown in Table 2. In a further embodiment, the subject has ALS or is at increased risk of having ALS if the sample from the subject has an increase in citrullination in any one or more of the peptides having the sequence set forth in any one or more of SEQ ID NO.: 315, SEQ ID NO.: 316, SEQ ID NO.: 317, SEQ ID NO.: 318, SEQ ID NO.: 319, SEQ ID NO.: 320, SEQ ID NO.: 321, SEQ ID NO.: 322, SEQ ID NO.: 323, SEQ ID NO.: 324, SEQ ID NO.: 325, SEQ ID NO.: 326, SEQ ID NO.: 327, SEQ ID NO.: 328, SEQ ID NO.: 329, SEQ ID NO.: 330, SEQ ID NO.: 331, SEQ ID NO.: 332, SEQ ID NO.: 333, SEQ ID NO.: 334, SEQ ID NO.: 335, SEQ ID NO.: 336, SEQ ID NO.: 337, SEQ ID NO.: 338, or combinations thereof. In exemplary embodiments, the citrullination sites in peptides having the sequence set forth in SEQ ID Nos. 315-338 are shown in Table 3. In exemplary embodiments, each of the citrullinatedpeptide sequences in the sample obtained from the subject is at least 100% 95%, 90%, 80%, 70% or 60% identical to the sequences set forth in any of SEQ ID Nos. 306-338. In some embodiments, the subject has ALS or is at increased risk of having ALS if the sample from the subject has an increase in citrullination in any one or more of the peptides having the sequence set forth in any one or more of SEQ ID Nos. 339-474. In exemplary embodiments, each of the peptide sequence in the sample obtained from the subject is at least 100%, 95%, 90%, 80%, 70% or 60% identical to the sequences set forth in any of SEQ ID Nos. 339-474. In some embodiments, change in citrullination refers to differentially present citrullination as defined herein.
[0072] Provided herein is a method for diagnosing chronic neurodegenerative disease in a subject in need thereof. The method includes obtaining a biological sample from a subject in need of a diagnosis and detecting citrullinated protein or citrullinated peptide in the biological sample obtained from the said subject. In some embodiments, presence of citrullinated proteins or citrullinated peptides is indicative of chronic neurodegenerative disease. In some embodiments a change in the level of the citrullinated protein or the citrullinated peptide relative to a reference value is indicative of chronic neurodegenerative disease. In one embodiment, an increase in the levels of citrullination of protein or citrullination of peptide relative to a reference value is indicative of chronic neurodegenerative disease. In one embodiment, a decrease in the levels of citrullination of protein or citrullination of peptide relative to a reference value is indicative of chronic neurodegenerative disease. In one embodiment, the subject has chronic neurodegenerative disease or is at increased risk of having chronic neurodegenerative disease if the sample from the subject has a change in citrullination in any one or more of the proteins in Table 5A. In some embodiments, the citrullinated peptides are brain specific. In some embodiments, the citrullinated peptides are not brain specific. In a further embodiment, the subject has chronic neurodegenerative disease or is at increased risk of having chronic neurodegenerative disease if the sample from the subject has a change in citrullination in any one or more of the peptides having the sequence set forth in any one or more of SEQ ID NO.: 355, SEQ ID NO.: 402, SEQ ID NO.: 1, SEQ ID NO.: 348, SEQ ID NO.: 363, SEQ ID NO.: 428, SEQ ID NO.: 373, SEQ ID NO.: 315, SEQ ID NO.: 316, SEQ ID NO.: 340, SEQ ID NO.: 377, SEQ ID NO.: 331, SEQ ID NO.: 332, SEQ ID NO.: 325, SEQ ID NO.: 375, SEQ ID NO.: 429, SEQ ID NO.: 414, SEQ ID NO.: 313, SEQ ID NO.: 366, SEQ ID NO.: 360, SEQ ID NO.: 423, SEQ ID NO.: 405, SEQ ID NO.: 439, SEQ ID NO.: 321, SEQ ID NO.: 475, SEQ ID NO.: 476, SEQ ID NO.: 477, SEQ ID NO.: 478, SEQ ID NO.: 479, SEQ ID NO.: 480, SEQ ID NO.: 481, SEQ ID NO.: 482, SEQ ID NO.: 483, SEQ ID NO.: 484, SEQ ID NO.: 485, SEQ ID NO.: 486, SEQ ID NO.: 487, SEQ ID NO.: 488, SEQ ID NO.: 489, SEQ ID NO.: 490, SEQ ID NO.: 491, SEQ ID NO.: 492, SEQ ID NO.: 493, SEQ ID NO.: 494, SEQ ID NO.: 495, SEQ ID NO.: 496, SEQ ID NO.: 497, SEQ ID NO.: 498, SEQ ID NO.: 499, SEQ ID NO.: 500, or combinations thereof (Table 5A). In exemplary embodiments, the citrullination sites in peptides having the sequence set forth in SEQ ID Nos. above are shown in Table 5A. In exemplary embodiments, each of the citrullinated peptide sequences in the sample from the subject is at least 95%, 90%, 80%, 70% or 60% identical to the sequences set forth Table 5A.
[0073] In exemplary embodiments, peptides that may be used for diagnosing chronic neurodegenerative disease are brain specific and comprises, consists of or consists essentially of any one or more of the sequences shown in Table 5A. In exemplary embodiments, peptides that may be used for diagnosing chronic neurodegenerative disease are not brain specific and comprises, consists of or consists essentially of sequences set forth in SEQ ID Nos. 501, 502, 503, 506 or combinations thereof (Table 5B). In exemplary embodiments, chronic neurodegenerative disease include buy are not limited to any one or more of Alzheimer's disease (AD) and other dementias, Parkinson's disease (PD) and PD-related disorders, Prion disease, Motor neurone diseases (MND), Huntington's Disease (HD), Spinocerebellar ataxia (SCA), spinal muscular atrophy (SMA) or combinations thereof. In some embodiments, change in citrullination refers to differentially present citrullination as defined herein.
[0074] Provided herein is a method for diagnosing acquired brain injury in a subject in need thereof. The method includes obtaining a biological sample from a subject in need of a diagnosis and detecting citrullinated protein or citrullinated peptide in the biological sample obtained from the said subject. In some embodiments, presence of citrullinated proteins or citrullinated peptides is indicative of acquired brain injury. In some embodiments a change in the level of the citrullinated protein or the citrullinated peptide relative to a reference value is indicative of acquired brain injury. In one embodiment, an increase in the levels of citrullination of protein or citrullination of peptide relative to a reference value is indicative of acquired brain injury. In one embodiment, a decrease in the levels of citrullination of protein or citrullination of peptide relative to a reference value is indicative of acquired brain injury. In a further embodiment, the subject has acquired brain injury or is at increased risk of having acquired brain injury if the sample from the subject has a change in citrullination in any one or more of the peptides having the sequence set forth in any one or more of SEQ ID NO.: 125, SEQ ID NO.: 265, SEQ ID NO.: 285, SEQ ID NO.: 505, SEQ ID NO.: 506, SEQ ID NO.: 507, SEQ ID NO.: 508, SEQ ID NO.: 509, SEQ ID NO.: 510, SEQ ID NO.: 511, SEQ ID NO.: 512, SEQ ID NO.: 513, SEQ ID NO.: 514, SEQ ID NO.: 515, SEQ ID NO.: 516, SEQ ID NO.: 517, SEQ ID NO.: 518, SEQ ID NO.: 519, SEQ ID NO.: 520, SEQ ID NO.: 521, SEQ ID NO.: 522, SEQ ID NO.: 523, SEQ ID NO.: 524, SEQ ID NO.: 525, SEQ ID NO.: 526, SEQ ID NO.: 527, SEQ ID NO.: 528, SEQ ID NO.: 529, SEQ ID NO.: 530, SEQ ID NO.: 531, SEQ ID NO.: 532, SEQ ID NO.: 533, SEQ ID NO.: 534, SEQ ID NO.: 535, SEQ ID NO.: 536, SEQ ID NO.: 537, SEQ ID NO.: 538, SEQ ID NO.: 539, SEQ ID NO.: 540, SEQ ID NO.: 541, SEQ ID NO.: 542, SEQ ID NO.: 543, SEQ ID NO.: 544, SEQ ID NO.: 545, SEQ ID NO.: 546, SEQ ID NO.: 547 or combinations thereof. In a further embodiment, the subject has acquired brain injury or is at increased risk of having acquired brain injury if the sample from the subject has a change in citrullination in any one or more of the peptides having the sequence set forth in Tables 6A and/or 6B. In exemplary embodiments, each of the citrullinated peptide sequence in the sample obtained from the subject is at least 95%, 90%, 80%, 70% or 60% identical to the sequences set forth in any of Tables 6A and/or 6B. In exemplary embodiments, acquired brain injury includes but is not limited to traumatic brain injuries (TBI's), strokes, brain illness, tumor, hemorrhage, and any other kind of brain injury acquired after birth. In some embodiments, change in citrullination refers to differentially present citrullination as defined herein.
[0075] Provided herein is a method for diagnosing chronic brain disease in a subject in need thereof. The method includes obtaining a biological sample from a subject in need of a diagnosis and detecting citrullinated protein or citrullinated peptide in the biological sample obtained from the said subject. In some embodiments, presence of citrullinated proteins or citrullinated peptides is indicative of chronic brain disease. In some embodiments a change in the level of the citrullinated protein or the citrullinated peptide relative to a reference value is indicative of chronic brain disease. In one embodiment, an increase in the levels of citrullination of protein or citrullination of peptide relative to a reference value is indicative of chronic brain disease. In one embodiment, a decrease in the levels of citrullination of protein or citrullination of peptide relative to a reference value is indicative of chronic brain disease. In one embodiment, the subject has chronic brain disease or is at increased risk of having chronic brain disease if the sample from the subject has a change in citrullination in any one or more of the secreted proteins in Table 7. In one embodiment, the subject has chronic brain disease or is at increased risk of having chronic brain disease if the sample from the subject has a change in citrullination in any one or more of the non-secreted proteins in Table 8. In a further embodiment, the subject has chronic brain disease or is at increased risk of having chronic brain disease if the sample from the subject has a change in citrullination in any one or more of secreted proteins selected from Syntaxin-binding protein 1 or citrullinated fragments thereof, Histone H4 or citrullinated fragments thereof, Cytoplasmic dynein 1 heavy chain 1 or citrullinated fragments thereof, Dynamin-1 or citrullinated fragments thereof, Gamma-enolase or citrullinated fragments thereof, Endoplasmin precursor or citrullinated fragments thereof, Heat shock 70 kDa protein 12A or citrullinated fragments thereof, Serine/threonine-protein phosphatase PP1-alpha catalytic subunit or citrullinated fragments thereof, Calreticulin precursor or citrullinated fragments thereof, Coronin-1A or citrullinated fragments thereof, Electron transfer flavoprotein subunit beta or citrullinated fragments thereof, Hemoglobin subunit beta or citrullinated fragments thereof, Mitogen-activated protein kinase 1 or citrullinated fragments thereof, Mitogen-activated protein kinase 3 or citrullinated fragments thereof, 26S proteasome non-ATPase regulatory subunit 12 or citrullinated fragments thereof, 60S ribosomal protein L4 or citrullinated fragments thereof, 60S acidic ribosomal protein P2 or citrullinated fragments thereof, Septin-7 or citrullinated fragments thereof, Alanine-tRNA ligase, cytoplasmic or citrullinated fragments thereof or combinations thereof. In a further embodiment, the subject has chronic brain disease or is at increased risk of having chronic brain disease if the sample from the subject has a change in citrullination in any one or more of non-secreted proteins selected from Synapsin-1 or citrullinated fragments thereof, Aconitate hydratase or citrullinated fragments thereof, Complexin-1 or citrullinated fragments thereof, Complexin-2 or citrullinated fragments thereof, Band 4.1-like protein 3 or citrullinated fragments thereof, Synapsin-2 or citrullinated fragments thereof, AP2-associated protein kinase 1 or citrullinated fragments thereof, Alpha-adducin or citrullinated fragments thereof, AP-2 complex subunit beta or citrullinated fragments thereof, Serine/threonine-protein kinase DCLK1 or citrullinated fragments thereof, Glutaminase kidney isoform or citrullinated fragments thereof, Isocitrate dehydrogenase [NAD] subunit alpha or citrullinated fragments thereof, Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform or citrullinated fragments thereof or combinations thereof. In some embodiments, change in citrullination refers to differentially present citrullination as defined herein.
[0076] Provided herein is a method for diagnosing acute brain disease in a subject in need thereof. The method includes obtaining a biological sample from a subject in need of a diagnosis and detecting citrullinated protein or citrullinated peptide in the biological sample obtained from the said subject. In some embodiments, presence of citrullinated proteins or citrullinated peptides is indicative of acute brain disease. In some embodiments a change in the level of the citrullinated protein or the citrullinated peptide relative to a reference value is indicative of acute brain disease. In one embodiment, an increase in the levels of citrullination of protein or citrullination of peptide relative to a reference value is indicative of acute brain disease. In one embodiment, a decrease in the levels of citrullination of protein or citrullination of peptide relative to a reference value is indicative of acute brain disease. In one embodiment, the subject has acute brain disease or is at increased risk of having acute brain disease if the sample from the subject has a change in citrullination in any one or more of the secreted proteins in Table 9. In one embodiment, the subject has acute brain disease or is at increased risk of having acute brain disease if the sample from the subject has a change in citrullination in any one or more of the non-secreted proteins in Table 10. In a further embodiment, the subject has acute brain disease or is at increased risk of having acute brain disease if the sample from the subject has a change in citrullination in any one or more of secreted proteins selected from Cullin-associated NEDD8-dissociated protein 1 or citrullinated fragments thereof, Peroxiredoxin-5 or citrullinated fragments thereof or combinations thereof. In a further embodiment, the subject has acute brain disease or is at increased risk of having acute brain disease if the sample from the subject has an increase in citrullination Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3 precursor or citrullinated fragments thereof. In some embodiments, change in citrullination refers to differentially present citrullination as defined herein.
[0077] Also provided herein are methods for treating neurodegenerative diseases in a subject in need thereof. The methods include diagnosing a neurodegenerative disease by the methods set forth herein and administering an effective amount of a therapeutic agent to the subject diagnosed with the neurodegenerative disease so as to treat neurodegenerative disease in the subject. In exemplary embodiments, examples of neurodegenerative diseases include but are not limited to Alzheimer disease, Parkinson disease, Lewy body dementia, frontotemporal dementia, amyotrophic lateral sclerosis, Huntington disease, Friedreich's ataxia, spinal muscular atrophy, prion diseases, multiple sclerosis, stroke, degenerative nerve diseases, encephalitis or Creutzfeld-Jacob disease. In various embodiments, treatments include but are not limited to any one or more of therapeutic lifestyle changes, therapeutic agents, surgical treatments or a combination thereof. In exemplary embodiments, lifestyle changes include any one or more of healthy diet, physical activity, weight management, stress management, not smoking or a combination thereof.
[0078] In exemplary embodiments, therapeutic agents for Alzheimer's disease include but are not limited to cholinesterase inhibitors (such as Donepezil, Rivastigmine, Galantamine), memantine (Namenda), Vitamin E, alternative treatments (for example, Caprylic acid and coconut oil, Concerns, Coenzyme Q10, Coral calcium, Ginkgo biloba, Huperzine A, Omega-3 fatty acids, Phosphatidylserine, Tramiprosate), or combinations thereof. Appropriate therapies and dosages will be apparent to one skilled in the art.
[0079] In exemplary embodiments, therapeutic agents for Parkinson's disease include but are not limited to carbidopa/levodopa, dopamine agonists, monoamine oxidase inhibitors, anticholinergics, surgery, lifestyle changes, alternative treatments (for example, Antioxidants Vitamin C and E, the Mediterranean Diet, Calcium and Vitamin D, Coenzyme Q10, Folate (Folic Acid), Ginger (Zingiber Officinalis), Gingko Biloba, Green Tea Polyphenols (GTPs), Milk Thistle (Silybum Marianum), St. John's Wort (Hypericum Perforatum), Vitamin B12) or combinations thereof. Appropriate therapies and dosages will be apparent to one skilled in the art.
[0080] In exemplary embodiments, treatments for Huntinton's disease include therapeutic agents and therapies including psychotherapy, speech therapy, physical therapy, occupation therapy or combinations thereof. Exemplary, therapeutic agents for Huntington's disease include but are not limited to Tetrabenazine (Xenazine), Antipsychotic drugs, (such as haloperidol (Haldol)), amantadine, levetiracetam (Keppra), clonazepam (Klonopin) or combinations thereof. Appropriate therapies and dosages will be apparent to one skilled in the art.
[0081] In exemplary embodiments, therapeutic agents for ataxia include but are not limited to riluzole, antiglutaminergic medication, nicotine receptor agonists, serotonergic therapy, GABAergic therapy, cholinergic therapy, channel stabilizing treatments (such as carbonic anhydrase inhibitors), insulin-like growth factors, supplements (such as Vitamin E) or combinations thereof. Appropriate therapies and dosages will be apparent to one skilled in the art.
[0082] In exemplary embodiments, treatments for spinal muscular atrophy include proper nutrition, therapeutic agents and therapies including psychotherapy, speech therapy, physical therapy, occupation therapy or combinations thereof. Therapeutic agents for spinal muscular atrophy include but are not limited to muscle relaxants such as baclofen, tizanidine, and the benzodiazepines to reduce spasticity, Botulinum toxin to treat jaw spasms or drooling, amitriptyline, glycopyolate, and atropine or by botulinum injections into the salivary glands to treat excessive saliva, antidepressants to treat depression. Appropriate therapies and dosages will be apparent to one skilled in the art.
[0083] In exemplary embodiments, therapeutic agents for prion disease include but are not limited to quinacrine, pentosan polysulfate (PPS), tetracyclic compounds or combinations thereof.
[0084] In various embodiments of the processes, assays and methods described herein, the reference value is based on the change in the level of citrullinated proteins or citrullinated peptides as set forth in, for example Tables 2-10. In one embodiment, the change in the level of citrullinated proteins or citrullinated peptides is in a neuronal cell. In another embodiment, the change in the level of citrullinated proteins or citrullinated peptides is in a non-neuronal cell. In an additional embodiment, the change in the level of citrullinated proteins or citrullinated peptides is in any cell. In an additional embodiment, the change in the level of citrullinated proteins or citrullinated peptides is in any bodily fluid. In some embodiments, the reference value is the mean or median expression level of citrullinated proteins or citrullinated peptides in a population of subjects that do not have neurodegenerative disease. In other embodiments, the reference value is the mean or median expression level of citrullinated proteins or citrullinated peptides in a population of subjects that have neurodegenerative diseases but have undergone treatment and show no or reduced expression of citrullinated proteins or citrullinated peptides. In additional embodiments, the reference value is the expression level of citrullinated proteins or citrullinated peptides in a sample obtained from the subject from a different (for example, an earlier) time point, such as during diagnosis of neurodegenerative disease, before treatment of neurodegenerative disease, after treatment of neurodegenerative disease or a combination thereof. In exemplary embodiments, neurodegenerative diseases include but are not limited to ALS, Alzheimer's disease, brain stroke, chronic brain disease, acute brain disease or combinations thereof. In some embodiments, change in citrullination refers to differentially present citrullination as defined herein.
[0085] In various embodiments, the expression level of citrullinated proteins or citrullinated peptides in the subject having or suspected of having neurodegenerative disease compared to the reference value is increased by at least or about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100%. In various embodiments, the expression level of citrullinated proteins or citrullinated peptides in the subject having or suspected of having neurodegenerative disease compared to the reference value is increased by at least or about 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, 15-fold, 20-fold, 25-fold, 30-fold, 35-fold, 40-fold, 45-fold, 50-fold, 55-fold, 60-fold, 65-fold, 70-fold, 75-fold, 80-fold, 85-fold, 90-fold, 95-fold, 100-fold or a combination thereof. In exemplary embodiments, neurodegenerative diseases include but are not limited to ALS, Alzheimer's disease, brain stroke, chronic brain disease, acute brain disease or combinations thereof.
[0086] In various embodiments, the expression level of citrullinated proteins or citrullinated peptides in the subject having or suspected of having neurodegenerative disease compared to the reference value is decreased by at least or about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100%. In various embodiments, the expression level of citrullinated proteins or citrullinated peptides in the subject having or suspected of having neurodegenerative disease compared to the reference value is decreased by at least or about 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, 15-fold, 20-fold, 25-fold, 30-fold, 35-fold, 40-fold, 45-fold, 50-fold, 55-fold, 60-fold, 65-fold, 70-fold, 75-fold, 80-fold, 85-fold, 90-fold, 95-fold, 100-fold or a combination thereof. In exemplary embodiments, neurodegenerative diseases include but are not limited to ALS, Alzheimer's disease, brain stroke, chronic brain disease, acute brain disease or combinations thereof.
Example 1: Experimental Methods
Reagents and Materials
[0087] The following reagents were obtained: rabbit skeletal muscle PAD cocktail (PAD) (SignalChem); PAD2 (Sigma), heavy meromyosin (HMM), tropomyosin (TM) (Sigma); F-actin (Cytoskeleton. Inc), cardiac troponin (TnI) (Abcam), anti-modified citrulline antibody (Millipore); sequencing grade Lys-C protease (WAKO), and protease inhibitor cocktail (Roche).
Human Heart Tissue
[0088] Left ventricular tissue samples were obtained from Cris Dos Remedios, University of Sydney, Australia after informed consent and with approval of the local Ethical Committee. The samples were acquired during heart transplantation surgery, from patients with HF (Ischemic Heart Disease (ISHD) and Idiopathic Cardiomyopathy (IDCM), n=10 each) and non-failing donor hearts (n=10) as previously described [Zhang P et al. Multiple reaction monitoring to identify site-specific troponin I phosphorylated residues in the failing human heart. Circulation 2012, 126:1828-1837].
Mouse Heart Tissue and Neonatal Myocytes
[0089] Male C57BL/6 mice (n=3) (5 days old neonatal mice, Jackson Laboratories) were obtained. Animal study was approved by The Johns Hopkins University Animal Care and Use Committee and followed established NIH guidelines. Briefly, Primary cultured ventricular myocytes were isolated from neonatal mice. Collagenase-digested isolated myocytes were incubated in buffer with increasing concentrations of Ca.sup.2+, achieving a final concentration of 1.2 mM Ca.sup.2+ as in the MEM culture media. Cells were seeded at 25,000 rod-shaped myocytes/ml on 6-well plates or 60-mm dishes coated with laminin. After 1 hour incubation in 37 C., 5% CO.sub.2, the culture media was replaced to remove unattached cells.
Protein Extraction and SWATH MS
[0090] Hearts were fractionated into myofilament- and cytosolic-enriched fractions using the IN Sequence protocol [Kane L A et al. Subfractionation of heart tissue: the in sequence myofilament protein extraction of myocardial tissue. Methods Mol Biol 2007, 357:87-90]. Protein extraction and generation of LysC peptides from subfractions was performed using a filter-aided sample preparation (FASP) protocol [24]. When needed recombinant proteins or the In Sequence fractions were incubated with PAD's cocktail at a ratio of 1:20 for 2 hr. at 37 C. in 100 mM Tris, pH 7.6, 5 mM DTT, 10 mM CaCl.sub.2. The reaction was stopped by addition of 5 mM EDTA prior to digestion. A Triple TOF 6600 mass spectrometer (Sciex) was used for both data dependent acquisition to build peptide spectral ion library and SWATH-MS (data independent acquisition) for each individual sample analysis. The raw data was searched with ProteinPilot Software 5.0 to create a spectral ion library. Individual SWATH-MS runs were matched against the spectral library created in the presence or absence of PAD (plus and minus PAD) for both the myofilament- and cytosolic-enriched protein fractions (see Data Supplement).
Preparation of Citrullinated Samples
[0091] Recombinant proteins and the fractions obtained from IN Sequence were incubated with PAD2 at a ratio of 1:20 for 2 hr. at 37 C. in working buffer (100 mM Tris, pH 7.6, 5 mM DTT, 10 mM CaCl.sub.2). The reaction was stopped by addition of 5 mM EDTA.
Statistical Validation Peptides, Proteins and Citrullination Residues: Acceptance Criteria.
[0092] Bioinformatics Analysis was performed with the workflow described in data supplement. The peptide normalization used in this study was based on the iRT peptide retention time [Escher C, et al. Using iRT, a normalized retention time for more targeted measurement of peptides. Proteomics 2012, 12:1111-1121] and normalized values were used for downstream analysis. Ensemble protein ID accession numbers were mapped back to their associated encoding Ensemble gene entries. Data analysis and mining were performed using iProXpress (http://proteininformationresource.org/iproxpress2) [Natale D A et al. Protein Ontology: a controlled structured network of protein entities. Nucleic Acids Res 2014, 42:D415-421] and Cytoscape [Saito R et al. A travel guide to Cytoscape plugins. Nat Methods 2012, 9:1069-1076]. The Kruskal-Wallis test (non-parametric one way ANOVA) for each peptide was used to calculate p-values. The significance of the biochemical changes was determined by performing a t-test (p<0.05) on the differences for all paired data. Unless otherwise stated all biochemical assays were replicated three times.
SDS-PAGE Immunoblot for Citrullination
[0093] A 1:2000 diluted of the anti-citrulline (Modified) antibody was used for the 1 DE western blot (see Data Supplement).
Two-Dimensional Gel Electrophoresis (2DE)
[0094] The independent verification of proteomics data was performed with fluorescence 2DE gel electrophoresis (2D-DIGE, pI range and SDS PAGE range) as reported previously [Matt P et al. Biomarker discovery: proteome fractionation and separation in biological samples. Physiol Genomics 2008, 33:12-17]. The treatment of sample with PAD2 enzyme, which removes a guanidino group from specific arginine residues within the modified protein, can be used to identify citrullinated proteins based on the change in charge of the protein after treatment (see Data Supplement).
Membrane-Permeabilized Myocytes
[0095] Left ventricular tissue from C57BL/6 mice was flash frozen in liquid nitrogen and stored at 80 C. For analysis, tissue was homogenized in the presence of 0.3% Triton X-100, and protease and phosphatase inhibitors, as described [Kirk J A et al. Cardiac resynchronization sensitizes the sarcomere to calcium by reactivating GSK-3beta. J Clin Invest. 2014, 1:129-38]. Myocytes were washed without Triton X-100 to remove the detergent, and resuspended in isolation buffer. PAD2 was activated in 10 mM Ca.sup.2+ and 50 mM DTT for 60 minutes at 37 C. PAD2 treated myocytes were then exposed to a 1:10 dilution of activated PAD2 in isolation buffer for 30 minutes at room temperature. Myocytes were then glued with silicone to the tips of 150 m diameter minutia pins attached to a force transducer and motor arm (Aurora Scientific Inc., Aurora, ON, Canada). Sarcomere length was monitored by video camera (Imperx, Boca Raton, Fla.) and calculated by the High-speed Video Sarcomere Length Program (Aurora Scientific Inc.). Myocyte sarcomere length was set at 2.1 m. A complete activation of the myocyte occurred at the beginning and end of the experiment, and the myocyte discarded if there was >10% rundown, as described [Kirk J A et al. Cardiac resynchronization sensitizes the sarcomere to calcium by reactivating GSK-3beta. J Clin Invest. 2014, 1:129-38].
ATPase Activity
[0096] The HMM-ATPase activity was analyzed at three separate experiments described previously [White H D. Special instrumentation and techniques for kinetic studies of contractile systems. Methods Enzymol 1982, 85:698-708; Tauhata S B, et al. High affinity binding of brain myosin-Va to F-actin induced by calcium in the presence of ATP. J Biol Chem 2001, 276:39812-39818]. First experiment was carried at constant HMM and F-actin concentration with citrullinated or non-citrullinated HMM and/or F-actin. Second, HMM-ATPase activity was determined at increasing TM concentrations (citrullinated or non-citrullinated). Third experiment HMM-ATPase activity was determined at constant HMM, F-actin and TM concentration with citrullinated or non-citrullinated TnI. Each experiment was done in triplicate and three separate times.
Actin Binding Experiments
[0097] Various concentrations of citrullinated and non-citrullinated HMM, TM and/or TnI were added to F-actin and centrifuged to determine extent of binding. Pellet and supernatant were analyzed using 10% SDS PAGE, and amount of each protein quantified by densitometry as previously described [Skorzewski R et al. Effect of actin C-terminal modification on tropomyosin isoforms binding and thin filament regulation. Biochim Biophys Acta 2009, 2: 237-243; Nascimento A A et al. Enzymatic characterization and functional domain mapping of brain myosin-V. J Biol Chem 1996, 271:17561-17569]. Each assay was carried out in triplicate.
Reverse Transcription-Polymerase Chain Reaction (RT-PCR)
[0098] Total mRNA from mouse neonatal cardiac myocytes was extracted using TRI-reagent (Sigma) according to the manufacturer's protocols. Complementary DNA (cDNA) was generated using the SuperScript III First-Standard Synthesis System (Invitrogen) according to the instructions of the manufacturer. RT-PCR was performed using primers specific for the PAD1, PAD2, PAD3, PAD4 and -actin. The PCR products were separated by electrophoresis on a 1.8% agarose gel and visualized under UV light. Each assay was done in duplicate.
1D-PAGE and Western Blot
[0099] Proteins 10 ug per well were separated by 1D-PAGE using 12-well 4-12% NuPAGE Bis-Tris gels and blotted onto PVDF membranes according to manufacturer's instruction. After staining the blotted membrane with Direct Blue followed by scanning images, membranes were incubated with modification reagent [1 vol of 1% diacetyl monoxime/0.5% antipyrine/1 N acetic acid, and 2 vol of a mixture of 85% H.sub.3PO.sub.4/98% H.sub.2SO.sub.4/H.sub.2O (20/25/55) containing 0.025% FeCl.sub.3] overnight at 37 C., protected from light. The membrane was blocked, probed overnight at 4 C. with an anti-modified citrulline antibody at 1:2000 (Millipore, Billerica, Mass.) and followed by washes incubated with the secondary antibody for 1 hour (goat polyclonal antirabbit IgG, 1:10000 dilution). Bound antibodies were visualized by chemiluminescent substrate as described by the manufacturer (Amersham Biosciences, Piscataway, N.J.). When developed, films were scanned with Epson Expression 10000 XL scanner (Epson, US) and imported into GraphPad Prism tools. A student's t-test was used to determine statistical difference between the groups. A p-value<0.05 was considered statistically significant.
Sample Deimination, Cy Labeling, 2-DE Separation
[0100] Heart samples, weighing approximately 150 mg, were subfractionated as described earlier. For deimination of each fraction was treated with 1.5 mg bacterial PAD2 in 200 mM Tris-HCl pH 7.5/10 mM dithiothreitol (DTT)/20 mM CaCl.sub.2 in a total volume of 100 uL. The same amount of each sample was treated at the same condition but without enzyme. After incubating the samples at 50 C. for 2 hours samples were mixed with DIGE labeling buffer (7 M urea/2 M thiourea/4% CHAPS/30 mM Tris pH 8.5) at a final concentration of 70 ug/110 uL. Cy dyes were added (3200 pmol/400 mg aliquot) and aliquots were incubated at RT in the dark for 30 min. Reactions were stopped by adding 1 mL 10 mM lysine per 400 pmol dye. Pooled standard was labeled with Cy2, samples no PAD2 treated were labeled with Cy3, and samples treated with PAD2 were labeled with Cy5. A 150 ug aliquot of pooled standard, sample +PAD2 and samplePAD2, labeled as stated above, were mixed together and diluted in IEF buffer (7 M urea/2 M thiourea/4% CHAPS/1% DTT/1% 3-10 ampholytes) to final volume 350 ul. Prepared samples were applied to 18 cm immobilized linear pH gradients (4-7) strips (IPG, BioRad), with active rehydration for 12 h at 20 C. For isoelectrofocusing (IEF), the BioRad Protean IEF cell was used with the following conditions at 20 C.: Step 1:1 hr with end voltage at 200 V; Step 2: 1 h ramping with end voltage at 500 V; Step 3: 1 hr with end voltage 500V; Step 4: 1 hr ramping with end voltage at 1000 V; Step 5: 2 hr with end voltage 1000V; Step 6: 2 hrs. ramping with end voltage at 1000 V; Step 7: 50000V/h (approximately 6 hrs). After IEF, the strips were equilibrated according to the manufacturer's instructions. Second dimension of 2-DE was then carried out with 10% gels and electrophoresed at constant voltage (80 V) for 30-60 min, followed by constant power (200V, 200 mA) for 6 hours. The DIGE gels were scanned using a Typhoon 9410 (GE Healthcare) at different emission wavelengths, which allows the differentially expressed proteins to be viewed as changed in color. Preparative gels were stained with silver staining and scanned with the Typhoon 9410.
Image Analysis
[0101] Small gels were scanned using an Epson Expression 10000 XL (Epson America), and large gels were scanned using an Amersham Typhoon 9410 (GE Healthcare). Differentially expressed proteins (treated vs. no treated with PAD2) were identified using Ludesi REDFIN analysis (Ludesi, http://www.ludesi.com) for spot detection, matching, and analysis. Ludesi REDFIN analysis was performed in two steps: differential in-gel analysis (DIA) followed by biological variation analysis (BVA). DIA quantifies protein volume from fluorescence intensity for Cy2, Cy3 and Cy5 and calculates the ratios Cy3/Cy2 (no PAD2 treated to internal standard) and Cy5/Cy2 (PAD2 treated to internal standard). Values are then normalized based on the assumption that the amount of protein per image is the same. 2-DE gel images were analyzed in REDFINA (http://www.ludesi.com) using student's t-test to determine statistical difference between the groups. A p-value<0.05 was considered statistically significant. Spots of interest were then excised from gel, destined and in-gel digested with trypsin. Digested samples were used for LC-MS/MS analysis as described below.
In-Gel Protein Digestion and Peptide Identification
[0102] Spots of interest were picked out from the gels with a shortened pipette tip, placed in small eppendorf tubes and distained by using a 30 mM potassium ferricyanide and 100 mM sodium thiosulfate. After a further washing with bi-distilled water, gel plugs were dried and rehydrated directly in reducing and alkylate reagent follow by digestion of 0.1 g/l trypsin in 50 mM NH.sub.4HCO.sub.3 pH 8.8 solution (Trypsin ultra grade sequencing grade, Promega, WI, USA). Digestion was performed 1 hr on ice; next the extra solution was removed and gel plugs were cover with 100 ul 50 mM NH.sub.4HCO.sub.3 and incubate overnight at 37 C. Peptides were desalted by ZipTip and analyzed by nanoflow LC-MS/MS by using an LTQ ion trap MS (Thermo Fisher Scientific) interfaced with an Agilent 1200 nanoLC system.
Mass Spectrometry
[0103] Each human heart was fractionated into myofilament- and cytosolic-enriched fractions using IN Sequence protocol [Kane L A, et al. Subfractionation of heart tissue: the in sequence myofilament protein extraction of myocardial tissue. Methods Mol Biol 200, 357:87-90]. Protein extracts were denatured, reduced and alkylated prior to digestion with LysC (1:20) using a filter-aided sample preparation (FASP) protocol (https://www.biochem.mpg.de/226356/FASP). Exogenous internal retention time standards (IRT, company and reference [Escher C, et al. Using iRT, a normalized retention time for more targeted measurement of peptides. Proteomics 2012, 12:1111-1121]) were added to each peptide fraction. To maximize the citrullinated proteome depth in vitro citrulllination, using PADs cocktail, of cardiac tissue lysates was performed followed by the proteins digestion with LysC. Spectral ion libraries were constructed by data dependent acquisition on an AB Sciex 6600 TripleTOF and the raw data was searched with ProteinPilot Software 5.0 to create a spectral ion library. The two fractions from each individual were sequentially analyzed using data independent acquisition (SWATH-MS) on the 6600 Triple TOF. The peptide data were kept for further analysis if they contained at least one high confidence citrulline-peptide/spectrum assignment (>95% confidence) and the confidence level of the protein to which it mapped was >95%. Peptide and ProteinProphet thresholds, the global false discovery rates for this study, obtained from a search of the reversed human database, were estimated to be on the order of <0.1% at the peptide and protein levels respectively. Importantly, transitions of each citrullinated peptide were selected and verified to provide accurate sensitivity and specificity for these targeted proteomics experiments. SWATH-MS fragment ion maps were created (from the endogenous samples) between 400-1250 m/z using 200 variable SWATH windows with a dwell time of 20 ms for each window. Source conditions were as follows for DDA and SWATH experiments: Spray voltage was set to 2.4 kV, source gas was set to 5, curtain gas was set to 30, interface heater temperature was set to 80, and declustering potential was set to 100. Rolling collision energy was used for MS2 experiments in the DDA runs. For both DDA and SWATH runs peptides were separated using an Eksigent Ekspert 415 nanoLC equipped with Ekspert cHiPLC and Ekspert nanoLC 400 autosampler. Samples were loaded onto a trap column (nano cHiPLC Trap 200 m0.5 mm ChromXP C18-CL 3 m 120 ) for 10 minutes at a flow rate of 2 L/min in 100% solvent A (0.1% formic acid in water) after which point they were separated using a nano cHiPLC 75 m15 cm ChromXP C18-CL 3 m 120 column using a flow rate of 300 nL/min and a linear gradient of 5-35% solvent B (0.1% formic acid in acetonitrile) for 120 min, 35-85% B for 2 minutes, holding at 85% for 5 minutes, then re-equilibration at 5% B for 17 minutes.
Construction of a Verified Citrullinated Spectral Ion Library
[0104] A verified citrullinated peptide ion library was constructed based on the retention time (RT) difference between pairs of peptides that had un-modified (non-citrullinated) and citrullinated forms present in the ion library and between peptides that had N/Q deaminated and citrullinated forms. Based on our data we observed that the difference in RT between the unmodified and citrullinated form of the same peptide sequence (in the absence of any other modifications) was on average 10 minutes, with the citrullinated peptide having the longer retention time, whereas N/Q deamidation resulted in a RT shift on average of about 2.5 minutes. Therefore, for citrullinated peptide sequences that had paired unmodified forms or paired N/Q deamidation forms and the RT difference was greater than 5 minutes we did not alter the selected transition ions in the ion library. For citrullinated peptides where the RT was less than 5 minutes between the pairs or if there was no unmodified form to use as a reference we manually selected transition ions that would unambiguously distinguish the citrullinated peptide from the unmodified or N/Q deaminated form and any transitions that did not unambiguously distinguish the citrullination site were removed from the ion library. For this subset of peptides five unique transitions were required for a citrullinated peptide to be included in the library. In addition to the verified citrullinated peptides for each protein, a maximum of 10 unmodified peptides were incorporated into the library for total protein quantification.
SWATH Data Analysis
[0105] The verified ion library was imported into PeakView v2.1 and SWATH files were loaded into the SWATH microapp version 2.0. Extraction settings were as follows: 30 peptides per protein, 5 transitions per peptide, 95% peptide confidence cutoff, an FDR threshold of 1%, an XIC extraction window of 5 min and tolerance of 0.05 Da.
Co-Sedimentation Assay
[0106] Binding assays were performed by TM cosedimentation (0-2 uM) with 5 uM F-actin essentially as described earlier [Skorzewski R, et al. Effect of actin C-terminal modification on tropomyosin isoforms binding and thin filament regulation. Biochim Biophys Acta, 2009, 2:237-243], with the following modifications. Binding of TM alone was assayed in 40 mM Tris HCl, pH 7.6, 1 mM DTT, 5 mM MgCl.sub.2, and 100 mM NaCl. After mixing of all assay components, samples were incubated at room temperature for 0.5 h to ensure attainment of the steady-state. Protein mixtures were ultracentrifuged for 25 min at 60,000 rpm in Beckman rotor TLA 100.2. The composition of the proteins in pellets and the amount of free TM left in the supernatant were examined on 4-12% SDS-PAGE. The gels stained with Coomassie Blue were scanned and quantified. Intensities of SDS-gel bands of pelleted F-actin were similar. TM bound to actin was calculated as TM/actin band intensity ratio normalized to the maximum ratio reached at saturation. The concentration of unbound TM was calculated from band intensities of TM left in the supernatant.
Myosin HMM-Induced Binding of TM to F-Actin
[0107] F-actin (5 M) and TM (1 M, citrullinated or control) in 30 mM NaCl, 0.5 mM MgCl2, 1 mM DTT, 5 mM imidazole, pH 7.0, were mixed with HMM (0-3.5 M). The mixture was incubated at room temperature for 30 min and then centrifuged in a TLA-100.2 rotor for 25 min, at 60,000 rpm at 15 C. The composition of proteins sedimented in pellets was analyzed by SDS-PAGE and densitometry [Sliwinska M, et al. Role of actin C-terminus in regulation of striated muscle thin filament. Biophys J. 2008, 4:1341-].
[0108] HMM-ATPase assays. The assays were performed as described by White [White H D. Special instrumentation and techniques for kinetic studies of contractile systems. Methods Enzymol 1982, 85:698-708] with several modifications. All assays were carried out at 22 C. in a buffer containing 30 mM NaCl, 5 mM MgCl2, and 10 mM Hepes, pH 7.5 with F-actin 0.2 mg/ml and HMM 0.02 mg/ml final concentrations. When present, non-citrullinated or citrullinated TM was added to F-actin to a final molar concentrations between 0-2 M TM. HMM-Actin-TM-TnI assay was carried as above with citrullinated or not citrullinated TnI at F-actin:TM:TnI molar ration 7:1:1 respectively. To assess the sensitivity of the regulated acto-S1 system, all assays were done in parallel both in the presence (0.5 mM CaCl2) and the absence (2 mM EGTA) of calcium. All reactions were initiated by addition of 4 mM ATP. The amount of liberated phosphate was determined calorimetrically at 650 nm. All assays were carried out within the linear range and each assay was done in triplicate.
Example 2
Identification of Myocardial Citrullinated Proteins.
[0109] To identify citrullinated targets in the heart we assessed the citrullinome in three groups, ISHD, IDCM and non-failing donor hearts (n=10 per group) using SWATH-MS [34]. SWATH-MS allowed for the quantification. 53 citrullinated sites were altered with HF compared to the non-failing controls (p<0.05) and are listed in Table 1A.
TABLE-US-00001 TABLE1A Listofcitrullinatedprotein(p= 0.05)withcitrullinatedpeptidessequence. Dea isCitrullinationordeamination.CAM iscarbamidomethylation.Citrullinated proteinsweregroupedbycellularcomponent.UPidentifier= UniversalProtein (UP)ResourceproteinID;p_kw= pvalueforKruskal-Wallistest(statistic) UniProtKB Protein Peptide Accessions p_kw Adenylatekinase RGETSGR[Dea]VDDNEETIK(SEQIDNO:1) Q5T9B7 0.03 isoenzyme1 Alcoholdehydrogenase1B AAGAAR[Dea]IIAVDINK(SEQIDNO:2) ADH1B 0.04 Beta-enolase SPDDPAR[Dea]HITGEK(SEQIDNO:3) ENOB 0.00 Carbonicanhydrase3 DIR[Dea]HDPSLQPWSVSYDGGSAK(SEQIDNO:4) CAH3 0.01 Fattyacid-binding LILTLTHGTAVC[CAM]TR[Dea]TYEK(SEQIDNO:5) FABPH 0.04 protein,heart Peptidyl-prolylcis-trans TAENFR[Dea]ALSTGEK(SEQIDNO:6) PPIA 0.01 isomeraseA Serumdeprivation- FQHPGSDMR[Dea]QEK(SEQIDNO:7) SDPR 0.01 responseprotein Serumdeprivation- VSPLTFGR[Dea]K(SEQIDNO:8) SDPR 0.01 responseprotein Heatshockproteinbeta-7 RHPHTEHVQQTFR[Dea]TEIK(SEQIDNO:9) HSPB7 0.05 Alpha-crystallinBchain GLSEMR[Dea]LEK(SEQIDNO:10) CRYAB 0.01 Actin* C[CAM]DIDIR[Dea]K(SEQIDNO:11) ACTA1 >0.05 Actin* QEYDEAGPSIVHR[Dea]K(SEQIDNO:12) ACTA2 >0.05 Filamin-C SSSSR[Dea]GSSYSSIPK(SEQIDNO:13) FLNC 0.03 LIMdomain-bindingprotein3 TSPEGAR[Dea]DLLGPK(SEQIDNO:14) LDB3 0.00 Myosin-bindingproteinC, EPVFIPR[Dea]PGITYEPPNYK(SEQIDNO:15) A8MXZ9 0.03 cardiac-type Myozenin-2 R[Dea]VATPFGGFEK(SEQIDNO:16) MYOZ2 0.01 Myozenin-2 AELPDYR[Dea]SFNR[Dea]VATPFGGFEK(SEQIDNO:17) MYOZ2 0.02 TroponinI,cardiacmuscle NIDALSGMEGR[Dea]K(SEQIDNO:18) TNNI3 0.02 TroponinI,cardiacmuscle ESLDLR[Dea]AHLK(SEQIDNO:19) TNNI3 0.02 TroponinI,cardiacmuscle PR[Dea]SFMPNLVPPK(SEQIDNO:20) E7EPW4 0.01 Tropomyosin** ETR[Dea]AEFAESVTKLEK(SEQIDNO:21) TPM1 0.002 Vimentin FADLSEAAN[Dea]RNNDALR[Dea]QAK(SEQIDNO:22) VIME 0.03 Glyceraldehyde-3- LWR[Dea]D[Dhy]GRGALQN[Oxi]IIPASTGAAK G3P 0.01 phosphatedehydrogenase (SEQIDNO:23) Myosin-7 AEETQR[Dea]SVNDLTSQR[Dea]AK(SEQIDNO:24) MYH7 0.05 Aconitatehydratase, SYLR[Dea]LRPDRVAMQDATAQ[Dea]M[Oxi]AMLQFISSGLSK ACON 0.01 (SEQIDNO:25) Aconitatehydratase, ANSVR[Dea]NAVTQEFGPVPDTAR[Dea]YYK ACON 0.03 (SEQIDNO:26) Aconitatehydratase, IVYGHLDDPASQEIER[Dea]GK(SEQIDNO:27) ACON 0.03 Adenylatekinase4, LLR[Dea]AVILGPPGSGK(SEQIDNO:28) KAD4 0.00 Alcoholdehydrogenase VAGASR[Dea]IIGVDINK(SEQIDNO:29) ADHX 0.05 class-3 ATPsynthasesubunitalpha, R[Dea]TGAIVDVPVGEELLGR[Dea]VVDALGNAIDGK ATPA 0.00 (SEQIDNO:30) ATPsynthasesubunitalpha, AIEEQVAVIYAGVR[Dea]GYLDK(SEQIDNO:31) ATPA 0.01 ATPsynthasesubunitalpha, GIRPAINVGLSVSR[Dea]VGSAAQ[Dea]TRAMK ATPA 0.01 (SEQIDNO:32) ATPsynthasesubunitalpha, QGQYSPMAIEEQVAVIYAGVR[Dea]GYLDK ATPA 0.03 (SEQIDNO:33) ATPsynthase-coupling SGGPVDASSEYQQELER[Dea]ELFK(SEQIDNO:34) ATP5J 0.00 factor6 Chlorideintracellular YR[Dea]NFDIPK(SEQIDNO:35) CLIC4 0.04 channelprotein4 Cytochromec(Fragment) EER[Dea]ADLIAYLK(SEQIDNO:36) C9JFR7 0.01 Delta-1-pyrroline-5- VLR[Dea]NAAGNFYINDK(SEQIDNO:37) AL4A1 0.00 carboxylatedehydrogenase, Delta-1-pyrroline-5- AADMLSGPR[Dea]R[Dea]AEILAK(SEQIDNO:38) AL4A1 0.01 carboxylatedehydrogenase, Delta-1-pyrroline-5- VANEPVLAFTQGSPER[Dea]DALQK(SEQIDNO:39) AL4A1 0.03 carboxylatedehydrogenase, Enoyl-CoAhydratase, EMVLTGDR[Dea]SAQDAK(SEQIDNO:40) ECHM 0.01 ES1proteinhomolog, VLR[Dea]GVEVTVGHEQEEGGK(SEQIDNO:41) ES1 0.00 HeatshockproteinHSP HLEINPDHSIIETLR[Dea]QK(SEQIDNO:42) HS90A 0.04 90-alpha NAD(P)transhydrogenase, AATITPFR[Dea]K(SEQIDNO:43) NNTM 0.05 Phosphatecarrierprotein, VYFR[Dea]LPRPPPPEMPESLK(SEQIDNO:44) MPCP 0.00 Pyruvatedehydrogenase C[CAM]DLHR[Dea]LEEGPPVTTVLTR[Dea]EDGLK ODPA 0.01 E1componentsubunit (SEQIDNO:45) alpha,somaticform, Succinatedehydrogenase FAIYR[Dea]WDPDK(SEQIDNO:46) SDHB 0.05 [ubiquinone] iron-sulfur subunit, Succinyl-CoAligase TR[Dea]LIGPNC[CAM]PGVINPGEC[CAM]K SUCA 0.02 [ADP/GDP-forming] (SEQIDNO:47) subunitalpha, Succinyl-CoA:3-ketoacid ADR[Dea]AGNVIFR[Dea]K(SEQIDNO:48) SCOT1 0.04 coenzymeAtransferase1, Voltage-dependentanion- SR[Dea]VTQSNFAVGYK(SEQIDNO:49) VDAC1 0.02 selectivechannelprotein1 60kDaheatshockprotein, FDR[Dea]GYISPYFINTSK(SEQIDNO:50) CH60 0.04 Trifunctionalenzyme PNIR[Dea]NVVVVDGVR[Dea]TPFLLSGTSYK ECHB 0.02 subunitbeta, (SEQIDNO:51) Aconitatehydratase, TGR[Dea]EDIANLADEFK(SEQIDNO:52) ACON 0.00 Aconitatehydratase, R[Dea]LQLLEPFDK(SEQIDNO:53) ACON 0.01 Dualspecificityprotein LGITHVLNAAEGR[Dea]SFMHVNTNANFYK DUS3 0.01 phosphatase3 (SEQIDNO:54) Neuroblastdifferentiation- FGVSTGR[Dea]EGQTPK(SEQIDNO:55) AHNK 0.01 associatedproteinAHNAK Collagenalpha-3(VI) DVVFLLDGSEGVR[Dea]SGFPLLK(SEQIDNO:56) E7ENL6 0.03 chain
[0110] Table 1B shows all citrullinated peptides found in this study. These were proteins with diverse cellular functions, including the regulators of transcription and chromatin structure, cytoskeletal and contraction, cellular signaling processes and metabolism (
TABLE-US-00002 TABLE1B allcitrullinatedpeptidesfoundinthisstudy.Dea isCitrullinationor deamination.CAM iscarbamidomethylation. UniProtKB Protein Peptide Accessions p_kw Cysteine-richprotein2 GVNTGAVGSYIYDR(SEQIDNO:57) P52943 0.58 Adenylatekinaseisoenzyme1 RGETSGR(SEQIDNO:1) Q5T9B7 0.03 Adenylatekinaseisoenzyme1 R[Dea]GETSGR[Dea]VDDNEETIK(SEQIDNO:58) Q5T9B7 0.15 Adenylatekinaseisoenzyme1 YGYTHLSTGDLLR[Dea]SEVSSGSAR[Dea]GK(SEQIDNO:59) Q5T9B7 0.57 Adenylatekinaseisoenzyme1 LLR[Dea]SEVSSGSAR[Dea]GK(SEQIDNO:60) Q5T9B7 0.68 Adenylatekinaseisoenzyme1 YGYTHLSTGDLLR[Dea]SEVSSGSARGK(SEQIDNO:61) Q5T9B7 0.74 Alcoholdehydrogenase1B AAGAAR[Dea]IIAVDINK(SEQIDNO:2) P00325 0.04 Aldosereductase PEDPSLLEDPR[Dea]IK(SEQIDNO:62) P15121 0.18 Alpha-crystallinBchain GLSEMR[Dea]LEK(SEQIDNO:10) P02511 0.01 Alpha-crystallinBchain QVSGPER[Dea]TIPITREEK(SEQIDNO:63) P02511 0.23 Alpha-crystallinBchain YR[Dea]IPADVDPLTITSSLSDGVLTVNGPR[Dea]K P02511 0.41 (SEQIDNO:64) Alpha-crystallinBchain SPFYLR[Dea]PPSFLR[Dea]APSWFDTGLSEMRLEK P02511 0.51 (SEQIDNO:65) Alpha-crystallinBchain SPFYLRPPSFLR[Dea]APSWFDTGLSEMRLEK(SEQIDNO:66) P02511 0.55 Alpha-crystallinBchain QVSGPER[Dea]TIPITR[Dea]EEK(SEQIDNO:67) P02511 0.97 Aspartateaminotransferase, HIYLLPSGR[Dea]INVSGLTTK(SEQIDNO:68) P17174 0.84 ATP-dependent6- LLAHVR[Dea]PPVSK(SEQIDNO:69) P08237 0.53 phosphofructokinase ATP-dependent6- NVLGHMQQGGSPTPFDR[Dea]NFATK(SEQIDNO:70) P08237 0.80 phosphofructokinase ATP-dependent6- [1Ac]-MDADDSR[Dea]APK(SEQIDNO:71) Q01813 0.55 phosphofructokinase Beta-enolase SPDDPAR[Dea]HITGEK(SEQIDNO:3) P13929 0.00 Carbonicanhydrase3 DIR[Dea]HDPSLQPWSVSYDGGSAK(SEQIDNO:4) P07451 0.01 CreatinekinaseM-type ELFDPIISDR[Dea]HGGYK(SEQIDNO:72) P06732 0.20 CreatinekinaseM-type GGDDLDPNYVLSSR[Dea]VR[Dea]TGR[Dea]SIK P06732 0.36 (SEQIDNO:73) CreatinekinaseM-type PIISDR[Dea]HGGYKPTDK(SEQIDNO:74) P06732 0.47 CreatinekinaseM-type ELFDPIISDR[Dea]HGGYKPTDK(SEQIDNO:75) P06732 0.51 CreatinekinaseM-type GGDDLDPNYVLSSRVR[Dea]TGRSIK(SEQIDNO:76) P06732 0.66 CreatinekinaseM-type FEEILTR[Dea]LRLQK(SEQIDNO:77) P06732 0.82 Fattyacid-bindingprotein LILTLTHGTAVC[CAM]TR[Dea]TYEK(SEQIDNO:5) P05413 0.04 Glyceraldehyde-3-phosphate LWR[Dea]D[Dhy]GRGALQN[Oxi]IIPSTGAAK P04406 0.01 dehydrogenase (SEQIDNO:23) Glycogenphosphorylase VAIQLNDTHPALSIPELMR[Dea]ILVDVEK(SEQIDNO:78) P11216 0.39 Glycogenphosphorylase QISVR[Dea]GLAGLGDVAEVRK(SEQIDNO:79) P11216 0.63 Hemoglobinsubunitalpha LR[Dea]VDPVN[Dea]FK(SEQIDNO:80) P69905 0.91 Hemoglobinsubunitalpha VGAHAGEYGAEALER[Dea]MFLSFPT(SEQIDNO:81) P69905 0.93 Hemoglobinsubunitalpha LER[Dea]MFLSFPTTK(SEQIDNO:82) P69905 0.93 Hemoglobinsubunitalpha R[Dea]VDPVNFK(SEQIDNO:83) P69905 0.93 Hemoglobinsubunitbeta VNVDEVGGEALGRLLVVYPWTQ[Dea]R[Dea]FFESFGDLSTPDAVM P68871 0.40 [Oxi]GNPK(SEQIDNO:84) Hemoglobinsubunitbeta VNVDEVGGEALGR[Dea]LLV(SEQIDNO:85) P68871 0.46 Hemoglobinsubunitbeta VNVDEVGGEALGR[Dea]LLVVYPWTQ[Dea]RFFWSFGDLSTPDAVMGN P68871 0.67 PK(SEQIDNO:86) Hemoglobinsubunitbeta R[Dea]FFESFGDLSTPDAVMGNPK(SEQIDNO:87) P68871 0.82 Hemoglobinsubunitbeta VNVDEVGGEALGR[Dea]L(SEQIDNO:88) P68871 0.90 Peptidyl-prolylcis-trans TAENFR[Dea]ALSTGEK(SEQIDNO:6) P62937 0.01 isomeraseA Phosphatidylethanolamine- VLVLTDPDAPSR[Dea]KDPK(SEQIDNO:89) P30086 0.12 bindingprotein1 Phosphatidylethanolamine- C[CAM]DEPILSN[Dea]RSGDHR[Dea]GK(SEQIDNO:90) P30086 0.55 bindingprotein1 Phosphoglyceratekinase1 SVVLMSHLGR[Dea]PDGVPMPDK(SEQIDNO:91) P00558 0.26 Phosphoglyceratekinase1 R[Dea]VVMR[Dea]VDFNVPMK(SEQIDNO:92) P00558 0.27 Serumalbumin YLYEIARR[Dea]H[AAS]P[Oxi]YFYAPELLFFAK P02768 0.06 (SEQIDNO:93) Serumalbumin VPQVSTPTLVEVSR[Dea]N(SEQIDNO:94) P02768 0.31 Serumalbumin WAVAR[Dea]LSQR[Dea]FPK(SEQIDNO:95) P02768 0.40 Serumalbumin FGER[Dea]AFK(SEQIDNO:96) P02768 0.46 Serumalbumin RESLVNR[Dea]RPC[CAM] (SEQIDNO:97) P02768 0.49 Serumalbumin AWAVAR[Dea]LSQR[Dea]FPK(SEQIDNO:98) P02768 0.64 Serumalbumin DDNPNLPRLVR[Dea]PEVDVMC[CAM]TAFHDNEETFLK P02768 0.66 (SEQIDNO:99) Serumalbumin TPVSDR[Dea]VTK(SEQIDNO:100) P02768 0.69 Serumalbumin ALLVR[Dea]YTK(SEQIDNO:101) P02768 0.70 Serumalbumin SEVAHR[Dea]FK(SEQIDNO:102) P02768 0.72 Serumalbumin LVEVSR[Dea]NLGK(SEQIDNO:103) P02768 0.74 Serumalbumin R[Dea]MPC[CAM]AEDYLSVVLNQLC[CAM]VLHEK P02768 0.82 (SEQIDNO:104) Serumalbumin DDNPNLPR[Dea]LVR[Dea]PEVDVMC[CAM]TAFHDNEETFLK P02768 0.84 (SEQIDNO:105) Serumalbumin [CRM]-YLYEIAR[Dea]RHPYFYAPELLFFAK(SEQIDNO:106) P02768 0.93 Serumalbumin C[CAM]C[CAM]TESLVNR[Dea]RPC[CAM] (SEQIDNO:107) P02768 0.93 Serumdeprivation-response FQHPGSDMR[Dea]QEK(SEQIDNO:7) O95810 0.01 protein Serumdeprivation-response VSPLTFGR[Dea]K(SEQIDNO:8) O95810 0.01 protein Transgelin R[Dea]EFTESQLQEGK(SEQIDNO:108) Q01995 0.22 Translationally-controlled MIIYR[Dea]DLISHDEMFSDIYK(SEQIDNO:109) Q5W0H4 0.14 tumorprotein TumorproteinD54 TSAALSTVGSAISR[Dea]K(SEQIDNO:110) O43399 0.08 Malatedehydroenase FVEGLPINDFSR[Dea]EK(SEQIDNO:111) P40925 0.17 Actin,alphaskeletalmuscle C[CAM]DIDIR[Dea]K(SEQIDNO:11) Q5T8M8 0.11 Actin,alphaskeletalmuscle QEYDEAGPSIVHR[Dea]K(SEQIDNO:12) Q5T8M8 0.16 Desmin EEAENNLAAFR[Dea]ADVDAATLAR(SEQIDNO:112) P17661 0.06 Desmin SR[Dea]LGTTR[Dea]TPSSYGAGELLDFSLADAVNQEFLTTRTNEK P17661 0.08 (SEQIDNO:113) Desmin NFRETSPEQR[Dea]GSEVHTK(SEQIDNO:114) P17661 0.23 Desmin MALDVEIATYR[Dea]K(SEQIDNO:115) P17661 0.23 Desmin SR[Dea]LGTTRTPSSYGAGELLDFSLADAVNQEFLTTRTNEK P17661 0.31 (SEQIDNO:116) Desmin VDVER[Dea]DNLLDDLQRLK(SEQIDNO:117) P17661 0.39 Desmin NFR[Dea]ETSPEQR[Dea]GSEVHTK(SEQIDNO:118) P17661 0.43 Desmin TIETR[Dea]DGEVVSEATQQHEVL(SEQIDNO:119) P17661 0.55 Desmin SSPVFPR[Dea]AGFGSK(SEQIDNO:120) P17661 0.88 Desmin [1Ac]-ASGVQVADEVC[CAM]R[Dea]IFYDMK P60981 0.78 (SEQIDNO:121) Filamin-C SSSR[Dea]GSSYSSIPK(SEQIDNO:13) Q14315 0.03 FourandahalfLIMdomains EPITTGGVTYR[Dea]EQPWHK(SEQIDNO:122) Q14192 0.08 protein2 Fructose-bisphosphate ELSDIAHR[Dea]IVAPGK(SEQIDNO:123) P04075 0.55 aldolaseA Glyceraldehyde-3-phosphate LVIN[Dea]GNPITIFQER[Dea]DPSK(SEQIDNO:124) P04406 0.66 dehydrogenase Glyceraldehyde-3-phosphate R[Dea]VIISAPSADAPMFVMGVNHEK(SEQIDNO:125) P04406 0.68 dehydrogenase Glyceraldehyde-3-phosphate AFRVPTAN[Dea]VSVVDLTC[CAM]R[Dea]LEK P04406 0.88 dehydrogenase (SEQIDNO:126) Glyceraldehyde-3-phosphate VSVVDLTC[CAM]R[Dea]LEKPAK(SEQIDNO:127) P04406 0.93 dehydrogenase Glyceraldehyde-3-phosphate LWR[Dea]DGR[Dea]GALQNIIPASTGAAK(SEQIDNO:128) P04406 0.99 dehydrogenase LIMdomain-bindingprotein3 TSPEGAR[Dea]DLLGPK(SEQIDNO:14) O75112 0.00 Moesin DR[Dea]SEEER[Dea]TTEAEK(SEQIDNO:129) P26038 0.28 Myomesin-1 HVSGITDTEEER[Dea]IK(SEQIDNO:130) P52179 0.07 Myomesin-1 SPR[Dea]FALFDLAEGK(SEQIDNO:131) P52179 0.57 Myosinlightchain3 LGQNPTQAEVLR[Dea]VLGKPRQEELNTK(SEQIDNO:132) P08590 0.09 Myosinlightchain3 LGKPR[Dea]QEELNTK(SEQIDNO:133) P08590 0.16 Myosinlightchain3 [CRM]-EAFMLFDR[Dea]TPK(SEQIDNO:134) P08590 0.39 Myosinlightchain3 EAFMLFDR[Dea]TPK(SEQIDNO:135) P08590 0.41 Myosinlightchain3 VLGKPR[Dea]QEELNTK(SEQIDNO:136) P08590 0.42 Myosinlightchain3 ALGQNPTQAEVLR[Dea]VLGK(SEQIDNO:137) P08590 0.59 Myosinlightchain3 LGQNPTQAEVLR[Dea]VLGKPRQ[Dea]EELNTK P08590 0.79 (SEQIDNO:138) Myosinlightchain3 LGQNPTQAEVLR[Dea]VLGK(SEQIDNO:139) P08590 0.71 Myosinlightchain3 EAFM[Oxi]LFDR[Dea]TPK(SEQIDNO:140) P08590 0.86 Myosinlightchain4 MLDFETFLPILQHISR[Dea]NK(SEQIDNO:141) P12829 0.28 Myosinlightchain4 EQGTYEDFVEGLR[Dea]VFDK(SEQIDNO:142) P12829 0.74 Myosinregulatorylight NDLRDTFAALGR[Dea]VNVK(SEQIDNO:143) P10916 0.71 chain2 Myosinregulatorylight EAFTIMDQNR[Dea]DGFIDK(SEQIDNO:144) P10916 0.77 chain2 Myosin-7 AEETQR[Dea]SVNDLTSQR[Dea]AK(SEQIDNO:24) P12883 0.05 Myosin-7 [1Ac]-GDSEMAVFGAAAPYLR[Dea]K(SEQIDNO:145) P12883 0.18 Myosin-7 VR[Dea]ELENELEAEQK(SEQIDNO:146) P12883 0.27 Myosin-7 R[Dea]YR[Dea]ILNPAAIPEGQFIDSRK(SEQIDNO:147) P12883 0.28 Myosin-7 RNHLR[Dea]VVDSLQT(SEQIDNO:148) P12883 0.31 Myosin-7 R[Dea]VR[Dea]ELENELEAEQK(SEQIDNO:149) P12883 0.40 Myosin-7 AVFGAAAPYLR[Dea]K(SEQIDNO:150) P12883 0.42 Myosin-7 LEAR[Dea]VR[Dea]ELENELEAEQK(SEQIDNO:151) P12883 0.43 Myosin-7 YR[Dea]ILNPAAIPEGQFIDSRK(SEQIDNO:152) P12883 0.51 Myosin-7 RYR[Dea]ILNPAAIPEGQFIDSRK(SEQIDNO:153) P12883 0.52 Myosin-7 NFELNALNAR[Dea]IEDEQALGSQLQK(SEQIDNO:154) P12883 0.58 Myosin-7 AEETQRSVNDLTSQR[Dea]AK(SEQIDNO:155) P12883 0.60 Myosin-7 RSVNDLTSQR[Dea]AK(SEQIDNO:156) P12883 0.74 Myosin-7 R[Dea]VRELENELEAEQK(SEQIDNO:157) P12883 0.76 Myosin-7 YRILNPAAIPEGQFIDSR[Dea]K(SEQIDNO:158) P12883 0.81 Myosin-7 RVIQYFAVIAAIGDR[Dea]SK(SEQIDNO:159) P12883 0.86 Myosin-7 RYR[Dea]ILNPAAIPEGQFIDSR[Dea]K(SEQIDNO:160) P12883 0.96 Myosin-bindingproteinC EPVFIPR[Dea]PGITYEPPNYK(SEQIDNO:15) A8MXZ9 0.03 Myosin-bindingproteinC VRWQR[Dea]GGSDISASNK(SEQIDNO:161) A8MXZ9 0.09 Myosin-bindingproteinC PR[Dea]PQVTWTK(SEQIDNO:162) A8MXZ9 0.21 Myozenin-2 R[Dea]VATPFGGFEK(SEQIDNO:16) Q9NPC6 0.01 Myozenin-2 AELPDYR[Dea]SFNR[Dea]VATPFGGFEK(SEQIDNO:17) Q9NPC6 0.02 Phosphoglucomutase-1 SGEHDFGAAFDGDGDR[Dea]NMILGK(SEQIDNO:163) P36871 0.86 Phosphoglucomutase-1 DLEALMFDR[Dea]SFVGK(SEQIDNO:164) P36871 0.87 Plastin-2 VNDDIIVNWVNETLR[Dea]EAKK(SEQIDNO:165) P13796 0.45 Profilin-1 C[CAM]SVIR[Dea][Dea]DS[Dhy]LLQDGEFSMDLRTK P07737 0.18 (SEQIDNO:166) Titin C[CAM]DVS[Dhy]R[Dea]GDWVTALASVTK(SEQIDNO:167) Q8WZ42 0.17 Tropomyosin* ETR[Dea]AEFAERSVTKLEK(SEQIDNO:21) Z7Z596 0.002* TroponinI NIDALSGMEGR[Dea]K(SEQIDNO:18) P19429 0.02 TroponinI ESLDLR[Dea]AHLK(SEQIDNO:19) P19429 0.02 TroponinI YR[Dea]AYATEPHAK(SEQIDNO:168) P19429 0.09 TroponinI [PGQ]-QELEREAEER[Dea]R[Dea]GEK(SEQIDNO:169) P19429 0.49 TroponinT PR[Dea]SFMPNLVPPK(SEQIDNO:20) E7EPW4 0.01 TroponinT GERVDFDDIHR[Dea]K(SEQIDNO:170) E7EPW4 0.06 TroponinT EAEDGPMEESKPKPR[Dea] (SEQIDNO:171) E7EPW4 0.23 TroponinT AEAETEETR[Dea]AEEDEEEEEAK(SEQIDNO:172) A7EPW4 0.66 Tubulinalpha-1Bchain HVPR[Dea]AVFVDLEPTVIDEVR[Dea]TGTYR[Dea]QLFHPEQLITGK P68363 0.43 (SEQIDNO:173) Tubulinalpha-4Achain HVPR[Dea]AVFVDLEPTVIDEIRN[Dea]GPYRQ[Dea]LFHPEQLITGK P68366 0.26 (SEQIDNO:174) Tubulinalpha-8chain EDAANNYAR[Dea]GHYTVGK(SEQIDNO:176) C9J2C0 0.37 Vimentin FADLSEAAN[Dea]RNNDALR[Dea]QAK(SEQIDNO:22) P08670 0.03 Vimentin TVETR[Dea]DGQVINETSQHHDDLE(SEQIDNO:177) P08670 0.09 Heatshockproteinbeta-1 LATQSNEITIPVTFESR[Dea]AQLGGPEAAK(SEQIDNO:178) P04792 0.34 Heatshockproteinbeta-7 RHPHTEHVQQTFR[Dea]TEIK(SEQIDNO:9) Q9UBY9 0.05 Leucine-richPPRmotif- IPENIYRGIR[Dea]N[Dea]LLESYHVPELIK(SEQIDNO:179) P42704 0.55 containingprotein TroponinC SEEELSDLFR[Dea]MFDK(SEQIDNO:180) P63316 0.69 Alpha-1-antitrypsin ELDR[Dea]DTVFALVN[Dea]YIFFK(SEQIDNO:181) P01009 0.61 ApolipoproteinA-I [PGE]-EN[Dea]GGAR[Dea]LAEYHAK(SEQIDNO:182) P02647 0.58 ApolipoproteinA-I DSGR[Dea]DYVSQFEGSALGK(SEQIDNO:183) P02647 0.90 ApolipoproteinA-I AKPALEDLR[Dea]QGLLPVLESFK(SEQIDNO:184) P02647 0.96 Calreticulin PR[Dea]QIDNPDYK(SEQIDNO:185) P27797 0.17 Calreticulin TEREQFVEFR[Dea]DK(SEQIDNO:186) O43852 0.06 Sarcalumenin IER[Dea]AITQELPGLLGSLGLGK(SEQIDNO:187) Q86TD4 0.24 Sarcalumenin TIEGIVMAADSAR[Dea]SFSPLEK(SEQIDNO:188) Q86TD4 0.60 Decorin ISR[Dea]VDAASLK(SEQIDNO:189) P07585 0.25 Beta-2-glycoprotein1 ATVVYQGER[Dea]VK(SEQIDNO:190) P02749 0.55 CathepsinD VER[Dea]QVFGEATK(SEQIDNO:191) P07339 0.14 Lumican YLYLR[Dea]NNQIDHIDEK(SEQIDNO:192) P51884 0.66 Myoglobin ALELFR[Dea]K(SEQIDNO:193) P02144 0.11 Ubiquitincarboxyl-terminal EEDPATGTGDPPR[Dea]K(SEQIDNO:194) P45974 0.50 hydrolase5 2,4-dienoyl-CoAreductase GAFSR[Dea]LDPTGTFEK(SEQIDNO:195) B7Z6B8 0.26 28SribosomalproteinS36 PNVSEALR[Dea]SAGLPSHSSVISQHSK(SEQIDNO:196) P82909 0.29 3-ketoacyl-CoAthiolase YALQSQQR[Dea]WK(SEQIDNO:197) P42765 0.55 3-ketoacyl-CoAthiolase VSPETVDSVIMGNVLQSSSDAIYLAR[Dea]HVGLR[Dea]VGIPK P42765 0.28 (SEQIDNO:198) Acetyl-CoAacetyltransferase EVVIVSATR[Dea]TPIGSFLGSLSLLPATK(SEQIDNO:199) P24752 0.07 Aconitatehydratase SYLR[Dea]LRPDRVAMQDAT[Dhy]AQ[Dea]M[Oxi]AMLQFISSGLSK Q99798 0.01 (SEQIDNO:25) Aconitatehydratase, ANSVR[Dea]NAVTQEFGPVPDTAR[Dea]YYK(SEQIDNO:26) Q99798 0.03 Aconitatehydratase, IVYGHLDDPASQEIER[Dea]GK(SEQIDNO:27) Q99798 0.03 Aconitatehydratase SYLRLR[Dea]PDRVAMQDATAQMAMLQFISSGLSK Q99798 0.14 (SEQIDNO:200) Aconitatehydratase FR[Dea]GHLDNISNNLLIGAINIEN[Dea]GK(SEQIDNO:201) Q99798 0.19 Acyl-CoenzymeA AFTGFIVEADTPGIQGR[Dea]K(SEQIDNO:202) Q5T4U5 0.15 dehydrogenase,C-4toC-12 straightchain,isoform CRA_a Acyl-CoenzymeA FAR[Dea]EEIIPVAAEYDK(SEQIDNO:203) Q5T4U5 0.26 dehydrogenase,C-4toC-12 straightchain,isoform CRA_a Acyl-CoenzymeA TR[Dea]PVVAAGAVGLAQRALDEATK(SEQIDNO:204) Q5T4U5 0.93 dehydrogenase,C-4toC-12 straightchain,isoform CRA_a Adenylatekinase4 LLR[Dea]AVILGPPGSGK(SEQIDNO:28) P27144 0.00 Adenylatekinaseisoenzyme1 KR[Dea]GETSGR[Dea]VDDNEETIK(SEQIDNO:205) Q5T9B7 0.95 Alcoholdehydrogenase VAGASR[Dea]IIGVDINK(SEQIDNO:29) P11766 0.05 class-3 Aldehydedehydrogenase VAFTGSTEIGR[Dea]VIQVAAGSSNLK(SEQIDNO:206) P05091 0.08 Aldehydedehydrogenase SR[Dea]VVGNPFDSK(SEQIDNO:207) P05091 0.55 Aspartateaminotransferase PYVLPSVR[Dea]K(SEQIDNO:208) P00505 0.22 ATPsynthasesubunitalpha R[Dea]TGAIVDVPVGEELLGR[Dea]VVDALGNAIDGK P25705 0.00 (SEQIDNO:30) ATPsynthasesubunitalpha AIEEQVAVIYAGVR[Dea]GYLDK(SEQIDNO:31) P25705 0.01 ATPsynthasesubunitalpha GIRPAINVGLSVSR[Dea]VGSAAQ[Dea]TRAMK(SEQIDNO:32) P25705 0.01 ATPsynthasesubunitalpha QGQYSPMAIEEQVAVIYAGVR[Dea]GYLDK(SEQIDNO:33) P25705 0.03 ATPsynthasesubunitbeta IPVGPETLGRIMNVIGEPIDER[Dea]GPIK(SEQIDNO:209) P06576 0.26 ATPsynthasesubunitbeta IPVGPETLGR[Dea]IMNVIGEPIDER[Dea]GPIK(SEQIDNO:210) P06576 0.51 ATPsynthasesubunitbeta IQR[Dea]FLSQPFQVAEVFTGHMGK(SEQIDNO:211) P06576 0.70 ATPsynthasesubunitbeta AHGGYSVFAGVGERTR[Dea]EGN[Dea]DLYHEMIESGVINLK P06576 0.87 (SEQIDNO:212) ATPsynthasesubunite PRAEEER[Dea]R[Dea]IAAEEK(SEQIDNO:213) P56385 0.32 ATPsynthase-coupling SGGPVDASSEYQQELER[Dea]ELFK(SEQIDNO:34) P18859 0.00 factor6, Chlorideintracellular YR[Dea]NFDIPK(SEQIDNO:35) Q9Y696 0.04 channelprotein4 Citratesynthase SQLSAAVTALNSESN[Dea]FARAYAQGISR[Dea]TK B4DJV2 0.34 (SEQIDNO:214) Citratesynthase TVVGQITVDMMYGGMR[Dea]GMK(SEQIDNO:215) B4DJV2 0.75 CreatinekinaseB-type LR[Dea]FPAEDEFPDLSAHNNHMAK(SEQIDNO:216) P12277 0.33 CreatinekinaseB-type EVFTR[Dea]FC[CAM]TGLTQIETLFK(SEQIDNO:217) P12277 0.82 CreatinekinaseS-type, C[CAM]TR[Dea]AER[Dea]R[Dea]EVENVAITALEGLK P17540 0.31 (SEQIDNO:218) CreatinekinaseS-type, TR[Dea]AER[Dea]R[Dea]EVENVAITALEGLK P17540 0.59 (SEQIDNO:219) CreatinekinaseS-type, EVREQ[Dea]PR[Dea]LFPPSADYPDLRK(SEQIDNO:220) P17540 0.72 CytochromeC EER[Dea]ADLIAYLK(SEQIDNO:36) C9JFR7 0.01 CytochromeC KEER[Dea]ADLIAYLK(SEQIDNO:221) C9JFR7 0.01 Cytochromecoxidase EIYPYVIQELR[Dea]PTLNELGISTPEELGLDKV P20674 0.07 subunit5A, (SEQIDNO:222) Cytochromecoxidase SHGSQETDEEFDARWVTYFN[Dea]KPDIDAWELR[Dea]K P20674 0.18 subunit5A, (SEQIDNO:223) Cytochromecoxidase ASGGGVPTDEEQATGLER[Dea]FIMLAAK(SEQIDNO:224) P10606 0.49 subunit5A, Delta-1-pyrroline-5- VLR[Dea]NAAGNFYINDK(SEQIDNO:37) P30038 0.00 carboxylatedehydrogenase Delta-1-pyrroline-5- AADMLSGPR[Dea]R[Dea]AEILAK(SEQIDNO:38) P30038 0.01 carboxylatedehydrogenase Delta-1-pyrroline-5- VANEPVLAFTQGSPER[Dea]DALQK(SEQIDNO:39) P30038 0.03 carboxylatedehydrogenase Delta-1-pyrroline-5- TVIQAEIDAAAELIDFFR[Dea]FNAK(SEQIDNO:225) P30038 0.12 carboxylatedehydrogenase Dihydrolipoyldehydrotenase NFQR[Dea]ILQK(SEQIDNO:226) P09622 0.87 Electrontransfer VVVSGGR[Dea]GLK(SEQIDNO:227) P13804 0.18 flavoproteinsubunitalpha Electrontransfer VFSVR[Dea]GTSFDAAATSGGSASSEK(SEQIDNO:228) P13804 0.18 flavoproteinsubunitalpha Electrontransfer LLYDLADQLHAAVGASR[Dea]AAVDAGFVPNDMQVGQTGK P13804 0.48 flavoproteinsubunitalpha (SEQIDNO:229) Electrontransfer VEREIDGGLETLR[Dea]LK(SEQIDNO:230) P38117 0.17 flavoproteinsubunitbeta Electrontransfer LSVISVEDPPQR[Dea]TAGVK(SEQIDNO:231) P38117 0.70 flavoproteinsubunitbeta ElongationfactorTu, PFLLPVEAVYSVPGR[Dea]GTVVTGTLER[Dea]GILK P49411 0.34 (SEQIDNO:232) ElongationfactorTu, SLERAEAGDN[Dea]LGALVR[Dea]GLK(SEQIDNO:233) P49411 0.53 ElongationfactorTu, NIR[Dea]TVVTGIEMFHK(SEQIDNO:234) P49411 0.58 ElongationfactorTu, PFLLPVEAVYSVPGR[Dea]GTVVTGTLERGILK(SEQIDNO:235) P49411 0.80 ElongationfactorTu, SLERAEAGDNLGALVR[Dea]GLK(SEQIDNO:236) P49411 0.80 Enoyl-CoAhydratase, EMVLTGDR[Dea]ISAQDAK(SEQIDNO:40) P30084 0.01 Enoyl-CoAhydratase, AQFAQPEILIGTIPGAGGTQ[Dea]RLTR[Dea]AVGK(SEQIDNO:237) P30084 0.11 ES1proteinhomolog, VLR[Dea]GVEVTVGHEQEEGGK(SEQIDNO:41) P30042 0.00 Fumaratehydratase, IANDIRFLGSGPR[Dea]SGLGELILPEN[Dea]EPGSSIMPGK P07954 0.19 (SEQIDNO:238) Fumaratehydratase, YYGAQTVR[Dea]STMNFK(SEQIDNO:239) P07954 0.55 GlutathioneS-transferase DSGNKPPGLLPR[Dea]K(SEQIDNO:240) Q9Y2Q3 0.95 kappa1 GlutathioneS-transferaseP DQQEAALVDMVNDGVEDLR[Dea]C[CAM]K(SEQIDNO:241) P09211 0.63 Heatshock70kDaprotein AQIHDLVLVGGSTR[Dea]IPK(SEQIDNO:242) P08107 0.68 1A/1B Heatshock70kDaprotein DAGVIAGLNVLRIIN[Dea]EPTAAAIAYGLDR[Dea]TGK P08107 0.74 1A/1B (SEQIDNO:243) HeatshockproteinHSP HLEINPDHSIIETLR[Dea]QK(SEQIDNO:42) P07900 0.04 90-alpha HeatshockproteinHSP EQVANSAFVERVR[Dea]K(SEQIDNO:244) P08238 0.60 90-alpha Isocitratedehydrogenase ANIMR[Dea]MSDGLFLQK(SEQIDNO:245) P50213 0.84 [NAD] subunitalpha, Isocitratedehydrogenase IWYEHR[Dea]LIDDMVAQVLK(SEQIDNO:246) [48735 0.13 [NADP], Isocitratedehydrogenase SNLDR[Dea]ALGRQ(SEQIDNO:247) P48735 0.19 [NADP], Isocitratedehydrogenase ATDFVADR[Dea]AGTFK(SEQIDNO:248) P48735 0.35 [NADP], Isocitratedehydrogenase PITIGR[Dea]HAHGDQYK(SEQIDNO:249) P48735 0.58 [NADP], Isocitratedehydrogenase TIEAEAAHGTVTR[Dea]HYREHQK(SEQIDNO:250) P48735 0.73 [NADP], Ketiminereductasemu- HR[Dea]GYLGVMPAYSAAEDALTTK(SEQIDNO:251) Q14894 0.21 crystallin Ketiminereductasemu- PGAHINAVGASR[Dea]PDWR[Dea]ELDDELMK Q14894 0.49 crystallin (SEQIDNO:252) L-lactatedehydrogenaseA GEMMDLQHGSLFLR[Dea]TPK(SEQIDNO:253) P00338 0.23 chain L-lactatedehydrogenaseB HR[Dea]VIGSGC[CAM]NLDSAR[Dea]FR[Dea]YLMAEK P01795 0.87 chain (SEQIDNO:254) L-lactatedehydrogenaseB IVVVTAGVRQQEGESR[Dea]LNLVQRN[Dea]VNVFK P07195 0.87 chain (SEQIDNO:255) Lonproteasehomolog, LQQ[Dea]RLGR[Dea]EVEEK(SEQIDNO:256) K7EKE6 0.97 Malatedehydrogenase, GC[CAM]DVVVIPAGVPR[Dea]K(SEQIDNO:257) P40926 0.49 Malatedehydrogenase, NSPLVSR[Dea]LTLYDIAHTPGVAADLSHIETK(SEQIDNO:258) P40926 0.97 Methylcrotonoyl-CoA QEGIIFIGPPPSAIR[Dea]DMGIK(SEQIDNO:259) Q96RQ3 0.31 carboxylasesubunitalpha, Methylmalonate- NLR[Dea]VNAGDQPGADLGPLITPQAK(SEQIDNO:260) Q02252 0.70 semialdehydedehydrogenase [acylating], NAD(P)transhydrogenase AATITPFR[Dea]K(SEQIDNO:43) Q13423 0.05 NAD(P)transhydrogenase SMGAIVR[Dea]GFDTR[Dea]AAALEQFK(SEQIDNO:261) Q13423 0.11 NADHdehydrogenase PIFSR[Dea]DMNEAK(SEQIDNO:262) P56556 0.16 [ubiquinone] 1alpha subcomplexsubunit6 Peroxiredoxin-1 R[Dea]TIAQDYGVLK(SEQIDNO:263) Q06830 0.21 Peroxiredoxin-2 EGGLGPLNIPLLADVTR[Dea]R[Dea]LSEDYGVLK P32119 0.16 (SEQIDNO:264) Peroxiredoxin-5 VR[Dea]LLADPTGAFGK(SEQIDNO:265) P30044 0.16 Peroxiredoxin-6 LPFPIIDDR[Dea]NR[Dea]ELAILLGMLDPAEK(SEQIDNO:266) P30041 0.68 Phosphatecarrierprotein, VYFR[Dea]LPRPPPPEMPESLK(SEQIDNO:44) Q00325 0.00 PyruvatedehydrogenaseE1 C[CAM]DLHR[Dea]LEEGPPVTTVLTR[Dea]EDGLK(SEQIDNO:45) P08559 0.01 componentsubunitalpha, somaticform, PyruvatedehydrogenaseE1 DR[Dea]MVNSNLASVEELK(SEQIDNO:267) P08559 0.60 componentsubunitalpha, somaticform, Pyruvatedehydrogenase HSLDASQGTATGPR[Dea]GIFTK(SEQIDNO:268) O00330 0.37 proteinXcomponent Short-chainspecificacyl- SAAVVFASTDR[Dea]ALQNK(SEQIDNO:269) P16219 0.54 CoAdehydrogenase Stress-70protein, SDIGEVILVGGMTR[Dea]MPK(SEQIDNO:270) P38646 0.11 Stress-70protein, IVR[Dea]ASN[Dea]GDAWVEAHGK(SEQIDNO:271) P38646 0.16 Succinatedehydrogenase VTLEYR[Dea]PVIDK(SEQIDNO:272) P31040 0.07 [ubiquinone] flavoprotein subunit, Succinatedehydrogenase IYQR[Dea]AFGGQSLK(SEQIDNO:273) P31040 0.40 [ubiquinone] flavoprotein subunit, Succinatedehydrogenase FAIYR[Dea]WDPDK(SEQIDNO:46) P21912 0.05 [ubiquinone] iron-sulfur subunit, Succinyl-CoAligase TR[Dea]LIGPNC[CAM]PGVINPGEC[CAM]K(SEQIDNO:47) P53597 0.02 [ADP/GDP-forming] subunit alpha, Succinyl-CoAligase PVVSFIAGLTAPPGR[Dea]R[Dea]MGHAGAIIAGGK(SEQIDNO:274) P53597 0.09 [ADP/GDP-forming] subunit alpha, Succinyl-CoAligase INFDSNSAYR[Dea]QK(SEQIDNO:275) Q9P2R7 0.27 [ADP-forming] subunitbeta, Succinyl-CoAligase GRIC[CAM]N[Dea]QVLVC[CAM]ER[Dea]K(SEQIDNO:276) Q9P2R7 0.39 [ADP-forming] subunitbeta, Succinyl-CoAligase IFDLQDWTQEDER[Dea]DK(SEQIDNO:277) Q9P2R7 0.73 [ADP-forming] subunitbeta, Succinyl-CoA:3-ketoacid ADR[Dea]AGNVIFR[Dea]K(SEQIDNO:48) P55809 0.04 coenzymeAtransferase1, Succinyl-CoA:3-ketoacid GLTAVSNNAGVDNFGLGLLLR[Dea]SK(SEQIDNO:278) P55809 0.93 coenzymeAtransferase1, Thioredoxin-dependent HLSVNDLPVGR[Dea]SVEETLRLVK(SEQIDNO:279) P30048 0.18 peroxidereductase, Thioredoxin-dependent HLSVNDLPVGR[Dea]SVEETLR[Dea]LVK(SEQIDNO:280) P30048 0.68 peroxidereductase, Trifunctionalenzyme ALTSFER[Dea]DSIFSNLTGQLDYQGFEK(SEQIDNO:281) P40939 0.99 subunitalpha, Verylong-chainspecific SDSHPSDALTR[Dea]K(SEQIDNO:282) P49748 0.32 acyl-CoAdehydrogenase, Verylong-chainspecific ITAFVVER[Dea]GFGGITHGPPEK(SEQIDNO:283) P49748 0.55 acyl-CoAdehydrogenase, Verylong-chainspecific ALVER[Dea]GGVVTSNPLGF(SEQIDNO:284) P49748 0.87 acyl-CoAdehydrogenase, Voltage-dependentanion- SR[Dea]VTQSNFAVGYK(SEQIDNO:49) P21796 0.02 selectivechannelprotein1 60kDaheatshockprotein, FDR[Dea]GYISPYFINTSK(SEQIDNO:50) P10809 0.04 61kDaheatshockprotein, VVR[Dea]TALLDAAGVASLLTTAEVVVTEIPK(SEQIDNO:285) P10809 0.07 62kDaheatshockprotein, LVQDVANNTNEEAGDGTTTATVLAR[Dea]SIAK(SEQIDNO:286) P10809 0.14 63kDaheatshockprotein, GANPVEIR[Dea]R[Dea]GVMLAVDAVIAELK(SEQIDNO:287) P10809 0.22 64kDaheatshockprotein, GR[Dea]TVIIEQSWGSPK(SEQIDNO:288) P10809 0.55 65kDaheatshockprotein, GANPVEIRR[Dea]GVMLAVDAVIAELK(SEQIDNO:289) P10809 0.58 66kDaheatshockprotein, FGADAR[Dea]ALMLQGVDLLADAVAVTMGPK(SEQIDNO:290) P10809 0.93 Cytoplasmicaconitate PAR[Dea]VILQDFTGVPAVVDFAAMR[Dea]DAVK P21399 0.77 hydratase (SEQIDNO:291) PolymeraseIandtranscript TVRGSLER[Dea]QAGQIK(SEQIDNO:292) Q6NZI2 0.09 releasefactor PolymeraseIandtranscript TVR[Dea]GSLER[Dea]QAGQIK(SEQIDNO:293) Q6NZI2 0.34 releasefactor Trifunctionalenzymesubunit PNIR[Dea]NVVVVDGVR[Dea]TPFLLSGTSYK(SEQIDNO:51) P55084 0.02 beta, Aconitatehydratase, TGR[Dea]EDIANLADEFK(SEQIDNO:52) Q99798 0.00 Aconitatehydratase, R[Dea]LQLLEPFDK(SEQIDNO:53) Q99798 0.01 Dualspecificityprotein LGITHVLNAAEGR[Dea]SFMHVNTNANFYK(SEQIDNO:54) P51452 0.01 phosphatase3 Elongationfactor1-alpha2 ASGVSLLEALDTILPPTR[Dea]PTDK(SEQIDNO:294) Q05639 0.45 Elongationfactor1-alpha2 IGGIGTVPVGR[Dea]VETGILR[Dea]PGMVVTFAPVNITTEVK Q05639 0.80 (SEQIDNO:295) Elongationfactor2 VNFTVDQIR[Dea]AIMDK(SEQIDNO:296) P13639 0.09 Eukaryotictranslation VAPAQPSEEGPGR[Dea]K(SEQIDNO:297) E7EX17 0.95 initiationfactor4B HistoneH2Btype1-M AVR[Dea]LLLPGELAK(SEQIDNO:298) Q99879 0.99 HistoneH3(Fragment) LPFQR[Dea]LVR[Dea]EIAQDFK(SEQIDNO:299) K7EK07 0.36 HistoneH4 RISGLIYEETR[Dea]GVLK(SEQIDNO:300) P62805 0.65 HistoneH4 VFLENVIR[Dea]DAVTYTEHAK(SEQIDNO:301) P62805 0.74 Neuroblastdifferentiation- FGVSTGR[Dea]EGQTPK(SEQIDNO:55) Q09666 0.01 associatedproteinAHNAK Fibrinogenalphachain ESSSHHPGIAEFPSR[Dea]GK(SEQIDNO:302) P02671 0.39 Fibrinogenalphachain R[Dea]LDGSVDFK(SEQIDNO:303) C9JEU5 0.62 Haptoglobin LR[Dea]TEGDGVYTLNNEK(SEQIDNO:304) P00738 0.40 Serotransferrin DYELLC[CAM]LDGTR[Dea]K(SEQIDNO:305) P02787 0.10 Collagenalpha-3(VI)chain DVVFLLDGSEGVR[Dea]SGFPLLK(SEQIDNO:56) E7ENL6 0.03
TABLE-US-00003 TABLE 1C Citrullinated peptides that are upregulated or downregulated in healthy versus ischemic and healthy versus IDCM subjects. Protein I/N I ES1 protein homolog 10.32617915 up Aconitate hydratase 8.871956482 up Glyceraldehyde-3-phosphate dehydrogenase 7.914843955 up Delta-1-pyrroline-5-carboxylate dehydrogenase 7.552745345 up Vimentin 6.886890573 up Neuroblast differentiation-associated protein AHNAK 6.631800512 up Serum deprivation-response protein 5.310526396 up Enoyl-CoA hydratase 5.304039413 up Aconitate hydratase 5.18248378 up Peptidyl-prolyl cis-trans isomerase A 4.691862761 up Delta-1-pyrroline-5-carboxylate dehydrogenase 4.531765219 up Chloride intracellular channel protein 4 4.143020683 up Alcohol dehydrogenase 1B 3.979284116 up Adenylate kinase 4 3.954001114 up Fatty acid-binding protein 3.891772332 up Myosin-binding protein C 3.770886194 up Aconitate hydratase 3.740779581 up Aconitate hydratase,\ 3.54332942 up Delta-1-pyrroline-5-carboxylate dehydrogenase 3.484011583 up Dual specificity protein phosphatase 3 3.348178139 up Pyruvate dehydrogenase E1 component subunit alpha, somatic form 3.336292196 up Voltage-dependent anion-selective channel protein 1 3.075867039 up Heat shock protein HSP 90-alpha 3.018162117 up Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2.797967329 up Aconitate hydratase 2.646902712 up Carbonic anhydrase 3 2.393105549 up Serum deprivation-response protein 2.181113303 up ATP synthase subunit alpha 2.125964715 up Succinyl-CoA:3-ketoacid coenzyme A transferase 1 2.02609809 up Alcohol dehydrogenase class-3 1.955112799 up Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha 1.813434217 up Troponin I, cardiac muscle 1.770629108 up ATP synthase subunit alpha 1.757665967 up ATP synthase subunit alpha 1.716317069 up Filamin-C 1.707322518 up 60 kDa heat shock protein 1.691322503 up Heat shock protein beta-7 1.659329245 up Myozenin-2 1.640224333 up Cytochrome c (Fragment) 1.516000483 up LIM domain-binding protein 3 1.456615429 up Trifunctional enzyme subunit beta 1.262914035 up Phosphate carrier protein 0.90684035 down ATP synthase subunit alpha 0.821046528 down Collagen alpha-3(VI) chain 0.787448747 down Myozenin-2 0.750016161 down Troponin I 0.707050891 down NAD(P) transhydrogenase 0.689499324 down Alpha-crystallin B chain 0.574071929 down ATP synthase-coupling factor 6 0.558912444 down Troponin T, cardiac muscle (Fragment) 0.474388613 down Beta-enolase 0.324050919 down Adenylate kinase isoenzyme 1 0.134886108 down I: Ischemic Heart Disease (ISHD); I/N = ischemia vs. normal (healthy); ID = Idiopathic Cardiomyopathy (IDCM); ID/N = IDCM vs. control (healthy).
TABLE-US-00004 TABLE 1D Citrullinated peptides that are upregulated or downregulated in healthy versus ischemic and healthy versus IDCM subjects. Protein ID/N ID ATP synthase subunit alpha 18.47537571 up ATP synthase subunit alpha 15.31631115 up Myozenin-2 14.27029851 up Glyceraldehyde-3-phosphate dehydrogenase 12.08226474 up ATP synthase subunit alpha 9.229219757 up ATP synthase subunit alpha 7.956015709 up ES1 protein homolog 6.450987219 up Delta-1-pyrroline-5-carboxylate dehydrogenase 4.442955018 up Enoyl-CoA hydratase 3.92858654 up Voltage-dependent anion-selective channel protein 1 3.872789427 up Aconitate hydratase 3.868674325 up Phosphate carrier protein 3.29840839 up Pyruvate dehydrogenase E1 component subunit alpha, somatic form 3.241986763 up Aconitate hydratase 3.202560876 up Vimentin 3.18977634 up NAD(P) transhydrogenase 3.087350045 up Trifunctional enzyme subunit beta 3.078371104 up Aconitate hydratase 3.033531051 up Myosin-binding protein C 2.938608028 up Chloride intracellular channel protein 4 2.768865949 up Aconitate hydratase 2.733376766 up Heat shock protein HSP 90-alpha 2.673523729 up Delta-1-pyrroline-5-carboxylate dehydrogenase 2.570795078 up Collagen alpha-3(VI) chain 2.444430998 up Serum deprivation-response protein 2.396582653 up Delta-1-pyrroline-5-carboxylate dehydrogenase 2.194292783 up Alcohol dehydrogenase 1B 1.513050932 up Aconitate hydratase 1.359569141 up Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1.182430989 up Dual specificity protein phosphatase 3 1.089131195 up Serum deprivation-response protein 1.05734493 up 60 kDa heat shock protein 0.676500721 down Heat shock protein beta-7 0.569844647 down Filamin-C 0.543903731 down Alcohol dehydrogenase class-3 0.539343446 down Adenylate kinase 4 0.516646378 down Fatty acid-binding protein 0.500998082 down Myozenin-2 0.483486835 down Neuroblast differentiation-associated protein AHNAK 0.440092248 down Cytochrome c (Fragment) 0.256014197 down Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha 0.234602593 down Peptidyl-prolyl cis-trans isomerase A 0.231427358 down Carbonic anhydrase 3 0.230059909 down LIM domain-binding protein 3 0.21853459 down Troponin I 0.188118204 down Troponin I 0.184373163 down Troponin T 0.153543871 down Alpha-crystallin B chain 0.145172906 down Succinyl-CoA:3-ketoacid coenzyme A 0.121733077 down transferase 1 ATP synthase-coupling factor 6 0.076789945 down Adenylate kinase isoenzyme 1 0.023786955 down Beta-enolase 0.013231973 down I: Ischemic Heart Disease (ISHD); I/N = ischemia vs. normal (healthy); ID = Idiopathic Cardiomyopathy (IDCM); ID/N = IDCM vs. control (healthy)
TABLE-US-00005 TABLE 1E Proteins that were up in both I and ID groups. Protein I/N I ID/N ID ATP synthase subunit alpha 2.125964715 up 18.47537571 up ATP synthase subunit alpha 1.757665967 up 15.31631115 up Glyceraldehyde-3-phosphate dehydrogenase 7.914843955 up 12.08226474 up ATP synthase subunit alpha 1.716317069 up 7.956015709 up ES1 protein homolog 10.32617915 up 6.450987219 up Delta-1-pyrroline-5-carboxylate dehydrogenase 4.531765219 up 4.442955018 up Enoyl-CoA hydratase 5.304039413 up 3.92858654 up Voltage-dependent anion-selective channel protein 1 3.075867039 up 3.872789427 up Aconitate hydratase 3.54332942 up 3.868674325 up Pyruvate dehydrogenase E1 component subunit 3.336292196 up 3.241986763 up alpha, somatic form Aconitate hydratase 8.871956482 up 3.202560876 up Vimentin 6.886890573 up 3.18977634 up Trifunctional enzyme subunit beta 1.262914035 up 3.078371104 up Aconitate hydratase 5.18248378 up 3.033531051 up Myosin-binding protein C 3.770886194 up 2.938608028 up Chloride intracellular channel protein 4 4.143020683 up 2.768865949 up Aconitate hydratase 3.740779581 up 2.733376766 up Heat shock protein HSP 90-alpha 3.018162117 up 2.673523729 up Delta-1-pyrroline-5-carboxylate dehydrogenase 7.552745345 up 2.570795078 up Serum deprivation-response protein 2.181113303 up 2.396582653 up Delta-1-pyrroline-5-carboxylate dehydrogenase 3.484011583 up 2.194292783 up Alcohol dehydrogenase 1B 3.979284116 up 1.513050932 up Aconitate hydratase 2.646902712 up 1.359569141 up Succinate dehydrogenase [ubiquinone] iron-sulfur 2.797967329 up 1.182430989 up subunit Dual specificity protein phosphatase 3 3.348178139 up 1.089131195 up Serum deprivation-response protein 5.310526396 up 1.05734493 up I: Ischemic Heart Disease (ISHD); I/N = ischemia vs. normal (healthy); ID = Idiopathic Cardiomyopathy (IDCM); ID/N = IDCM vs. control (healthy).
TABLE-US-00006 TABLE 1F Proteins that were down in both I and ID groups. Protein I/N I ID/N ID Troponin I 0.707051 down 0.188118 down Alpha-crystallin B chain 0.574072 down 0.145173 down ATP synthase-coupling factor 6 0.558912 down 0.07679 down Troponin T, cardiac muscle 0.474389 down 0.153544 down (Fragment) Beta-enolase 0.324051 down 0.013232 down Adenylate kinase isoenzyme 1 0.134886 down 0.023787 down I: Ischemic Heart Disease (ISHD); I/N = ischemia vs. normal (healthy); ID = Idiopathic Cardiomyopathy (IDCM); ID/N = IDCM vs. control (healthy).
[0111] Western blotting of myofilament- and cytosolic-enriched fractions obtained from ISHD, IDCM and non-failing donor hearts (n=10/group) using an anti-modified citrulline antibody confirmed that citrullination occurs to intracellular proteins. Although there was no difference (
[0112] To further validate citrullination of the high abundant sarcomeric proteins, DIGE 2D gel electrophoresis (pH 4-7, 10% SDS PAGE) was carried out. Myofilament- and cytosolic-enriched fractions of ISHD, IDCM and non-failing donor hearts (n=4/group) were pretreated with PAD2 to induce maximum citrullination, combined at a 1:1 ratio with the matching untreated samples and simultaneously resolved by 2D gel electrophoresis. The sarcomeric proteins, including actin, TM and myosin light chains were shown to be citrullinated with ectopic treatment of PAD2 (
Biochemical Assessment of Modified Sarcomeric Proteins.
[0113] To test whether citrullination can affect sarcomeric protein function, actin, HMM, TM and troponin were citrullinated by ectopic PAD2 and then compared to respective unmodified recombinant proteins to determine if citrullination affects their biochemical, structural, or enzymatic properties. The binding of citrullinated or untreated HMM, TM or TM-TnI to F-actin was determined using classical co-sedimentation assays (
[0114] The binding of cardiac TnI to F-actin in the presence of TM was performed by co-sedimenting citrullinated TnI in the presence of F-actin and TM. It was found that both citrullinated and non-citrullinated forms of cardiac TnI bound to F-actin equally well (
Inhibition of HMM-A TPase Activity.
[0115] To verify a possible modulation of the actomyosin HMM-ATPase activity by citrullination of sarcomeric proteins, experiments were performed in the presence of citrullinated HMM, F-actin and TM. The data summarized in
PAD2 Reduces Calcium Sensitivity in Skinned Myocytes
[0116] Chemically skinned cardiomyocytes isolated from the left ventricle of wild-type C57B16 male mice were exposed to varying concentrations of calcium (n=8 myocytes from 3 mice per group,
Analysis of PAD mRNA Expression.
[0117] To determine the cell specificity of the PAD isoform expression in the myocardium, mRNA expression level was determined using isoform specific primers by Nested-PCR on isolated cardiac myocytes and fibroblasts (
Example 3
[0118] Our experimental findings characterize citrullinated proteins in the normal and HF myocardium. The analysis revealed that citrullination is enriched in the mitochondria and sarcomere subproteomes. Protein citrullination has broad cellular distribution (
[0119] Ca.sup.2+-dependent alterations to Tn alter an azimuthal movement of TM on the actin surface, which allows myosin binding and cross-bridge isomerization to strong binding, force-producing states and muscle contraction. At low intracellular Ca.sup.2+, Tn-TM sterically blocks myosin binding sites on actin (blocked state), while in presence of elevated Ca.sup.2+ Tn-TM moves and partially exposes the myosin binding sites on F-actin (closed state). Myosin binding in the presence of Ca.sup.2+ is required for full activation. It is a combination of Ca.sup.2+-induced TnI conformational change which is, in part, transmitted via TnT to TM (especially the Ti region that binds along TM) as well as myosin binding that influence the exact positioning of TM on the actin filament. Based on our MS data, citrullination sites on myosin, actin, TM, TnI and TnT are in regions what can influence these interactions and thus, the actomyosin HMM-ATPase activity and contraction. Below outlines the potential impact based on the biochemical and physiological experiments presented in this manuscript.
[0120] First, intrinsic actomyosin HMM-ATPase was inhibited by citrullination, but this was overcome in the presence of F-actin regardless of whether F-actin is citrullinated or not. Citrullinated F-actin was a more potent modulator of HMM enzymatic activity and increased actomyosin HMM-ATPase rate by 55% compared to the unmodified F-actin. This suggests that citrullination of F-actin changes the confirmation of the actin filament to alter the ease of ATP hydrolysis by the myosin once it is bound. The actin-HMM interaction was also affected by the citrullination of TM. Citrullinated TM displayed enhanced binding to F-actin compared to unmodified TM. This was also observed in the presence of HMM (based on the centrifugation assays). This correlated to an inhibition of the citrullinated TM-actin-HMM ATPase activity compared to the non-citrullinated TM, suggesting that citrullinated TM altered the ability of HMM to bind to the actin filament (
[0121] Biochemical results were related to our physiological finding and showed that citrullination of the sarcomeric proteins caused a decrease in Ca.sup.2+-sensitivity in the skinned cardiac myocyte (
[0122] Finally, to better understand the involvement of citrullinated proteins in the heart, it is important to obtain insight about cell specificity. Previous data acquired by the immunohistochemistry showed that PADs 1-3 and to some degree, PAD6 were detected in cardiomyocytes with PADs 2 and 4 found in endothelial cells and vascular smooth muscle cells. In the present study, we relied not on antibodies and tissue slices, but rather examined the mRNA expression of PAD family members in isolated mouse cardiomyocytes and cardiac fibroblasts. The data showed that PAD2 was primarily expressed in both cardiomyocytes and cardiac fibroblasts whereas PAD1 and PAD4 mRNA were the major forms in the cardiac fibroblasts.
[0123] We have presented previously unexplored roles for citrullination in the heart. Ultimately, identification of citrullination of the majority of the sarcomeric proteins and alterations in their biochemical properties suggest that there is potentially a new PTM regulation of cardiac contractility. Since citrullination at some of these residues were increased in the myocardium of individuals with HF compared to the controls, suggest that citrullination could play a role, in the decrease contractile dysfunction in HF.
Example 4: Citrullinated Peptides in Neurodegenerative Diseases
[0124] Citrullination is a PTM of arginine residues that is characterized by the oxidization of the side chain. This modification is catalyzed by Peptidyl Arginine Deiminase enzymes (PAD) that causes the conversion of arginine to citrulline. Citrullination, also known as deimination occurs when there is a loss of a positive charge and reduction in hydrogen-bonding ability, ultimately causing a change in the protein's chemical structure. This modification plays both a physiological role, for instance during apoptosis and epigenetics, and a pathological role in cancer or diseases of the central nervous system [3]. Furthermore, anti-citrullinated protein antibodies (ACPAs) are present in 60% of patients with rheumatoid arthritis (RA) and are associated with aggressive disease and a poor prognosis [4, 5]. Genetic studies of RA have identified many disease-prone SNPs at >100 non-HLA gene loci [6]. Therefore, the investigation to associate citrullination, SNPs and disease can provide an insight to many pathological disorders.
Protocol Overview
[0125] The purpose of this protocol is to build citrullinated assay libraries that support accurate detection of citrullinated proteins/peptides in vivo. The protocol covers the sample preparation, the acquisition of high-quality fragment ion spectra in DIA mode, the spectral citrullinated library generation and bioinformatics pipeline for binning the citrullinated peptides based on quality. Furthermore, additional tools were developed to translate the large datasets into knowledge by further annotating the peptide data with known vs. novel, and linkage to disease associated genomic alteration information.
Materials
[0126] Reagents: Rabbit skeletal muscle PAD cocktail (PAD) (SignalChem); Sequencing grade Lys-C protease (WAKO); iRT retention time peptides [13]; FASP Protein Digestion Kit (Expedeon),
[0127] Human brain tissue. Healthy control post-mortem human brain tissues corresponding to superior frontal gyrus (SFG) (n=10) obtained from NIH NeuroBioBank (NBB). The cases had neither a clinical history nor a neuropathology diagnosis of neurologic disease. Human ALS motor cortex(n=1) and ALS thoracic spinal cord (n=4) with corresponding healthy samples obtained from occipital lobe (n=3). Mouse brains: Alzheimer's model (1.9 months old, lots of beta-amlyloid, memory deficitis and onset of neurodegeneration, n=5; 2.9 months old, normal/healthy mouse, with inctact memory, n=5; 3.2 months old, little to no detectable beta-amyloid and intact memory, n=2; 4. 2 months old, healthy mouse, n=2). Stroke mouse (a middle cerebral artery occlusion stroke, n=5 Left side of brain where storoke ocured, right side of brain, corresponding healthy control); Healthy mouse (n=5, brain, aorta, skeletal muscle).
[0128] Brain buffer A: Ice-cold low salt buffer: 10 mM Tris, pH 7.5, 5 mM EDTA, 1 mM DTT, 10% sucrose, 10 mM b-glycerophosphate, 10 mM sodium orthovanadate, 10 mM tetrasodium pyrophosphate, 50 mM sodium fluoride, 1Roche complete protease inhibitor cocktail).
[0129] Brain buffer B: 1% Triton, 10 mM Tris, pH 7.5, 5 mM EDTA, 1 mM DTT, 10% sucrose, 10 mM b-glycerophosphate, 10 mM sodium orthovanadate, 10 mM tetrasodium pyrophosphate, 50 mM sodium fluoride, 1Roche complete protease inhibitor cocktail
[0130] PAD Buffer: 0.1M tris-HCl, pH7.4, 10 mM CaCl2, 5 mM DTT, 10 ug/ul aprotonin, 10 g/ul leupeptin, 10 ug/ul pepstatin.
[0131] Equipment: High Speed Mixer Mill (MM400) (Retsch); Mixer Mill jar (#22.008.0005 Retsch) and 7 mm stainless steel ball (#22.455.0008 Retsch); Refrigenerated Bench-top centrifuge (Eppendorf 5415R), temperature 4 C. and 20 C.; Beckman Coulter Optima Ultracentrifuge with TLA 100.2 rotor; TripleTof 5600+ mass spectrometer (AB Sciex); TripleTof 6600+ mass spectrometer (AB Sciex); iProXpress (http://proteininformationresource.org/iproxpress2) [14]; Computer: PC with Microsoft Windows 7 (Microsoft), >4 GB of RAM, sufficient hard disk space (for the protocol case study 40 GB).
[0132] Software: Microsoft Windows 7 (Microsoft); MS Excel (Microsoft); Cytoscape Plugin BiNGO A Biological Network Gene Ontology Tool (http://baderlab.org/Software/EnrichmentMap/BingoTutorial).
[0133] Equipment Setup: Detailed instructions, including screenshots, for the installation of each software module are provided in Supplementary material.
[0134] Methods: 1. Brain sample preparation. TIMING 90 min to a few days (depends on number of samples); 2. Weigh tissue and record wet tissue weight. 3. Cut the tissue into small pieces with a scalpel or a tissue slice blade. 4. Transfer the tissue pieces into 3 volumes (w/v) of ice cold Buffer A. 5. Homogenize the tissue on ice using a homogenizer (30 s at 20 Hz using a single 7 mm stainless-steel ball). 6. Centrifuge the sample for 15 min, 30800 rpm, 4 C. using a TLA 100.2 rotor in a Beckman Coulter Optima Ultracentrifuge. 7. Transfer the supernatant into a clean tube. 8. To remaining pellet add buffer B (1:3 tissue to buffer ratio) and homogenized at 30 Hz for 30 s in a cold Mixer Mill MM400. 9. Centrifuge at 100,000 rpm for 20 min in a TLA-100.2 rotor (Beckman). 10. Transfer the supernatant into a clean tube and determine the protein concentration by the Bradford method.
[0135] Protein citrullination: Peptides can only be identified by targeted MS if they are included in the assay library. To cover proteins that are expressed in specific biological conditions we needed to prepare the pool of citrullinated peptides that theoretically represents the entire biological space. Most PAD isoforms are exclusively expressed in the cytoplasm, except for PAD4, which contains a nuclear localization signal and is indeed found to reside at least in part in the nucleus. It would therefore be reasonable to assume that the substrate specificity differs between the PAD isotypes [15, 16]. A key step in the process is the treatment of pooled tissue/sample(s) in vitro with a PAD cocktail to induce hypo-citrullination of accessible arginine residues. (1) Pool samples in each fraction in order to obtain 200 ug sample pool. (2) Mix up to 30 l of a protein pool with 150 l of PAD Buffer. (3) Add PAD cocktail (Catalog #P312-37C) in an enzyme/substrate (w/w) ratio of 1:25, and incubate the reaction for 2 h at 37C, gentle shacking. Stop citrullination by adding EDTA until 50 mM final concentration. (4) Prepare the negative control the same way but add water instead of PAD cocktail. (5) Keep on ice until use.
[0136] Protein digestion. Protein Discovery's FASP Protein Digestion Kit was used in order to digest all samples with LysC in an enzyme/substrate (w/w) ratio of 1:30, and incubate the reaction for 20 h at 37 C., gentle shaking.
[0137] SWATH-MS Data Acquisition. Generation of SWATH-MS maps: Triple-TOF MS analysis in DDA and SWATH mode. A TripleTOF 6600 mass spectrometer (Sciex) was used for both data dependent acquisition to build peptide spectral ion library and SWATH-MS (data independent acquisition) for each individual sample analysis. The raw data was searched with ProteinPilot Software 5.0 to create a spectral ion library. Individual SWATH-MS runs were matched against the spectral library created in the presence or absence of PAD (plus and minus PAD).
[0138] Extensive identification and analysis of conserved citrullinated peptides. The blast on the peptide level was performed to find human homology (sequence-similar) equivalent of the mouse data obtained from brain stroke mouse model, Alzheirmer's and healthy mouse brain, as well as from mouse aorta and mosue skeletal muscle. The matching list only includes the top blastp-short hit, meaning >80% of peptide homology between mouse and human was found. In most cases, if the top hit was an isoform, the other isoforms and canonical protein was also conserved.
TABLE-US-00007 TABLE 11 Summary of output files for brain sample plus and minus PAD treatment for brain samples (confidence threshold used was 0.995) (JF_150402_5600-plus/minusPAD). Total Peptides Total Unique Peptides Output File Description NG Rule minus PAD plus/minus PAD minus PAD plus/minus PAD 1 delta =>5 min Not checked 1,637 36,202 58 1,530 conf >0.95 2 delta <5 min OR pass 3,238 30,382 152 1,571 conf <0.95 OR no matched control 3 delta <5 min OR fail 1,370 19,450 55 1,006 conf <0.95 OR no matched control 4 every line Not checked 375,717 431,816 17,147 20,702 without R[Dea]
[0139] The citrullinated peptides are binned into 4 different output files based. Output 1 contains the high confidence peptides, which have a >5 min delta in retention time between the modified peptide and the unmodified peptide, plus a confidence score (user input). Output 2 and 3 contains peptides that had a citrullinated R residue; however, no unmodified peptide was found in the dataset limiting the ability to calculate the retention time difference. However, for Output 2 an N/Q residue is not within 5 amino acids on either side of the citrullinated R residue; whereas in Output 3 an N/Q residue is located within 5 amino acids on either side the citrulinated R residue. Output 4 contains all peptides in the original file that did not meet the criteria for Outputs 1-3.
[0140] Herein we describe a step-by-step protocol and an integrated, openly accessible computational pipeline to generate high-quality assay libraries for analysis of citrullinated peptides in complex biological samples. Using the high resolution of the time-of-flight mass analyzer (>30,000) that allowing for confident identification of the peptide elution profile and discrimination between near isobaric parent mass tolerance and bioinformatics pipeline that rules the outcomes we were able to identified citrullinated peptides over a dynamic range of 6 orders of magnitude and quantified those with relative abundance.
[0141] There are some chemical, proteomic and antibody-based procedures that are currently available for the analysis of citrullination in complex samples [15-17]. However, with the current methods it remains challenging to rapidly, consistently, reproducibly, accurately, and sensitively detect and quantify citrullinated peptides across multiple samples. Here we present a new strategy that systematically queries sample sets for the presence and quantity of citrullinated proteins with exact site of modified residues. It consists of using the information available in fragment ion spectral libraries, like relative intensities, chromatographic concurrence to mine the complete citrullinated fragment ion maps generated using DIA method.
[0142] In essence, our tools identify peak groups that uniquely associate with the targeted citrullinated peptide within the comprehensive SWATH MS signal map, and then compute a probability that the targeted citrullinated peptide has been correctly identified by following the set up rules in bioinformatics pipeline. In order to increase sensitivity a high-quality library of citrullinated assays is a prerequisite for SWATH MS and similar targeting MS methods. Ideally, the citrullinated peptides in the assay library cover all citrullinated proteins of interest for a particular study, or even an entire proteome. In order to make sure it is true samples on based the library is built on are in vitro citrullinated by PAD cocktail. This step helps improve detection of citrullinated proteins present in lower amounts as well as cover potentially new sites.
[0143] We show that SWATH-MS can be successfully adopted for PTM analysis. Bioinformatics pipeline added for analysis of citrullinated peptide makes the analysis reliable, robust and quick. We believe that this methodology will increase popularity of analysis of citrullination in the field and shortly will be invaluable to elucidate the importance of this posttranslational modification in vivo.
[0144] As described herein, citrullination, the post-translational (PTM) conversion of arginine to citrulline by the family of peptidylarginine deiminase (PADs), has been commonly implicated as abnormal pathological features in neurodegenerative diseases such as prion diseases, multiple sclerosis, and Alzheimer's disease. This PTM could be a target for novel diagnostic or therapeutic agents. Therefore, an unambiguous and efficient method to identify citrullinated proteins and their modified residues is of extreme importance.
[0145] ALS, or amyotrophic lateral sclerosis, is a progressive neurodegenerative disease that affects nerve cells in the brain and the spinal cord. The inventors investigated the role of citrullination in ALS disorders, with a focus on identifying a potentially clinically relevant PTM biomarker(s).
[0146]
[0147] As shown in
TABLE-US-00008 TABLE2 CitrullinatedpeptidesasbiomarkersforALS.Thesepeptides detectedinsubjectwithALSbutnothealthyhumans.Dea is Citrullinationordeamination.CAM iscarbamidomethylation. UniProtKB Modification Accessions ProteinName ModifiedSequence position Q99962 SH3Endophilin-A1 PSGVQMDPC[CAM]C[CAM]R[Dea]ALYDFEPENEGELGFK 296 G2 (SEQIDNO:306) P49419 Alpha-aminoadipic QYMR[Dea]R[Dea]STC[CAM]TINYSK 581,519 semialdehyde (SEQIDNO:307) dehydrogenase H3BRN4 4-aminobutyrate LILIAR[Dea]NK 465 aminotransferase (SEQIDNO:308) P68402 Platelet-activating VIVVWVGTNNHENTAEEVAGGIEAIVQLINTR[Dea]QPQAK 128 factoracetylhydrolase (SEQIDNO:309) IBsubunitbeta Q13011 ECHDelta(3,5)- EVDVGLAADVGTLQR[Dea]LPK 211 Delta(2,4)-dienoyl- (SEQIDNO:310) CoAisomerase P21291 CSRP1Cysteineand HEEAPGHR[Dea]PTTNPNASK 109 glycine-richprotein1 (SEQIDNO:311) P63215 GBGGuanine GETPVNSTMSIGQAR[Dea]K 17 nucleotide-binding (SEQIDNO:312) protein G(I)/G(S)/G(O) subunitgamma-33 F8VVM2 FPhosphatecarrier VRIQTQPGYANTLR[Dea]DAAPK 200 protein, (SEQIDNO:313) P49588 SYAAlanine-tRNA NVGC[CAM]LQEALQLATSFAQLR[Dea]LGDVK 962 ligase (SEQIDNO:314)
TABLE-US-00009 TABLE3 Citrullinatedpeptides(fromhumans)asbiomarkersforALS.Dea is Citrullinationordeamination.CAM iscarbamidomethylation. UniProtKB Modification Accessions ProteinName ModifiedSequence position P14136 Glialfibrillaryacidic FADLTDAAAR[Dea]NAELLR[Dea]QAK 270,276 protein (SEQIDNO:315) P14136 Glialfibrillaryacidic EIR[Dea]TQYEAMASSNMHEAEEWYRSK 239 protein (SEQIDNO:316) P14136 Glialfibrillaryacidic MASSNMHEAEEWYR[Dea]SK 258 protein (SEQIDNO:317) P14136 Glialfibrillaryacidic ASSNMHEAEEWYR[Dea]SK 258 protein (SEQIDNO:318) P14136 Glialfibrillaryacidic LAR[Dea]LEEEGQSLK 330 protein (SEQIDNO:319) P06744 Glucose-6-phosphateisomerase ILLANFLAQTEALMR[Dea]GK 438 (SEQIDNO:320) P08670 Vimentin TVETR[Dea]DGQVINETSQHHDDLE 450 (SEQIDNO:321) P08670 Vimentin VELQELNDR[Dea]FANYIDK 113 (SEQIDNO:322) P08670 Vimentin SSVPGVR[Dea]LLQDSVDFSLADAINTEFK 78 (SEQIDNO:323) P08670 Vimentin ALR[Dea]DVR[Dea]QQYESVAAK 270,273 (SEQIDNO:324) P02686 Myelinbasicprotein GAEGQRPGFGYGGR[Dea]ASDYK 264 (SEQIDNO:325) P02686 Myelinbasicprotein SHGR[Dea]TQDENPVVHFF 213 (SEQIDNO:326) P02686 Myelinbasicprotein SRFSWGAEGQRPGFGYGGR[Dea]ASDYK 264 (SEQIDNO:327) P02686 Myelinbasicprotein SR[Dea]FSWGAEGQR[Dea]PGFGYGGR[Dea]ASDYK 247,256,264 (SEQIDNO:328) P02686 Myelinbasicprotein SWGAEGQR[Dea]PGFGYGGR[Dea]ASDYK 256,264 (SEQIDNO:329) P02686 Myelinbasicprotein SHGR[Dea]TQDENPVVHF 213 (SEQIDNO:330) P02686 Myelinbasicprotein LGGR[Dea]DSRSGSPMARR[Dea] 293 (SEQIDNO:331) P02686 Myelinbasicprotein EGQRPGFGYGGR[Dea]ASDYK 264 (SEQIDNO:332) P30038 Delta-1-pyrroline-5- AIEAALAAR[Dea]K 113 carboxylatedehydrogenase (SEQIDNO:333) P30044 Peroxiredoxin-5 VR[Dea]LLADPTGAFGK 148 (SEQIDNO:334) Q9BW30 Tubulinpolymerization- TGGAVDR[Dea]LTDTSR[Dea]YTGSHK 124,130 promotingproteinfamiyl (SEQIDNO:335) member3 Q13011 Delta(3,5)-Delta(2,4)- VIGNQSLVNELAFTAR[Dea]K 230 dienoyl-CoAisomerase (SEQIDNO:336) P29762 Cellularretinoicacid- MR[Dea]SSENFDELLK 11 bindingprotein1 (SEQIDNO:337) Q9P2T1 GMPreductase2 YAGGVAEYR[Dea]ASEGK 286 (SEQIDNO:338)
TABLE-US-00010 TABLE4 CorrelatedcitrullinatedLysCpeptidesbasedonmatchingmousesequencetohuman sequence.Dea isCitrullinationordeamination.CAM iscarbamidomethylation. UniProtKB Modification Accessions ProteinName ModifiedSequence position P69905 HemoglobinsubunitalphaOS= Homo R[Dea]MFLSFPTTK 32, sapiensGN= HAB1PE= 1SV= 2 (SEQIDNO:339) P66905 HemoglobinsubunitalphaOS= Homo VGAHAGEYGAEALER[Dea]MFL 32, sapiensGN= HAB1PE= 1SV= 3 (SEQIDNO:340) P46821 Microtubule-associatedprotein1B TTR[Dea]TSDVGGYYYEK 1897, OS= HomosapiensGN= MAP1B (SEQIDNO:341) PE= 1SV= 2 Q15149 PlectinOS= HomosapiensGN= VPQR[Dea]AGEVER[Dea]DLDK 571,577, PLECPE= 1SV= 3 (SEQIDNO:342) Q15149 PlectinOS= HomosapiensGN= LHVAILER[Dea]EK 517, PLECPE= 1SV= 4 (SEQIDNO:343) Q14204 Cytoplasmicdynein1heavychain1 R[Dea[VEPLR[Dea]NELQK 3408,3413 OS= HomosapiensGN= DYNC1H1 (SEQIDNO:344) PE= 1SV= 5 Q01484 Ankyrin-2OS= Homosapiens EGHVGLVQELLGR[Dea]GSSVDSATK 86, GN= ANK2PE= 1SV= 4 (SEQIDNO:345) J3KPX8 MAP1lightchainLC2OS= Homo AIVFEIMEAGEPTGPILGAEALPGGLR[Dea]TL 1123, sapiensGN= MAP1APE= 1SV= 1 PQEPGKPQK (SEQIDNO:346) Q13385 Tubulinbeta-2AchainOS= Homo IREEYPDR[Dea]IMNTFSVMPSPK 162, sapiensGN= TUBB2A,PE= 1SV= 1 (SEQIDNO:347) Q00610 Clathrinheavychain1OS= Homo GILR[Dea]TPDTIR[Dea]R[Dea]FQSVPAQPG 393,399, sapiensGN= CLTCPE= 1SV= 5 QTSPLLQYFGILLDQGQLNK 400, (SEQIDNO:348) Q00610 Clathrinheavychain1OS= Homo YESLELC[CAM]R[Dea]PVLQQGR[Dea]K 436,437, sapiensGN= CLTCPE= 1SV= 6 (SEQIDNO:349) 444, Q99798 Aconitatehydratase,OS= Homo SYLR[Dea]LR[Dea]PDR[Dea]VAMQDATAQMA 90,92,95, sapiensGN= ACO2PE= 1SV= 2 MLQFISSGLSK(SEQIDNO:350) E7ESP9 Neurofilamentmediumpolypeptide SIELESVR[Dea]GTK 335, OS= HomosapiensGN= NEFM (SEQIDNO:351) PE= 1SV= 1 Q9NQC3 Reticulon-4OS= Homosapiens AESAVIVANPR[Dea]EEIIVK 320, GN= RTN4PE= 1SV= 2 (SEQIDNO:352) Q9NQC3 Reticulon-4OS= Homosapiens EAQIR[Dea]ETETFSDSSPIEIIDEFPTLISSK 854, GN= RTN4PE= 1SV= 2 (SEQIDNO:353) Q9NQ66 1-phosphatidylinositol EWTNEVFSLATNLLAQNMSR[Dea]DAFLEK 148, 4,5-biphosphatephosphodiesterase (SEQIDNO:354) beta-1OS= Homosapiens GN= PLCB1PE= 1SV= 1 P04075 Fructose-biphosphatealdolaseA ADDGR[Dea]PFPQVIK 92, OS= HomosapiensGN= ALDOA (SEQIDNO:355) PE= 1SV= 2 P10809 60kDaheatshockprotein, LVQDVANNTNEEAGDGTTTATVLAR[Dea]SIAK 121, OS= HomosapiensGN= HSPD1 (SEQIDNO:356) PE= 1SV= 2 P00558 PhosphoglyceratekinaseOS= Homo ALESPER[Dea]PFLAILGGAK 206, sapiensGN= PGK1PE= 1SV= 3 (SEQIDNO:357) P00558 PhosphoglyceratekinaseOS= Homo R[Dea]VVMR[Dea]VDFNVPMK 18,22, sapiensGN= PGK1PE= 1SV= 3 (SEQIDNO:358) P13639 Elongationfactor2OS= Homo VLENAEGAR[Dea]TTPSVVAFTADGER[Dea]LV 85,99, sapiensGN= EEF2PE= 1SV= 4 GMPAK (SEQIDNO:360) P06744 Glucose-6-phosphateisomerase NLVTEDVMR[Dea]MLVDLAK 66, OS= HomosapiensGN= GPIPE= 1 (SEQIDNO:361) SV= 4 P12277 CreatinekinaseB-typeOS= Homo DLFDPIIEDR[Dea]HGGYKPSDEHK 96, sapiensGN= CKBPE= 1SV= 1 (SEQIDNO:362) P12277 CreatinekinaseB-typeOS= Homo DLFDPIIEDR[Dea]HGGYKPSDEHK 96, sapiensGN= CKBPE= 1SV= 2 (SEQIDNO:363) P11216 Glycogenphosphorylase,brainform QISVR[Dea]GLAGLGDVAEVR[Dea]K 17,29, OS= HomosapiensGN= PYGBPE= 1 (SEQIDNO:364) SV= 5 P49588 Alanine--tRNAligase,cytoplasmic DVQR[Dea]EIADLGEALATAVIPQWQK 793, OS= HomosapiensGN= AARSPE= 1 (SEQIDNO:365) SV= 2 Q01814 Plasmamembranecalcium-trans- GIIDSTHTEQR[Dea]QVVAVTGDGTNDGPALK 812, portingATPase2OS= Homosapiens (SEQIDNO:366) GN= ATP2B2PE= 1SV= 2 P09543 2,3-cyclicnucleotide3- ITPGAR[Dea]GAFSEEYK 93, phosphodiesteraseOS= Homosapiens (SEQIDNO:367) GN= CNPPE= 1SV= 2 P09543 2,3-cyclicnucleotide3- TLFILR[Dea]GLPGSGK 56, phosphodiesteraseOS= Homosapiens (SEQIDNO:368) GN= CNPPE= 1SV= 2 P09543 2,3-cyclicnucleotide3- ELR[Dea]QFVPGDEPREK 224, phosphodiesteraseOS= Homosapiens (SEQIDNO:369) GN= CNPPE= 1SV= 2 P19367 Hexokinase-1OS= Homosapiens MVSGMYLGELVR[Dea]LILVK 307, GN= HK1PE= 1SV= 3 (SEQIDNO:370) Q9ULC6 Protein-argininedeiminasetype-1 R[Dea]ELGLAESDIVDIPQLFFLK 556, OS= HomosapiensGN= PADI1 (SEQIDNO:371) PE= 1SV= 2 Q8N573 Oxidationresistanceprotein1 TLYR[Dea]TMTGLDTPVLMVIK 754, OS= HomosapiensGN= OXR1 (SEQIDNO:372) PE= 1SV= 2 P15311 EzrinOS= HomosapiensGN= EZR EELER[Dea]QAVDQIK 405, PE= 1SV= 4 (SEQIDNO:373) P08238 HeatshockproteinHSP90-beta IDIIPNPQER[Dea]TLTLVDTGIGMTK 82, OS= HomosapiensGN= HSP90AB1 (SEQIDNO:374) PE= 1SV= 4 P29966 Myristoylatedalanine-rich GEAAAER[Dea]PGEAAVASSPSK 18, C-kinasesubstrateOS= Homo (SEQIDNO:375) sapiensGN= MARCKSPE= 1SV= 4 P49418 AmphiphysinOS= Homosapiens AEEPLAAVTPAVGLDLGMDTR[Dea]AEEPVEEAV 457, GN= AMPHPE= 1SV= 1 IIPGADADAAVGTLVSAAEGAPGEEAEAEK (SEQIDNO:376) P10636 Microtubule-associatedproteintau SR[Dea]LQTAPVPMPDLK 559, OS= HomosapiensGN= MAPTPE= 1 (SEQIDNO:377) SV= 5 P52306 Rap1GTPase-GDPdissociation LLGTLR[Dea]MLIDAQAEAAEQLGK 427, stimulatorOS= Homosapiens (SEQIDNO:378) GN= RAP1GDS1PE= 1SV= 3 Q05639 Elongationfactor1-alpha2 YYITIIDAPGHR[Dea]DFIK 96, OS= HomosapiensGN= EEF1A2 (SEQIDNO:379) PE= 1SV= 1 Q02252 Methylmalonate-semialdehyde YAHLVDVGQVGVNVPIPVPLPMFSFTGSR[Dea]S 488,492, dehydrogenase[acylating], SFR[Dea]GDTNFYGK OS= HomosapiensGN= ALDH6A1 (SEQIDNO:380) PE= 1SV= 2 P09972 Fructose-biphosphatealdolaseC R[Dea]AEVNGLAAQGK 331, OS= HomosapiensGN= ALDOC (SEQIDNO:381) PE= 1SV= 2 P40926 Malatedehydrogenase,OS= Homo GLDPAR[Dea]VNVPVIGGHAGK 191, sapiensGN= MDH2PE= 1SV= 3 (SEQIDNO:382) P48735 Isocitratedehydrogenase[NADP], ATDFVADR[Dea]AGTFK 188, OS= HomosapiensGN= IDH2PE= 1 (SEQIDNO:383) SV= 2 F5GXC8 Succinyl-CoAligase[ADP-forming] IFDLQDWTQEDER[Dea]DK 242, subunitbeta,OS= Homosapiens (SEQIDNO:384) GN= SUCLA2PE= 1SV= 1 P09104 Gamma-enolaseOS= Homosapiens LAMQEFMILPVGAESFR[Dea]DAMRLGAEVYHTL 179, GN= ENO2PE= 1SV= 3 K (SEQIDNO:385) Q9BPU6 Dihydropyrimidinase-related VR[Dea]GVDR[Dea]TPYLGDVAVVVHPGK 485,489, protein5OS= HomosapiensGN= (SEQIDNO:386) DPYSL5PE= 1SV= 1 Q9BPU6 Dihydropyrimidinase-related MDENR[Dea]FVAVTSSNAAK 372, protein5OS= HomosapiensGN= (SEQIDNO:387) DPYSL5PE= 1SV= 2 Q14195 Dihydropyrimidinase-related SAADLISQAR[Dea]K 268, protein3OS= HomosapiensGN= (SEQIDNO:388) DPYSL3PE= 1SV= 1 P09471 Guaninenucleotide-bindingprotein PVVYSNTIQSLAAIVR[Dea]AMDTLGIEYGDK 86, G(o)subunitalphaOS= Homo (SEQIDNO:389) sapiensGN= GNAO1PE= 1SV= 4 Q9ULU8 Calcium-dependentsecretion ELGR[Dea]VILHPTPNSPK 479, activator1OS= HomosapiensGN= (SEQIDNO:390) CADPSPE= 1SV= 3 P49419 Alpha-aminoadipicsemialdehyde DLGR[Dea]IFR[Dea]WLGPK 466,469, dehydrogenaseOS= Homosapiens (SEQIDNO:391) GN= ALDH7A1PE= 1SV= 5 P38606 V-typeprotonATPasecatalytic TVGMLSNMIAFYDMAR[Dea]R[Dea]AVETTAQS 552,553, subunitAOS= HomosapiensGN= DNK ATP6V1APE= 1SV= 2 (SEQIDNO:392) H3BRN4 4-aminobutyrateaminotransferase EEFR[Dea]PNAPYR[Dea]IFNTWLGDPSK 386,392, OS= HomosapiensGN= ABATPE= 1 (SEQIDNO:393) SV= 1 P07237 Proteindisulfide-isomerase R[Dea]TGPAATTLPDGAAAESLVESSEVAVIGFF 132, OS= HomosapiensGN= P4HBPE= 1 K SV= 3 (SEQIDNO:394) O94760 N(G),N(G)-dimethylarginine IMQQMSDHR[Dea]YDK 208, dimethylaminohydrolase1 (SEQIDNO:395) Q16181 Septin-7 DR[Dea]LPLAVVGSNTIIEVNGK 243, (SEQIDNO:396) O75781 Paralemmin-1OS= Homosapiens R[Dea]RQLEDER[Dea]RQLQHLK 32,39, GN= PALMPE= 1SV= 2 (SEQIDNO:397) P30153 Serine/threonine-protein HMLPTVLR[Dea]MAGDPVANVR[Dea]FNVAK 527,537, phosphatase2A65kDaregulatory (SEQIDNO:398) subunitAalphaisoformOS= Homo sapiensGN= PPP2R1APE= 1SV= 4 P15121 AldosereductaseOS= Homosapiens PEDPSLLEDPR[Dea]IK 233, GN= AKR1B1PE= 1SV= 3 (SEQIDNO:400) P07954 FumaratehydrataseOS= Homo IGR[Dea]THTQDAVPLTLGQEFSGYVQQVK 233, sapiensGN= FHPE= 1SV= 3 (SEQIDNO:401) P24752 Acetyl-CoAacetyltransferase, EVVIVSATR[Dea]TPIGSFLGSLSLLPATK 49, OS= HomosapiensGN= ACAT1 (SEQIDNO:402) PE= 1SV= 1 E9PFW3 AP-2complexsubunitmu DIILPFR[Dea]VIPLVR[Dea]EVGRTK 313,319, OS= HomosapiensGN= AP2M1 (SEQIDNO:403) PE= 1SV= 1 P30086 Phosphatidylethanolamino-binding LYTLVLTDPDAPSR[Dea]K 76, proteinOS= HomosapiensGN= (SEQIDNO:404) PEBP1PE= 1SV= 3 P04350 Tubulinbeta-4AchainOS= Homo GHYTEGAELVDAVLDVVR[Dea]K 121, sapiensGN= TUBB4APE= 1SV= 2 (SEQIDNO:405) Q9UI5 Transgelin-3OS= Homosapiens AAETYGVR[Dea]TTDIFQTVDLWEGK 106, GN= TAGLN3PE= 1SV= 2 (SEQIDNO:406) O43175 D-3-phosphoglyceratedehydrogenase VLISDSLPDC[CAM]C[CAM]R[Dea]K 18,19,20, OS= HomosapiensGN= PHGDH (SEQIDNO:407) PE= 1SV= 4 P00915 Carbonicanhydrase1OS= Homo ESISVSSEQLAQFRSLLSN[Dea]VEGDNAVPMQH 233,247, sapiensGN= CA1PE= 1SV= 2 NNR[Dea]PTQPLK (SEQIDNO:408) P61981 14-3-3proteingammaOS= Homo MKGDYYR[Dea]YLAEVATGEK 132, sapiensGN= YWHAGPE= 1SV= 2 (SEQIDNO:409) P61604 10kDaheatshockprotein, DYFLFR[Dea]DGDILGK 92, OS= HomosapiensGN= HSPE1 (SEQIDNO:410) PE= 1SV= 2 P21281 V-typeprotonATPasesubunitB, DIGWQLLR[Dea]IFPK 485, brainisoformOS= Homosapiens (SEQIDNO:411) GN= ATP6V1B2PE= 1SV= 3 B4DKF8 PHandSEC7domain-containing FSR[Dea]PLLPATTTK 245, protein3OS= HomosapiensGN= (SEQIDNO:412) PSD3PE= 1SV= 1 P32119 Peroxiredoxin-2OS= Homosapiens EGGLGPLNIPLLADVTR[Dea]R[Dea]LSEDYGV 109,110, GN= PRDX2PE= 1SV= 5 LK (SEQIDNO:413) P32119 Peroxiredoxin-2OS= Homosapiens TDEGIAYR[Dea]GLFIIDGK 127, GN= PRDX2PE= 1SV= 5 (SEQIDNO:414) P02647 ApolipoproteinA-IOS= Homo VEPLR[Dea]AELQEGARQK 147, sapiensGN= APOA1PE= 1SV= 1 (SEQIDNO:415) Q12765 Secernin-1OS= HomosapiensGN= NSAR[Dea]PR[Dea]DEVQEVVYFSAADHEPESK 30,32, SCRN1PE= 1SV= 2 (SEQIDNO:416) Q12765 Secernin-1OS= HomosapiensGN= AHEWAR[Dea]AIIESDQEQGR[Dea]K 355,366, SCRN1PE= 1SV= 2 (SEQIDNO:417) P00918 Carbonicanhydrase2OS= Homo LNFNGEGEPEELMVDNWR[Dea]PAQPLK 245, sapiensGN= CA2PE= 1SV= 2 (SEQIDNO:418) E9PDE8 Heatshock70kDaprotein4L VR[Dea]YLEEER[Dea]PFAIEQVTGMLLAK 78,84, OS= HomosapiensGN= HSPA4L (SEQIDNO:419) PE= 1SV= 1 Q9H115 Beta-solubleNSFattachment ER[Dea]EAVQLMAEAEK 8, proteinOS= HomosapiensGN= (SEQIDNO:420) NAPBPE= 1SV= 2 P00505 Aspartateaminotransferase, FSR[Dea]DVFLPK 153, OS= HomosapiensGN= GOT2 (SEQIDNO:422) PE= 1SV= 3 Q13509 Tubulinbeta-3chainOS= Homo FWEVISDEHGIDPSGNYVGDSDLQLER[Dea]ISV 46, sapiensGN= TUBB3PE= 1SV= 2 YYNEASSHK (SEQIDNO:423) O15144 Actin-relatedprotein2/3complex DR[Dea]VTVVFSTVFK 160, subunit2OS= HomosapiensGN= (SEQIDNO:424) ARPC2PE= 1SV= 1 P09211 GlutathioneS-transferaseP FQDGDLTLYQSNTILR[Dea]HLGR[Dea]TLGLY 71,75, OS= HomosapiensGN= GSTP1 GK PE= 1SV= 2 (SEQIDNO:325) O95292 Vesicle-associatedmembrane FR[Dea]GPFTDVVTTNLK 19, protein-associatedproteinB/C (SEQIDNO:426) OS= HomosapiensGN= VAPB PE= 1SV= 3 P42765 3-ketoacyl-CoAthiolase, QTMQVDEHAR[Dea]PQTTLEQLQK 224, OS= HomosapiensGN= ACAA2 (SEQIDNO:427) PE= 1SV= 2 Q8TAM6 ErminOS= HomosapiensGN= ERMN GHQAAEIEWLGFR[Dea]K 163, PE= 2SV= 1 (SEQIDNO:428) Q92686 NeurograninOS= HomosapiensGN= GPGPGGPGGAGVAR[Dea]GGAGGGPSGD 68, NRGNPE= 1SV= 1 (SEQIDNO:429) K7ELL7 Glucosidase2subunitbeta MPPYDEQTQAFIDAAQEAR[Dea]NK 381, OS= HomosapiensGN= PRKCSH (SEQIDNO:430) PE= 1SV= 1 Q9BY11 ProteinkinaseCandcasein GPQYGSLER[Dea]AWGAIMTEADK 82, kinasesubstrateinneurons (SEQIDNO:431) proteinOS= HomosapiensGN= PACSIN1PE= 1SV= 1 O15075 Serine/threonine-proteinkinase TTSASR[Dea]AVSSLATAK 161, DCLK1OS= HomosapiensGN= DCLK1 (SEQIDNO:432) PE= 1SV= 2 P09622 Dihydrolipoyldehydrogenase, NLGLEELGIELDPR[Dea]GR[Dea]IPVNTRFQ 334,336, OS= HomosapiensGN= DLDPE= 1 [Dea]TK 344, SV= 2 (SEQIDNO:433) P25705 ATPsynthasesubunitalpha, R[Dea]TGAIVDVPGEELLGR[Dea]VVDALGNAI 133,149, OS= HomosapiensGN= APT5A1 DGK PE= 1SV= 1 (SEQIDNO:434) Q02750 Dualspecificitymitogen-activated AGR[Dea]IPEQILGK 160, proteinkinasekinase1 (SEQIDNO:435) OS= HomosapiensGN= MAP2K1 PE= 1SV= 2 Q01995 TransgelinOS= HomosapiensGN= GPSYGMSR[Dea]EVQSK 12, TAGLNPE= 1SV= 4 (SEQIDNO:437) Q16352 Alpha-internexinOS= Homosapiens SEMAR[Dea]HLR[Dea]EYQDLLNVK 374,377, GN= INAPE= 1SV= 2 (SEQIDNO:437) Q92752 Tenascin-ROS= HomosapiensGN= R[Dea]HAVLMGLQPATEYIVNLVAVHGTVTSEPI 827, TNRPE= 1SV= 3 VGSITTGIDPPK (SEQIDNO:438) O94811 Tubulinpolymerization-promoting AISSPTVSR[Dea]LTDTTK 165, proteinOS= HomosapiensGN= (SEQIDNO:439) TPPPPE= 1SV= 1 P30048 Thioredoxin-dependentperoxide HLSVNDLPVGRSVEETLR[Dea]LVK 214, reductase,OS= HomosapiensGN= (SEQIDNO:440) PRDX3PE= 1SV= 3 Q9Y570 Proteinphosphatasemethylesterase R[Dea]DFSPVPWSQYFESMEDVEVENETGK 39, 1OS= HomosapiensGN= PPME1 (SEQIDNO:441) PE= 1SV= 3 P69891 Hemoglobinsubunitgamma-1 MVTAVASALSSR[Dea]YH 145, OS= HomosapiensGN= HBG1 (SEQIDNO:442) PE= 1SV= 2 Q5T9B7 Adenylatekinaseisoenzyme1 GQLVPLETVLDMLR[Dea]DAMVAK 93, OS= HomosapiensGN= AK1PE= 1 (SEQIDNO:443) SV= 1 F5GXJ9 CD166antigenOS= Homosapiens PDGSPVFIAFR[Dea]SSTK 20, GN= ALCAMPE= 1SV= 1 (SEQIDNO:444) Q6PUV4 Complexin-2OS= HomosapiensGN= AALEQPC[CAM]EGSLTR[Dea]PK 90,96, CPLX1PE= 1SV= 2 (SEQIDNO:445) Q5T6W5 Heterogeneousnuclear R[Dea]PAEDMEEEQAFK 22, ribonucleoproteinKOS= Homo (SEQIDNO:446) sapiensGN= HNRNPKPE= 1SV= 1 Q9NQR4 Omega-amidaseNIT2OS= Homo R[Dea]SDLYAVEMK 265, sapiensNG= NIT2PE= 1SV= 1 (SEQIDNO:447) P48426 Phosphatidylinositol5-phosphate R[Dea]FLDFIGHILT 396, 4-kinassetype-2alphaOS= Homo (SEQIDNO:448) sapiensGN= PIP4K2APE= 1SV= 2 Q4J6C6 Prolylendopeptidase-like LMR[Dea]TAADTPAIMNWDLFFTMK 326, OS= HomosapiensGN= PREPL (SEQIDNO:449) PE= 1SV= 1 P61106 Ras-relatedproteinRab-14 ADLEAQR[Dea]DVTYEEAK 132, OS= HomosapiensGN= RAB14 (SEQIDNO:450) PE= 1SV= 4 Q99447 Ethanolamine-phosphate GPPVFTQEER[Dea]YK 76, cytidylyltrasferaseOS= Homo (SEQIDNO:451) sapiensGN= PCYT2PE= 1SV= 1 P48506 Glutamate--cysteineligase SR[Dea]YDSIDSYLSK 328, catalyticsubunitOS= Homosapiens (SEQIDNO:452) GN= GCLCPE= 1SV= 2 P27361 Mitogen-activatedproteinkinase3 R[Dea]ITVEEALAHPYLEQYYDPTDEPVAEEPFT 318, OS= HomosapiensGN= MAPK3PE= 1 FAMELDDLPK SV= 4 (SEQIDNO:453) B1AKZ3 AstrocyticphosphoproteinPEA-15 LTR[Dea]IPSAK 122, OS= HomosapiensGN= PEA15 (SEQIDNO:454) PE= 1SV= 1 P12036 Neurofilamentheavypolypeptide EQLQALNDR[Dea]FAGYIDK 107, OS= HomosapiensGN= NEFHPE= 1 (SEQIDNO:455) SV= 4 P62333 26Sproteaseregulatorysubunit IHIDLPNEQAR[Dea]LDILK 309, 10BOS= HomosapiensGN= PSMC6 (SEQIDNO:456) PE= 1SV= 1 P36578 60SribosomalproteinL4 GHR[Dea]IEEVPELPLVVEDK 143, OS= HomosapiensGN= RPL4PE= 1 (SEQIDNO:457) SV= 5 P13861 cAMP-dependentproteinkinasetype NLDQEQLSQVLDAMFER[Dea]IVK 158, II-alpharegulatorysubunit (SEQIDNO:4589) OS= HomosapiensGN= PRKAR2A PE= 1SV= 2 Q8WW12 PESTproteolyticsignal-containing R[Dea]SAEEEAADLPTKPTK 52, nuclearproteinOS= Homosapiens (SEQIDNO:459) GN= PNCPPE= 1SV= 2 P50897 Palmitoyl-1-proteinthioesterase1 ETIPLQETSLYTQDR[Dea]LGLK 268, OS= HomosapiensGN= PPT1PE= 1 (SEQIDNO:460) SV= 1 Q9UJU6 Drebrin-likeproteinOS= Homo ESGR[Dea]FQDVGPQAPVGSVYQK 148, sapiensGN= DBNLPE= 1SV= 1 (SEQIDNO:461) Q14019 Coactosin-likeproteinOS= Homo FALITWIGENVSGLQR[Dea]AK 91, sapiensGN= COTL1PE= 1SV= 3 (SEQIDNO:462) Q8TEA8 D-tyrosyl-tRNA(Tyr)deacylase1 ILNLR[Dea]VFEDESGK 53, OS= HomosapiensGN= DTD1PE= 1 (SEQIDNO:463) SV= 2 H0Y7Q1 Arf-GAPwithdualPHdomain- AVDR[Dea]PMLPQEYAVEAHFK 340, containingprotein1(Fragment) (SEQIDNO:464) OS= HomosapiensGN= ADAP1 PE= 1SV= 1 O00401 NeuralWiskott-Aldrichsyndrome AALLDQIR[Dea]EGAQLK 414, proteinOS= HomosapiensGN= (SEQIDNO:465) WASLPE= 1SV= 2 O94772 Lymphocyteantigen6HOS= Homo R[Dea]HFFSDYLMGFINSGILK 82, sapiensGN= LY6HPE= 2SV= 1 (SEQIDNO:466) A8MX49 Proteinphosphatase1FOS= Homo APGTVLSQEEVEGELAELAMGFLGSR[Dea]K 69, sapiensGN= PPM1FPE= 1SV= 2 (SEQIDNO:467) O95336 6-phosphogluconolactonase IVAPISDSPKPPPQR[Dea]VTLTLPVLNAAR 185,197, OS= HomosapiensGN= PGLSPE= 1 [Dea]TVIFVATGEGK SV= 2 (SEQIDNO:468) O43708 Maleylacetoacetateisomerase R[Dea]ASVR[Dea]MISDLIAGGIQPLQNLSVLK 96,100, OS= HomosapiensGN= GSTZ1 (SEQIDNO:469) PE= 1SV= 3 Q9UI12 ATPaseinhibitorOS= Homosapiens GSDQSENVDR[Dea]GAGSIR[Dea]EAGGAFGK 35,41, GN= ATPIF1PE= 1SV= 1 (SEQIDNO:470) Q9P1F3 CostarsfamilyproteinAVRACL IGVLFR[Dea]KKD 35, OS= HomosapiensGN= AVRACL (SEQIDNO:471) PE= 1SV= 1 P62851 40SribosomalproteinS25 IR[Dea]GSLAR[Dea]AALQELLSK 80,85, OS= HomosapiensGN= RPS25 (SEQIDNO:472) PE= 1SV= 1 C9J0K6 SorcinOS= HomosapiensGN= SRI ALTTMGFR[Dea]LSPQAVNSIAK 92, PE= 1SV= 1 (SEQIDNO:473) Q9NVJ2 ADP-ribosylationfactor-like R[Dea]DLPNALDEK 132, protein8BOS= HomosapiensGN= (SEQIDNO:474) ARL8BPE= 1SV= 1
TABLE-US-00011 TABLE5A Citrullinatedpeptidesobservedinchronicneurodegenerativedisease. Thesecitrullinatedpeptidesarebrainspecific. UniProtKB Peptide Accessions Name ADDGR[Dea]PFPQVIK sp|P04075-2| Isoform2ofFructose-bisphosphatealdolaseA (SEQIDNO:355) ALDOA_HUMAN OS= HomosapiensGN= ALDOA EVVIVSATR[Dea]TPIGSLFLGSLS sp|P24752| Acetyl-CoAacetyltransferase LLPATK THIL_HUMAN (SEQIDNO:402) RGETSGR[Dea]VDDNEETIK sp|P00568| Adenylatekinaseisoenzyme1 (SEQIDNO:1) KAD1_HUMAN OS= HomosapiensGN= AK1PE= 1SV= 3 PGVVHVIDIDR[Dea]GEEK sp|P55087| Aquaporin-4OS= HomosapiensGN= AQP4PE= 1 (SEQIDNO:475) AQP4_HUMAN SV= 2 IPVGPETLGR[Dea]IMNVIGEPIDE sp|P06576| ATPsynthasesubunitbeta,OS= Homosapiens RGPIK ATPB_HUMAN GN= ATP5BPE= 1SV= 3 (SEQIDNO:476) SVHR[Dea]GEVPCTVTTASPLDDAV sp|P48047| ATPsynthasesubunitO,OS= HomosapiensGN= LSELK ATPO_HUMAN ATP5OPE= 1SV= 1 (SEQIDNO:477) GILR[Dea]TPDTIR[Dea]R[Dea] sp|Q00610| Clathrinheavychain1 FQSVPAQPGQTSPLLQYFGILLDQGQ CLH1_HUMAN LNK (SEQIDNO:348) ELEEDFIR[Dea]SELK sp|Q14019| Coactosin-likeproteinOS= HomosapiensGN= (SEQIDNO:478) COTL1_HUMAN COTL1PE= 1SV= 3 DLFDPIIEDR[Dea]HGGYK sp|P12277| CreatinekinaseB-typeOS= HomosapiensGN= (SEQIDNO:363) KCRB_HUMAN CKBPE= 1SV= 1 EGNASGVSLLEALDTILPPTR[Dea] sp|Q05639| Elongationfactor1-alphaOS= HomosapiensGN= PTDK EF1A2_HUMAN EEF1A2PE= 1SV= 1 (SEQIDNO:479) GHQAAEIEWLGFR[Dea]K sp|Q8TAM6| Ermin (SEQIDNO:428) ERMIN_HUMAN EELER[Dea]QAVDQIK sp|P15311| Ezmin (SEQIDNO:373) ERZI_HUMAN EIR[Dea]TQYEAMASSNMHEAEEWY sp|P14136| Glialfibrillaryacidicprotein RSK GFAP_HUMAN (SEQIDNO:316) FADLTDAAAR[Dea]NAELLR[Dea] sp|P14136| Glialfibrillaryacidicprotein QAK GFAP_HUMAN (SEQIDNO:315) GYFEDRR[Dea]PSANCDPYAVTEAI sp|P15104| GlutaminesynthetaseOS= HomosapiensGN= GLUL VRTCLLNETGDEPFQYK GLNA_HUMAN PE= 1SV= 4 (SEQIDNO:480) RLIGRR[Dea]FDDAVVQSDMK sp|P11142| Heatshockcognate71kDaprotein (SEQIDNO:481) HSP7C_HUMAN OS= HomosapiensGN= HSPA8PE= 1SV= 1 VGAHAGEYGAEALER[Dea]MFL sp|P69905| Hemoglobinsubunitalpha (SEQIDNO:340) HBA_HUMAN LGRLLVVYPWTQR[dea]YFDSFGDL sp|P69892| Hemoglobinsubunitgamma-2OS= Homosapiens SSASAIMGNAK HGB2_HUMAN GN= HBG2PE= 1SV= 2 (SEQIDNO:482) ESLLFEGR[Dea]ITPELLTRGK sp|P19367| Hexokinase-1OS= HomosapiensGN= HK1PE= 1 (SEQIDNO:483) HXK1_HUMAN SV= 3 RSTITSR[Dea]EVQTAVR[Dea]LL sp|Q8N257| HistoneH2Btype3-BOS= HomosapiensGN= LPGELAK H2B3B_HUMAN HIST3B2BBPE= 1SV= 3 (SEQIDNO:484) CR[Dea]EVAENCK sp|P50213| Isocitratedehydrogenase[NAD] subunitalpha, (SEQIDNO:485) IDH3A_HUMAN OS= HomosapiensGN= IDH3APE= 1SV= 1 CR[Dea]APEVSQYIYQVYDSILK sp|P63010-2| Isoform2ofAP-2complexsubunitbeta (SEQIDNO:486) AP2B1_HUMAN OS= HomosapiensGN= AP2B1 GILR[Dea]TPDTIR[dea]RFQSVP sp|Q00610-2| Isoform2ofClathrinheavychain1OS= Homo AQPGQTSPLLQYFGILLDQGQLNK CLH1_HUMAN sapiensGN= CLTC (SEQIDNO:487) PTIFIQE[Dea]RDPTNIK sp|P04406-2| Isoform2ofGlyceraldehyde-3-phosphate (SEQIDNO:488) G3P_HUMAN dehydrogenaseOS= HomosapiensGN= GAPDH GCDVVVIPAGVPR[Dea]K sp|P40926-2| Isoform2ofMalatedehydrogenase,OS= Homo (SEQIDNO:489) MDHM_HUMAN sapiensGN= MDH2 HR[Dea]DTGILDSIGRFFSGDR sp|P02686-2| Isoform2ofMyelinbasicproteinOS= Homo [Dea]GAPK MBP_HUMAN sapiensGN= MBP (SEQIDNO:490) ER[Dea]LDQPMTEIVSR[Dea]VSK sp|P22314-2| Isoform2ofUbiquitin-likemodifier-activating (SEQIDNO:491) UBA1_HUMAN enzyme1OS= HomosapiensGN= UBA1 LLVSSEDYGR[dea]DLTGVQNLRK sp|Q13813-3| Isoform3ofSpectrinalphachain,non- (SEQIDNO:492) SPTN1_HUMAN erythrocytic1OS= HomosapiensGN= UBA1 VAVTPPGLAR[Dea]EDWK sp|P28331-4| Isoform4ofNADH-ubiquinoneoxidoreductase75 (SEQIDNO:493) NDUS1_HUMAN kDasubunit,OS= HomosapiensGN= NDUFS1 VR[Dea]IQTQPGYAN sp|Q00325-2| IsoformBofPhosphatecarrierprotein, (SEQIDNO:494) MPCP_HUMAN OS= HomosapiensGN= SLC25A3 RIER[Dea]ELAEAQDDSILK sp|P30530-2| IsoformShortofTyrosine-proteinkinasereceptor (SEQIDNO:495) UFO_HUMAN UFOOS= HomosapiensGN= AXL SR[Dea]LQTAPVPMPDLK sp|P10636| Microtubule-associatedproteintau (SEQIDNO:377) TAU_HUMAN KRDTGILDSIGRFFGGDR[Dea]GAP sp|P02686| Myelinbasicprotein K MBP_HUMAN (SEQIDNO:496) SHGR[Dea]TQDENPVVHF sp|P02686| Myelinbasicprotein (SEQIDNO:330) MBP_HUMAN EGQRPGFGYGGR[Dea]ASDYK sp|P02686| Myelinbasicprotein (SEQIDNO:332) MBP_HUMAN GAEGQRPGFGYGGR[Dea]ASDYK sp|P02686| Myelinbasicprotein (SEQIDNO:325) MBP_HUMAN GEAAAER[Dea]PGEAAVASSPSK sp|P29966| Myristoylatedalanine-richC-kinasesubstrate (SEQIDNO:375) MARCS_HUMAN GPGPGGPGGAGVAR[Dea]GGAGGGP sp|Q92686| Neurogranin SGD NEUG_HUMAN (SEQIDNO:429) TDEGIAYR[Dea]GLFIIDGK sp|P32119| Peroxiredoxin-2 (SEQIDNO:414) PRDX2_HUMAN VRIQTQPGYANTLR[Dea]DAAPK sp|F8VVM2| Phosphatecarrierprotein, (SEQIDNO:313) F8VVM2_HUMAN GIIDSTHTEQR[Dea]QVVAVTGDGT sp|Q01814| Plasmamembranecalcium-transportingATPase2 NDGPALK AT2B2_HUMAN (SEQIDNO:366) EAFQNAYLELGGLGER[Dea]VLGFC sp|P13637| Sodium/potassium-transportingATPasesubunit HYYLPEEQFPK AT1A3_HUMAN alpha-3OS= HomosapiensGN= ATP1A3PE= 1 (SEQIDNO:497) SV= 3 VLENAEGAR[Dea]TTPSVVAFTADG s{|P38646| Stress-70protein,OS= HomosapiensGN= HSPA9 ER[Dea]LVGMPAK GRP75_HUMAN PE= 1SV= 2 (SEQIDNO:360) RIHVLPIDDTVEGITGNLFEVYLK sp|P55072| TransitionalendoplasmicreticulumAPTase (SEQIDNO:498) TERA_HUMAN OS= HomosapiensGN= VCPPE= 1SV= 4 HVPR[Dea]AVFVDLEPTVIDEIRNG sp|P68366| Tubulinalpha-4AchainOS= HomosapiensGN= PYRQLFHPEQLITGK TBA4A_HUMAN TUBA4APE= 1SV= 1 (SEQIDNO:499) FWEVISDEHGIDPSGNYVGSDLQLER sp|Q13509| Tubulinbeta-3chain [Dea]ISVYYNEASSHK TBB3_HUMAN (SEQIDNO:423) AILVDLEPGTMDSVRS[Dea]GAFGH sp|Q13509| Tubulinbeta-3chainOS= HomosapiensGN= TUBB3 LFR[Dea]PDNFIFGQSGAGNNWAK TBB3_HUMAN PE= 1SV= 2 (SEQIDNO:500) GHYTEGAELVDAVLDVVR[Dea]K sp|P04350| Tubulinbeta (SEQIDNO:405) TBB4A_HUMAN AISSPTVSR[Dea]LTDTTK sp|O94811| Tubulinpolymerization-promotingprotein (SEQIDNO:439) TPPP_HUMAN TVETR[Dea]DGQVINETSQHHDDLE sp|P08670| Vimentin (SEQIDNO:321) VIME_HUMAN
TABLE-US-00012 TABLE5B Citrullinatedpeptidesobservedinchronicneurodegenerativedisease. Thesecitrullinatedpeptidesarenotbrainspecific. UniProtKB Peptide Accessions ProteinName AVLDVAETGTEAAAATGVIGGIRK sp|Q96P15-3| Isoform3ofSerpinB11OS= Homosapiens (SEQIDNO:501) SPB11_HUMAN GN= SERPINB11 GFPVVLDSPRDGNLK sp|Q9Y2J8| Protein-argininedeiminasetype-2 (SEQIDNO:502) PADI2_HUMAN OS= HomosapiensGN= PADI2PE= 1SV= 2 GPDRLPAGYEIVLYISMSDSDK sp|Q9Y2J8| Proteinarginingdeiminasetype-2 (SEQIDNO:503) PADI2_HUMAN OS= HomosapiensGN= PADI2PE= 1SV= 2 RFSMVIDNGIVK sp|P30044| Peroxidoxin-5,OS= HomosapiensGN= PRDX5 (SEQIDNO:504) PRDX5_HUMAN PE= 1SV= 4
TABLE-US-00013 TABLE6A Citrullinatedpeptidedetectedinacquiredbraininjuryinhumanbrains. Thesecitrullinatedpeptidesarebrainspecific UniProtKB Peptide Accessions ProteinName AQQRDVDGATLARLDLEK sp|Q16352| Alpha-internexinOS= HomosapiensGN= INA (SEQIDNO:505) AINX_HUMAN PE= 1SV= 2 AVTELNEPLSNEDR[Dea]NLLSVAYK sp|Q04917| 14-3-3proteinetaOS= HomosapiensGN= (SEQIDNO:506) 1433F_HUMAN YWHAHPE= 1SV= 4 AVTEQGAELSNEER[dea]NLLSVAYK sp|P27348| 14-3-3proteinthetaOS= HomosapiensGN= (SEQIDNO:507) 143T_HUMAN YWHAQPE= 1SV= 1 VVR[Dea]TALLDAAGVASLLTTAEVV sp|P10809| 50kDaheatshockprotein VTEIPK CH60_HUMAN (SEQIDNO:285) LEAPDADELPR[Dea]SDFDPGQDTYQ sp|Q99798| Aconitatehydratase,OS= HomosapiensGN= HPPK ACON_HUMAN ACO2PE= 1SV= 2 (SEQIDNO:508) LSEELSGGR[Dea]LK sp|P61158| Actin-relatedprotein3OS= Homosapiens (SEQIDNO:509) ARP3_HUMAN GN= ACTR3PE= 1SV= 3 ILIPWLLSPER[Dea]LDIK sp|Q8WXF7| Atlastin-1OS= HomosapiensGN= ATL1 (SEQIDNO:510) ATLA1_HUMAN PE= 1SV= 1 LR[Dea]FPAEDEFPDLSSHNNHMAK sp|P12277| CreatinekinaseB-typeOS= Homosapiens (SEQIDNO:511) KCRB_HUMAN GN= CKBPE= 1SV= 1 ITR[Dea]TSFLDDAFRK sp|Q14204| Cytoplasmicdynein1heavychain1 (SEQIDNO:512) DYHC1_HUMAN OS= HomosapiensGN= DYNC1H1PE= 1SV= 5 DNFTLIPEGTNGTEER[Dea]MSVIWD sp|Q16555| Dihydropyrimidinase-relatedprotein2 K YL2_HUMAN OS= HomosapiensGN= DPYSL2PE= 1SV= 1 (SEQIDNO:513) MVEGFFDR[Dea]GASIVEDK sp|P49448| Glutamatedehydrogenase2,OS= Homosapiens (SEQIDNO:514) DHE4_HUMAN GN= GLUD2PE= 1SV= 2 GDYYR[Dea]YLAEVAAGDDK sp|P63104-2| Isoform2of14-3-3proteinzeta/delta (SEQIDNO:515) I433Z_HUMAN OS= HomosapiensGN= YWHAZ R[Dea]ALVFQPVTELK sp|P08237-2| Isoform2ofATP-dependent6-phosphofructo- (SEQIDNO:516) PFKAM_HUMAN kinase,muscletypeOS= Homosapiens GN= PFKM R[Dea]VIISAPSADAPMFVMGVNHEK sp|P04406-2| Isoform2ofGlyceraldehyde-3-phosphate (SEQIDNO:125) G3P_HUMAN dehydrogenaseOS= HomosapiensGN= GAPDH NSPLVSR[Dea]LTLYDIAHTPGVAAD sp|P40926-2| Isoform2ofMalatedehydrogenase, LSHIETR[Dea]ANVK MDHM_HUMAN OS= HomosapiensGN= MDH2 (SEQIDNO:518) HEGFE[Dea]DLAALGDK sp|Q13813-2| Isoform2ofSpectrinalphachain,non- (SEQIDNO:519) SPTN1_HUMAN erythrocytic1OS= HomosapiensGN= SPTAN1 LFVTNDAATILR[Dea]ELEVQHPAAK sp|P50990-2| Isoform2ofT-complexprotein1subunit (SEQIDNO:520) TCPQ_HUMAN thetaOS= HomosapiensGN= CCT8 GR[Dea]GITGIEDK sp|29401-2| Isoform2ofTransketolaseOS= Homosapiens (SEQIDNO:521) TKT_HUMAN GN= TKT PHSVSLNDTETR[Dea]K sp|Q9P0L0-2| Isoform2ofVesicle-associatedmembrane (SEQIDNO:522) VAPA_HUMAN protein-associatedproteinAOS= HomosapiensGN= VAPA MDIRG[Dea]AVDAAVPTNIIAAK sp|Q9UI12-2| Isoform2ofV-typeprotonATPasesubunitH (SEQIDNO:523) VATH_HUMAN OS= HomosapiensGN= ATP6V1H TDDYGR[Dea]DLSSVQTLLTK sp|Q13813-3| Isoform3ofSpectrinalphachain,non- (SEQIDNO:524) SPTN1_HUMAN erythrocytic1OS= HomosapiensGN= SPTAN1 R[Dea]LVPGGGATEIELAK sp|P50990-3| Isoform3ofT-complexprotein1subunit (SEQIDNO:525) TCP1_HUMAN thetaOS= HomosapiensGN= CCT8 VR[Dea]LLADPTGAFGK sp|P30044-4| Isoform4ofPeroxiredoxin-5,OS= Homo (SEQIDNO:265) PRDX5_HUMAN sapiensGN= PRDX5 R[Dea]GFGFVTFDDHDPVDK sp|P2266-2| IsoformA2ofHeterogeneousnuclear (SEQIDNO:526) ROA2_HUMAN ribonucleoproteinsA2/B1OS= Homosapiens GN= HNRNPA2B1 IATPR[Dea]GAASPAQK sp|P10636-7| IsoformTau-EofMicrotubule-associated (SEQIDNO:527) TAU_HUMAN proteintauOS= HomosapiensGN= MAPT RVVAEPVELAQEFR[Dea]K sp|O75489| NADHdehydrogenase[ubiquinone] iron-sulfur (SEQIDNO:528) NDUS3_HUMAN protein3,OS= HomosapiensGN= NDUFS3 PE= 1SV= 1 GADEAALAR[Dea]AELEK sp|P07196| NeurofilamentlightpolypeptideOS= Homo (SEQIDNO:529) NFL_HUMAN sapiensGN= NEFLPE= 1SV= 3 QIVWNGPVGVFEWEAFAR[Dea]GTK sp|P00558| PhosphoglyceratekinaseOS= Homosapiens (SEQIDNO:530) PGK1_HUMAN GN= PGK1PE= 1SV= 3 PMQFLGDEETVR[Dea]K sp|P18669| PhosphoglyceratemutaseOS= Homosapiens (SEQIDNO:531) PGAM1_HUMAN GN= PGAM1PE= 1SV= 2 R[Dea]GFGFVYUFQSHDAADK sp|Q4VXU2| Polyadenylate-bindingprotein1-like (SEQIDNO:532) PAP1L_HUMAN OS= HomosapiensGN= PABPC1LPE= 2SV= 1 VPDFSDYR[Dea]RAEVLDSTK sp|P9C7P4| Putativecytochromeb-c1complexsubunit (SEQIDNO:533) UCRIL_HUMAN Rieske-likeprotein1OS= Homosapiens GN= UQCRFS1P1PE= 5SV= 1 R[Dea]DVAGDASESALLK sp|P13637| Sodium/potassium-transportingATPasesubunit (SEQIDNO:534) AT1A3_HUMAN alpha-3OS= HomosapiensGN= ATP1A3PE= 1 SV= 3 DLTSVMR[Dea]LLSK sp|Q01082| Spectrinbetachain,non-erythrocytic1 (SEQIDNO:535) SPTB2_HUMAN OS= HomosapiensGN= SPTBN1PE= 1SV= 2 FMELLEPLSER[Dea]K sp|P38646| Spectrinbetachain,non-erythrocytic1 (SEQIDNO:536) GRP75_HUMAN OS= HomosapiensGN= SPTBN1PE= 1SV= 2 ER[Dea]VEAVNMAEGIIHDTETK sp|P38646| Stress-70proteinOS= HomosapiensGN= (SEQIDNO:537) GRP75_HUMAN HSPA9PE= 1SV= 2 HVLSGTLGIPEHTYR[Dea]SR[Dea] sp|P04216| Thy-1membraneglycoproteinOS= Homo VTLSNQPYIK THY1_HUMAN sapiensGN= THY1PE= 1SV= 2 (SEQIDNO:538) MIIYR[Dea]DLSIHDELFSDIYK sp|P13693| Translationally-controlledtumorprotein (SEQIDNO:539) TCTP_HUMAN OS= HomosapiensGN= TPT1PE= 1SV= 1 TGGAVDR[Dea]LTDTSK sp|Q9BW30| Tubulinpolymerization-promotingprotein (SEQIDNO:540) TPPP3_HUMAN familymember3OS= HomosapiensGN= TPPP3 PE= 1SV= 1 SSEEAVR[Dea]EVHR[Dea]LIEGRA sp|O94811| Tubulinpolymerization-promotingprotein PVISGVTK TPPP_HUMAN OS= HomosapiensGN= TPPPPE= 1SV= 1 (SEQIDNO:541) LLIIGTTSR[Dea]K sp|P46459| Vesicle-fusingATPaseOS= HomosapiensGN= (SEQIDNO:542) NSF_HUMAN NSFPE= 1SV= 3 WGDPVTR[Dea]VLDDGELLVQQTK sp|P46459| Vesicle-fusingATPaseOS= HomosapiensGN= (SEQIDNO:543) NSF_HUMAN NSFPE= 1SV= 3 ITR[Dea]VEMLEIIEAIYK sp|P62760| Visinin-likeprotein1OS= Homosapiens (SEQIDNO:544) VISLI_HUMAN GN= VSNL1PE= 1SV= 2 FPR[dea]YAEIVHLTLPDGTK sp|P21281| V-typeprotonATPasesubunitB,brain (SEQIDNO:545) VATB2_HUMAN isoformOS= HomosapiensGN= ATP6V1B2 PE= 1SV= 3
TABLE-US-00014 TABLE6B Citrullinatedpeptidedetectedinacquiredbraininjuryinhumanbrains. Thesecitrullinatedpeptidesarenotbrainspecific UniProtKB Peptide Accessions Name GDARPAEIDSLWEISK sp|P49821|NDU NADHdehydrogenase[ubiquinone] flavoprotein1, (SEQIDNO:546) V1_HUMAN OS= HomosapiensGN= NDUFV1PE= 1SV= 4 SVVLMSHLGRPDGVPMPDK sp|P00558- Isoform2ofPhosphoglyceratekinase1 (SEQIDNO:547) 2|PGK1_HUMAN OS= HomosapiensGN= PGK1
TABLE-US-00015 TABLE 7 Secreted citrullinated human proteins in chronic brain disease UniProtKB Accessions Protein Name P61764 Syntaxin-binding protein 1; P62805 Histone H4 Q14204 Cytoplasmic dynein 1 heavy chain 1; Q05193 Dynamin-1; P09104 Gamma-enolase; P14625 Endoplasmin precursor; O43301 Heat shock 70 kDa protein 12A P62136 Serine/threonine-protein phosphatase PP1-alpha catalytic subunit; P27797 Calreticulin precursor; P31146 Coronin-1A; P38117 Electron transfer flavoprotein subunit beta; P68871 Hemoglobin subunit beta; P28482 Mitogen-activated protein kinase 1; P27361 Mitogen-activated protein kinase 3; O00232 26S proteasome non-ATPase regulatory subunit 12; P36578 60S ribosomal protein L4; P05387 60S acidic ribosomal protein P2; Q16181 Septin-7; P49588 Alanine--tRNA ligase, cytoplasmic;
TABLE-US-00016 TABLE 8 Non-secreted citrullinated human proteins in chronic brain disease UniProtKB Accessions Protein Name P17600 Synapsin-1; Q99798 Aconitate hydratase, O14810 Complexin-1; Q6PUV4 Complexin-2; Q9Y2J2 Band 4.1-like protein 3; Q92777 Synapsin-2; Q2M2I8 AP2-associated protein kinase 1; P35611 Alpha-adducin; P63010 AP-2 complex subunit beta; O15075 Serine/threonine-protein kinase DCLK1; O94925 Glutaminase kidney isoform, P50213 Isocitrate dehydrogenase [NAD] subunit alpha Q08209 Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform;
TABLE-US-00017 TABLE 9 Secreted citrullinated human proteins in acute brain disease UniProtKB Accessions Protein Name Q86VP6 Cullin-associated NEDD8-dissociated protein 1; P30044 Peroxiredoxin-5,
TABLE-US-00018 TABLE 10 Non-secreted citrullinated human proteins in acute brain disease UniProtKB Accessions Protein Name P63215 Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3 precursor
References for Example 4
[0148] 1. Ren J, Jiang C, Gao X, Liu Z, Yuan Z, Jin C, et al. PhosSNP for systematic analysis of genetic polymorphisms that influence protein phosphorylation. Mol Cell Proteomics 2010, 9:623-634. [0149] 2. Ryu G M, Song P, Kim K W, Oh K S, Park K J, Kim J H. Genome-wide analysis to predict protein sequence variations that change phosphorylation sites or their corresponding kinases. Nucleic Acids Res 2009, 37:1297-1307. [0150] 3. Baka Z, Gyorgy B, Geher P, Buzas E I, Falus A, Nagy G. Citrullination under physiological and pathological conditions. Joint Bone Spine 2012, 79:431-436. [0151] 4. Demoruelle M K, Deane K. Antibodies to citrullinated protein antigens (ACPAs): clinical and pathophysiologic significance. Curr Rheumatol Rep 2011, 13:421-430. [0152] 5. Uysal H, Nandakumar K S, Kessel C, Haag S, Carlsen S, Burkhardt H, et al. Antibodies to citrullinated proteins: molecular interactions and arthritogenicity. Immunol Rev 2010, 233:9-33. [0153] 6. Okada Y, Wu D, Trynka G, Raj T, Terao C, Ikari K, et al. Genetics of rheumatoid arthritis contributes to biology and drug discovery. Nature 2014, 506:376-381. [0154] 7. De Ceuleneer M, Van Steendam K, Dhaenens M, Deforce D. In vivo relevance of citrullinated proteins and the challenges in their detection. Proteomics 2012, 12:752-760. [0155] 8. Raijmakers R, van Beers J J, El-Azzouny M, Visser N F, Bozic B, Pruijn G J, et al. Elevated levels of fibrinogen-derived endogenous citrullinated peptides in synovial fluid of rheumatoid arthritis patients. Arthritis Res Ther 2012, 14:R114. [0156] 9. Stahl D C, Swiderek K M, Davis M T, Lee T D. Data-controlled automation of liquid chromatography/tandem mass spectrometry analysis of peptide mixtures. J Am Soc Mass Spectrom 1996, 7:532-540. [0157] 10. Yates J R, 3rd, Eng J K, McCormack A L, Schieltz D. Method to correlate tandem mass spectra of modified peptides to amino acid sequences in the protein database. Anal Chem 1995, 67:1426-1436. [0158] 11. Gillet L C 1 NP TS, Rst H, Selevsek N, Reiter L, Bonner R, Aebersold R. Targeted data extraction of the MS/MS spectra generated by data-independent acquisition: a new concept for consistent and accurate proteome analysis. Mol Cell Proteomics 2012. [0159] 12. Liu Y, Huttenhain R, Collins B, Aebersold R. Mass spectrometric protein maps for biomarker discovery and clinical research. Expert Rev Mol Diagn 2013, 13:811-825. [0160] 13. Escher C, Reiter L, MacLean B, Ossola R, Herzog F, Chilton J, et al. Using iRT, a normalized retention time for more targeted measurement of peptides. Proteomics 2012, 12:1111-1121. [0161] 14. Crowgey E L, Stabley D L, Chen C, Huang H, Robbins K M, Polson S W, et al. An integrated approach for analyzing clinical genomic variant data from next-generation sequencing. J Biomol Tech 2015, 26:19-28. [0162] 15. Hensen S M, Boelens W C, Bonger K M, van Cruchten R T, van Delft F L, Pruijn G J. Phenylglyoxal-based visualization of citrullinated proteins on Western blots. Molecules 2015, 20:6592-6600. [0163] 16. Hensen S M, Pruijn G J. Methods for the detection of peptidylarginine deiminase (PAD) activity and protein citrullination. Mol Cell Proteomics 2014, 13:388-396. [0164] 17. Stensland M, Holm A, Kiehne A, Fleckenstein B. Targeted analysis of protein citrullination using chemical modification and tandem mass spectrometry. Rapid Commun Mass Spectrom 2009, 23:2754-2762.
[0165] The various methods and techniques described above provide a number of ways to carry out the application. Of course, it is to be understood that not necessarily all objectives or advantages described can be achieved in accordance with any particular embodiment described herein. Thus, for example, those skilled in the art will recognize that the methods can be performed in a manner that achieves or optimizes one advantage or group of advantages as taught herein without necessarily achieving other objectives or advantages as taught or suggested herein. A variety of alternatives are mentioned herein. It is to be understood that some preferred embodiments specifically include one, another, or several features, while others specifically exclude one, another, or several features, while still others mitigate a particular feature by inclusion of one, another, or several advantageous features.
[0166] Furthermore, the skilled artisan will recognize the applicability of various features from different embodiments. Similarly, the various elements, features and steps discussed above, as well as other known equivalents for each such element, feature or step, can be employed in various combinations by one of ordinary skill in this art to perform methods in accordance with the principles described herein. Among the various elements, features, and steps some will be specifically included and others specifically excluded in diverse embodiments.
[0167] Although the application has been disclosed in the context of certain embodiments and examples, it will be understood by those skilled in the art that the embodiments of the application extend beyond the specifically disclosed embodiments to other alternative embodiments and/or uses and modifications and equivalents thereof.
[0168] Preferred embodiments of this application are described herein, including the best mode known to the inventors for carrying out the application. Variations on those preferred embodiments will become apparent to those of ordinary skill in the art upon reading the foregoing description. It is contemplated that skilled artisans can employ such variations as appropriate, and the application can be practiced otherwise than specifically described herein. Accordingly, many embodiments of this application include all modifications and equivalents of the subject matter recited in the claims appended hereto as permitted by applicable law. Moreover, any combination of the above-described elements in all possible variations thereof is encompassed by the application unless otherwise indicated herein or otherwise clearly contradicted by context.
[0169] All patents, patent applications, publications of patent applications, and other material, such as articles, books, specifications, publications, documents, things, and/or the like, referenced herein are hereby incorporated herein by this reference in their entirety for all purposes, excepting any prosecution file history associated with same, any of same that is inconsistent with or in conflict with the present document, or any of same that may have a limiting affect as to the broadest scope of the claims now or later associated with the present document. By way of example, should there be any inconsistency or conflict between the description, definition, and/or the use of a term associated with any of the incorporated material and that associated with the present document, the description, definition, and/or the use of the term in the present document shall prevail.
[0170] It is to be understood that the embodiments of the application disclosed herein are illustrative of the principles of the embodiments of the application. Other modifications that can be employed can be within the scope of the application. Thus, by way of example, but not of limitation, alternative configurations of the embodiments of the application can be utilized in accordance with the teachings herein. Accordingly, embodiments of the present application are not limited to that precisely as shown and described.
[0171] Various embodiments of the invention are described above in the Detailed Description. While these descriptions directly describe the above embodiments, it is understood that those skilled in the art may conceive modifications and/or variations to the specific embodiments shown and described herein. Any such modifications or variations that fall within the purview of this description are intended to be included therein as well. Unless specifically noted, it is the intention of the inventors that the words and phrases in the specification and claims be given the ordinary and accustomed meanings to those of ordinary skill in the applicable art(s).
[0172] The foregoing description of various embodiments of the invention known to the applicant at this time of filing the application has been presented and is intended for the purposes of illustration and description. The present description is not intended to be exhaustive nor limit the invention to the precise form disclosed and many modifications and variations are possible in the light of the above teachings. The embodiments described serve to explain the principles of the invention and its practical application and to enable others skilled in the art to utilize the invention in various embodiments and with various modifications as are suited to the particular use contemplated. Therefore, it is intended that the invention not be limited to the particular embodiments disclosed for carrying out the invention.
[0173] While particular embodiments of the present invention have been shown and described, it will be obvious to those skilled in the art that, based upon the teachings herein, changes and modifications may be made without departing from this invention and its broader aspects and, therefore, the appended claims are to encompass within their scope all such changes and modifications as are within the true spirit and scope of this invention.