Anti-folate receptor alpha antibodies and uses thereof

10101343 ยท 2018-10-16

Assignee

Inventors

Cpc classification

International classification

Abstract

Described herein are antibodies, and antigen-binding fragments thereof, that are specific for folate receptor alpha, related polynucleotides, expression vectors, and cells that express the described antibodies. Also provided are methods of using the described antibodies, and antigen-binding fragments thereof, and related kits. Provided herein are also methods for diagnosing cancers, such as breast cancer, thyroid cancer, colorectal cancer, endometrial cancer, fallopian tube cancer, ovarian cancer, or lung cancer, using the described antibodies, and antigen-binding fragments thereof. The methods involve determining the amount of folate receptor alpha in a sample derived from a subject and comparing this level with the level of folate receptor alpha in a control sample or reference sample.

Claims

1. A method of detecting folate receptor alpha (FR) in a biological sample comprising ovarian cancer cells, comprising exposing the biological sample to an antibody or antigen-binding fragment comprising: a) a light chain CDR1 having the amino acid sequence of SEQ ID NO: 2, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 3, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 4, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 6, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 7, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 8; b) a light chain CDR1 having the amino acid sequence of SEQ ID NO: 10, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 11, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 12, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 14, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 15, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 16; c) a light chain CDR1 having the amino acid sequence of SEQ ID NO: 18, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 19, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 20, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 22, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 23, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 24; or d) a light chain CDR1 having the amino acid sequence of SEQ ID NO: 26, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 27, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 28, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 30, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 31, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 32; and detecting FR.

2. The method of claim 1, wherein the FR is membranous FR.

3. The method of claim 1, wherein the FR is cytoplasmic FR.

4. The method of claim 1, wherein the ovarian cancer cells are serous carcinoma cells, mucinous carcinoma cells, endometrioid carcinoma cells, or clear cell carcinoma cells.

5. The method of claim 1, wherein the biological sample is derived from urine, blood, serum, plasma, saliva, ascites, circulating cells, circulating tumor cells, cells that are not tissue associated, tissues, surgically resected tumor tissue, biopsies, fine needle aspiration samples, or histological preparations.

6. The method of claim 1, further comprising quantifying the FR.

7. The method of claim 6 wherein the step of quantifying the amount of FR present in the biological sample comprises western blot analysis, radioimmunoassay, immunofluorimetry, immunoprecipitation, equilibrium dialysis, immunodiffusion, electrochemiluminescence (ECL) immunoassay, immunohistochemistry, fluorescence-activated cell sorting (FACS) or ELISA assay.

8. A method of detecting folate receptor alpha (FR) in a biological sample comprising ovarian cancer cells, the method comprising exposing the biological sample to a first antibody, or antigen-binding fragment thereof, comprising: a light chain CDR1 having the amino acid sequence of SEQ ID NO: 2, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 3, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 4, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 6, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 7, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 8; a light chain CDR1 having the amino acid sequence of SEQ ID NO: 10, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 11, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 12, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 14, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 15, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 16; a light chain CDR1 having the amino acid sequence of SEQ ID NO: 18, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 19, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 20, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 22, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 23, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 24; or a light chain CDR1 having the amino acid sequence of SEQ ID NO: 26, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 27, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 28, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 30, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 31, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 32; further comprising exposing the biological sample to a second antibody, or antigen-binding fragment thereof, comprising: a light chain CDR1 having the amino acid sequence of SEQ ID NO: 2, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 3, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 4, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 6, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 7, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 8; a light chain CDR1 having the amino acid sequence of SEQ ID NO: 10, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 11, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 12, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 14, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 15, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 16; a light chain CDR1 having the amino acid sequence of SEQ ID NO: 18, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 19, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 20, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 22, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 23, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 24; or a light chain CDR1 having the amino acid sequence of SEQ ID NO: 26, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 27, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 28, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 30, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 31, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 32, wherein the second antibody or antigen-binding fragment is different than the first antibody or antigen-binding fragment, and detecting FR.

9. The method of claim 8, wherein the FR is membranous FR.

10. The method of claim 8, wherein the FR is cytoplasmic FR.

11. The method of claim 8, wherein the ovarian cancer cells are serous carcinoma cells, mucinous carcinoma cells, endometrioid carcinoma cells, or clear cell carcinoma cells.

12. The method of claim 8, wherein the biological sample is derived from urine, blood, serum, plasma, saliva, ascites, circulating cells, circulating tumor cells, cells that are not tissue associated, tissues, surgically resected tumor tissue, biopsies, fine needle aspiration samples, or histological preparations.

13. The method of claim 8, further comprising quantifying the FR.

14. The method of claim 13 wherein the step of quantifying the amount of FR present in the biological sample comprises western blot analysis, radioimmunoassay, immunofluorimetry, immunoprecipitation, equilibrium dialysis, immunodiffusion, electrochemiluminescence (ECL) immunoassay, immunohistochemistry, fluorescence-activated cell sorting (FACS) or ELISA assay.

15. A method of detecting folate receptor alpha (FR) in a biological sample comprising breast cancer cells, comprising exposing the biological sample to an antibody or antigen-binding fragment comprising: a) a light chain CDR1 having the amino acid sequence of SEQ ID NO: 2, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 3, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 4, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 6, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 7, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 8; b) a light chain CDR1 having the amino acid sequence of SEQ ID NO: 10, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 11, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 12, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 14, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 15, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 16; c) a light chain CDR1 having the amino acid sequence of SEQ ID NO: 18, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 19, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 20, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 22, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 23, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 24; or d) a light chain CDR1 having the amino acid sequence of SEQ ID NO: 26, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 27, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 28, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 30, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 31, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 32; and detecting folate receptor alpha (FR).

16. The method of claim 15, wherein the FR is membranous FR.

17. The method of claim 15, wherein the FR is cytoplasmic FR.

18. The method of claim 15, wherein the breast cancer cells are is fibroadenoma cells, cystosarcoma cells, ductal carcinoma in situ cells, invasive lobular carcinoma cells, or invasive ductal carcinoma cells.

19. The method of claim 18, wherein the invasive ductal carcinoma cells are derived from invasive ductal carcinoma that is estrogen receptor (ER)/progesterone receptor (PR)+, ER/PR, Herceptin 2 (Her2)+, Her2, or ER/PR/Her2.

20. The method of claim 15, wherein the biological sample is derived from urine, blood, serum, plasma, saliva, ascites, circulating cells, circulating tumor cells, cells that are not tissue associated, tissues, surgically resected tumor tissue, biopsies, fine needle aspiration samples, or histological preparations.

21. The method of claim 15, further comprising quantifying the FR.

22. The method of claim 21 wherein the step of quantifying the amount of FR present in the biological sample comprises western blot analysis, radioimmunoassay, immunofluorimetry, immunoprecipitation, equilibrium dialysis, immunodiffusion, electrochemiluminescence (ECL) immunoassay, immunohistochemistry, fluorescence-activated cell sorting (FACS) or ELISA assay.

23. A method of detecting folate receptor alpha (FR) in a biological sample comprising breast cancer cells, the method comprising exposing the biological sample to a first antibody, or antigen-binding fragment thereof, comprising: a light chain CDR1 having the amino acid sequence of SEQ ID NO: 2, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 3, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 4, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 6, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 7, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 8; a light chain CDR1 having the amino acid sequence of SEQ ID NO: 10, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 11, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 12, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 14, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 15, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 16; a light chain CDR1 having the amino acid sequence of SEQ ID NO: 18, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 19, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 20, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 22, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 23, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 24; or a light chain CDR1 having the amino acid sequence of SEQ ID NO: 26, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 27, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 28, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 30, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 31, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 32; further comprising exposing the biological sample to a second antibody, or antigen-binding fragment thereof, comprising: a light chain CDR1 having the amino acid sequence of SEQ ID NO: 2, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 3, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 4, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 6, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 7, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 8; a light chain CDR1 having the amino acid sequence of SEQ ID NO: 10, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 11, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 12, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 14, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 15, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 16; a light chain CDR1 having the amino acid sequence of SEQ ID NO: 18, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 19, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 20, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 22, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 23, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 24; or a light chain CDR1 having the amino acid sequence of SEQ ID NO: 26, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 27, a light chain CDR3 having the amino acid sequence of SEQ ID NO: 28, a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 30, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 31, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 32, wherein the second antibody or antigen-binding fragment is different than the first antibody or antigen-binding fragment, and detecting FR.

24. The method of claim 23, wherein the FR is membranous FR.

25. The method of claim 23, wherein the FR is cytoplasmic FR.

26. The method of claim 23, wherein the breast cancer cells are is fibroadenoma cells, cystosarcoma cells, ductal carcinoma in situ cells, invasive lobular carcinoma cells, or invasive ductal carcinoma cells.

27. The method of claim 26, wherein the invasive ductal carcinoma cells are derived from invasive ductal carcinoma that is estrogen receptor (ER)/progesterone receptor (PR)+, ER/PR, Herceptin 2 (Her2)+, Her2, or ER/PR/Her2.

28. The method of claim 23, wherein the biological sample is derived from urine, blood, serum, plasma, saliva, ascites, circulating cells, circulating tumor cells, cells that are not tissue associated, tissues, surgically resected tumor tissue, biopsies, fine needle aspiration samples, or histological preparations.

29. The method of claim 23, further comprising quantifying the FR.

30. The method of claim 29 wherein the step of quantifying the amount of FR present in the biological sample comprises western blot analysis, radioimmunoassay, immunofluorimetry, immunoprecipitation, equilibrium dialysis, immunodiffusion, electrochemiluminescence (ECL) immunoassay, immunohistochemistry, fluorescence-activated cell sorting (FACS) or ELISA assay.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 depicts the migratory patterns of FR by SDS-PAGE under nonreducing conditions. FR was assessed in either native (lane 2) or reduced and alkylated (lane 3) form.

(2) FIG. 2 illustrates amino acid residues of FR (SEQ ID NO:1) that comprise the epitopes (shaded regions) for monoclonal antibodies 9F3, 24F12, and 26B3, as predicted by hydrogen/deuterium exchange mass spectrometry and docking methods.

(3) FIG. 3 shows four western blots of purified recombinant (A) and whole cell lysates (B) from CHO cells expressing FR or FR homologs FR, FR or FR were run on SDS-PAGE gels. Proteins were prepared in sample buffer with or without reducing agents. Panel A, lane 1, molecular weight markers, lanes 2-5. 0.5 g reduced FR, FR, FR, and FR, respectively; lane 6, blank; lanes 7-10, 0.5 g nonreduced FR, FR, FR, and FR, respectively. The positive band represents the only reactive species in each lane and corresponds to a molecular weight of 38 kDa. Panel B, lane 1 molecular weight markers, lane 2 CHO-FR, lane 3, CHO-FR, lane 4 CHO-FR whole cell lysates prepared in sample buffer without reducing agents and fractionated on an SDS-PAGE gel. Each panel is probed with the designated anti-FR mAb labeled on the right. The molecular weights for FR are: FR 38 kDA; FR 30 kDa; FR 28 kDa; FR 26 kDa. The LK26 and BN3.2 antibodies that recognize FR under denatured and nonreduced or reduced conditions, respectively, were used as positive controls.

(4) FIG. 4 shows a formalin-fixed, paraffin-embedded papillary serous ovarian cancer tissue sample probed for the presence of FR with monoclonal antibody 26B3.

(5) FIG. 5 shows FR expression in normal tissues. Normal lung (A) and kidney (B) samples stained with antibody 26B3 demonstrate that expression of FR is highly restricted to epithelial cells and has a predominantly apical distribution (images are 20 magnification).

(6) FIG. 6 provides a graphical representation comparing M-scores for lung adenocarcinoma generated using antibody 26B3 or antibody BN3.2.

(7) FIG. 7 shows FR staining of histologic subtypes of non-small cell lung carcinoma: (A) lung adenocarcinoma at 20, (B) lung adenocarcinoma at 40, (C) lung adenosquamous at 20, and (D) lung squamous cell carcinoma at 40.

(8) FIG. 8 provides a graphical representation comparing M-scores for lung adenocarcinoma duplicate samples (cores) stained with antibody 26B3.

(9) FIG. 9 illustrates the M-score for FR distribution of lung adenocarcinoma and squamous cell carcinoma. The mean M-Scores were 19.84 (18.64) and 1.39 (5.54), respectively (p<0.0001).

(10) FIG. 10 shows FR expression in three lung adenocarcinoma fine needle aspiration (FNA) samples (A), (B), and (C). Staining of cell block material from lymph node FNAs with antibody 26B3 demonstrated successful staining of FR, with expression limited to epithelial cells with an apical distribution.

(11) FIG. 11 illustrates the survival functions (death or censor) for subjects having lung adenocarcinoma who were deemed to be FR positive and FR negative by immunohistochemistry analysis of tissue samples using antibody 26B3.

(12) FIG. 12 shows representative tissue microarray (TMA) images stained with antibody 26B3 at either 20 or 40 magnification for (A) ductal carcinoma in situ, (B)-(D) invasive ductal carcinoma.

(13) FIG. 13 provides a graphical representation of the M-score distribution, as determined by staining with 26B3, relative to the molecular subtype (her-2 (+) and her-2 ()) of the breast cancer sample.

(14) FIG. 14(A-D) show representative histology samples from stage IV, her2 negative breast cancers stained with antibody 26B3 at either 20 or 40 magnification.

(15) FIGS. 15A, 15B, and 15C show representative images of metastatic breast cancer samples obtained by fine needle aspiration stained with antibody 26B3.

(16) FIG. 16 shows FR expression in ovarian serous carcinoma. (A) 3+ strong (right field) and 2+ moderate membrane staining (left upper field) are visible at 10 magnification. (B) Shows the same area as (A) at 20 magnification, confirming a 3+ strong, thick circumferential membrane staining (right field). 2+ moderate membrane staining (left upper field) has a weaker, thinner staining than 3+, and it is circumferential or localized to the luminal borders. (C) shows that 1+ weak membrane staining is limited to the luminal borders and requires 40 magnification to visualize. (D) Ovarian surface epithelial cells and the underlying cortical stromal cells are entirely negative (20 magnification).

(17) FIG. 17 shows FR expression is limited to the luminal borders normal endometrium with weak 1+ and moderate 2+ intensity at 40 magnification (A). Strong (+3) membrane staining can be observed on the luminal borders of atypical complex hyperplasia at 20 magnification (B).

(18) FIG. 18 shows strong (+3) FR membrane staining on the luminal borders of grade 1 adenocarcinoma of endometrium (A). In addition, many tumor cells have 2+ or 3+ cytoplasmic staining (20 magnification). FR membrane staining (2+ and 3+) is present on the luminal borders of grade 2 adenocarcinoma of endometrium; cytoplasmic staining is weak (20 magnification (B). About 50% of the tumor cells of grade 3 adenocarcinoma of endometrium demonstrate 3+ strong, circumferential membrane staining with weak cytoplasmic staining at 40 magnification (C).

(19) FIG. 19 shows adenocarcinoma with squamous metaplasia with about 80% of metaplastic squamous cells with 2+ and 3+ FR membrane staining and 1+ and 2+ FR cytoplasmic staining at 20 magnification (A). Clear cell carcinoma of endometrium tumor cells have large irregular nuclei, prominent nucleoli and abundant clear cytoplasm. The majority of these tumor cells have 2+ or 3+ FR membrane staining at 40 magnification (B).

(20) FIG. 20 shows that ciliated and non-ciliated cells of normal fallopian tube have 3+ FR membrane staining on the luminal and lateral cell borders (A). Cytoplasmic staining is also evident (20 magnification). (B) Chronic salpingitis with abundant lymphocytes and plasma cells in the stroma. Mucosal cells retain 3+ FR staining on the luminal borders (20 magnification). (C) Grade 2 tubal serous adenocarcinoma tumor cells form complex papillary projections and show 3+ FR membrane staining on the luminal and lateral cell borders, with cytoplasmic staining also evident (20 magnification).

(21) FIG. 21 depicts ovarian cortical serous/tubal cysts. Lining cells reveal 3+, strong membrane and cytoplasmic staining (20 magnification).

DETAILED DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS

(22) The following description characterizes antibodies, and antigen-binding fragments thereof, that specifically bind to FR. Also described are related polynucleotides capable of encoding these antibodies, and antigen-binding fragments, cells expressing the antibodies, and antigen-binding fragments, as well as associated vectors and detectable antibody labels. In addition, methods of using the antibodies, and antigen-binding fragments, are described. For example, the provided antibodies, and antigen-binding fragments, may be used to diagnose ovarian, breast, thyroid, colorectal, endometrial, fallopian tube, or lung cancer; monitor ovarian, breast, thyroid, colorectal, endometrial, fallopian tube, or lung cancer progression, regression, or stable disease; to determine whether or not a patient should be treated for cancer, or to determine whether or not a subject is afflicted with FR-expressing cancer and thus may be amenable to treatment with a FR-specific anti-cancer therapeutic.

(23) Definitions

(24) Various terms relating to aspects of the description are used throughout the specification and claims. Such terms are to be given their ordinary meaning in the art unless otherwise indicated. Other specifically defined terms are to be construed in a manner consistent with the definitions provided herein.

(25) As used in this specification and the appended claims, the singular forms a, an, and the include plural referents unless the content clearly dictates otherwise. Thus, for example, reference to a cell includes a combination of two or more cells, and the like.

(26) The term about as used herein when referring to a measurable value such as an amount, a temporal duration, and the like, is meant to encompass variations of up to 10% from the specified value, as such variations are appropriate to perform the disclosed methods. Unless otherwise indicated, all numbers expressing quantities of ingredients, properties such as molecular weight, reaction conditions, and so forth used in the specification and claims are to be understood as being modified in all instances by the term about. Accordingly, unless indicated to the contrary, the numerical parameters set forth in the following specification and attached claims are approximations that may vary depending upon the desired properties sought to be obtained by the present invention. At the very least, and not as an attempt to limit the application of the doctrine of equivalents to the scope of the claims, each numerical parameter should at least be construed in light of the number of reported significant digits and by applying ordinary rounding techniques.

(27) Notwithstanding that the numerical ranges and parameters setting forth the broad scope of the invention are approximations, the numerical values set forth in the specific examples are reported as precisely as possible. Any numerical value, however, inherently contain certain errors necessarily resulting from the standard deviation found in their respective testing measurements.

(28) Isolated means a biological component (such as a nucleic acid, peptide or protein) has been substantially separated, produced apart from, or purified away from other biological components of the organism in which the component naturally occurs, i.e., other chromosomal and extrachromosomal DNA and RNA, and proteins. Nucleic acids, peptides and proteins that have been isolated thus include nucleic acids and proteins purified by standard purification methods. Isolated nucleic acids, peptides and proteins that can be part of a composition and still be isolated if such composition is not part of the native environment of the nucleic acid, peptide, or protein. The term also embraces nucleic acids, peptides and proteins prepared by recombinant expression in a host cell as well as chemically synthesized nucleic acids.

(29) Polynucleotide, synonymously referred to as nucleic acid molecule or nucleic acids, refers to any polyribonucleotide or polydeoxyribonucleotide, which may be unmodified RNA or DNA or modified RNA or DNA. Polynucleotides include, without limitation single- and double-stranded DNA, DNA that is a mixture of single- and double-stranded regions, single- and double-stranded RNA, and RNA that is mixture of single- and double-stranded regions, hybrid molecules comprising DNA and RNA that may be single-stranded or, more typically, double-stranded or a mixture of single- and double-stranded regions. In addition, polynucleotide refers to triple-stranded regions comprising RNA or DNA or both RNA and DNA. The term polynucleotide also includes DNAs or RNAs containing one or more modified bases and DNAs or RNAs with backbones modified for stability or for other reasons. Modified bases include, for example, tritylated bases and unusual bases such as inosine. A variety of modifications may be made to DNA and RNA; thus, polynucleotide embraces chemically, enzymatically or metabolically modified forms of polynucleotides as typically found in nature, as well as the chemical forms of DNA and RNA characteristic of viruses and cells. Polynucleotide also embraces relatively short nucleic acid chains, often referred to as oligonucleotides.

(30) The meaning of substantially the same can differ depending on the context in which the term is used. Because of the natural sequence variation likely to exist among heavy and light chains and the genes encoding them, one would expect to find some level of variation within the amino acid sequences or the genes encoding the antibodies or antigen-binding fragments described herein, with little or no impact on their unique binding properties (e.g., specificity and affinity). Such an expectation is due in part to the degeneracy of the genetic code, as well as to the evolutionary success of conservative amino acid sequence variations, which do not appreciably alter the nature of the encoded protein. Accordingly, in the context of nucleic acid sequences, substantially the same means at least 65% identity between two or more sequences. Preferably, the term refers to at least 70% identity between two or more sequences, more preferably at least 75% identity, more preferably at least 80% identity, more preferably at least 85% identity, more preferably at least 90% identity, more preferably at least 91% identity, more preferably at least 92% identity, more preferably at least 93% identity, more preferably at least 94% identity, more preferably at least 95% identity, more preferably at least 96% identity, more preferably at least 97% identity, more preferably at least 98% identity, and more preferably at least 99% or greater identity. Such identity may be determined using nBLAST algorithm (Altschul et al., (1990) Proc. Natl. Acad. Sci. USA 87:2264-8; Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-7).

(31) The degree of variation that may occur within the amino acid sequence of a protein without having a substantial effect on protein function is much lower than that of a nucleic acid sequence, since the same degeneracy principles do not apply to amino acid sequences. Accordingly, in the context of an antibody or antigen-binding fragment, substantially the same means antibodies or antigen-binding fragments having 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the antibodies or antigen-binding fragments described. Other embodiments include FR specific antibodies, or antigen-binding fragments, that have framework, scaffold, or other non-binding regions that do not share significant identity with the antibodies and antigen-binding fragments described herein, but do incorporate one or more CDRs or other sequences needed to confer binding that are 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to such sequences described herein.

(32) A vector is a replicon, such as plasmid, phage, cosmid, or virus in which another nucleic acid segment may be operably inserted so as to bring about the replication or expression of the segment.

(33) A cell has been transformed when exogenous or heterologous nucleic acids such as DNA have been introduced inside the cell. The transforming DNA may or may not be integrated (covalently linked) into the genome of the cell. In prokaryotes, yeast, and mammalian cells for example, the transforming DNA may be maintained on an episomal element such as a plasmid. With respect to eukaryotic cells, a stably transformed cell, or stable cell is demonstrated by the ability of the eukaryotic cell to establish cell lines or clones comprised of a population of daughter cells containing the transforming DNA. A clone is a population of cells derived from a single cell or common ancestor by mitosis. A cell line is a clone of a primary cell that is capable of stable growth in vitro for many generations. In some examples provided herein, cells are transformed by transfecting the cells with DNA.

(34) The terms express and produce are used synonymously herein, and refer to the biosynthesis of a gene product. These terms encompass the transcription of a gene into RNA. These terms also encompass translation of RNA into one or more polypeptides, and further encompass all naturally occurring post-transcriptional and post-translational modifications. The expression or production of an antibody or antigen-binding fragment thereof may be within the cytoplasm of the cell, or into the extracellular milieu such as the growth medium of a cell culture.

(35) The terms treating or treatment refer to any success or indicia of success in the attenuation or amelioration of an injury, pathology or condition, including any objective or subjective parameter such as abatement, remission, diminishing of symptoms or making the condition more tolerable to the patient, slowing in the rate of degeneration or decline, making the final point of degeneration less debilitating, improving a subject's physical or mental well-being, or prolonging the length of survival. The treatment may be assessed by objective or subjective parameters; including the results of a physical examination, neurological examination, or psychiatric evaluations.

(36) Antibody refers to all isotypes of immunoglobulins (IgG, IgA, IgE, IgM, IgD, and IgY) including various monomeric and polymeric forms of each isotype, unless otherwise specified.

(37) Antigen-binding fragments are any proteinaceous structure that may exhibit binding affinity for a particular antigen. Some antigen-binding fragments are composed of portions of intact antibodies that retain antigen-binding specificity of the parent antibody molecule. For example, antigen-binding fragments may comprise at least one variable region (either a heavy chain or light chain variable region) or one or more CDRs of an antibody known to bind a particular antigen. Examples of suitable antigen-binding fragments include, without limitation diabodies and single-chain molecules as well as Fab, F(ab)2, Fc, Fabc, and Fv molecules, single chain (Sc) antibodies, individual antibody light chains, individual antibody heavy chains, chimeric fusions between antibody chains or CDRs and other proteins, protein scaffolds, heavy chain monomers or dimers, light chain monomers or dimers, dimers consisting of one heavy and one light chain, and the like. All antibody isotypes may be used to produce antigen-binding fragments. Additionally, antigen-binding fragments may include non-antibody proteinaceous frameworks that may successfully incorporate polypeptide segments in an orientation that confers affinity for a given antigen of interest, such as protein scaffolds. Antigen-binding fragments may be recombinantly produced or produced by enzymatic or chemical cleavage of intact antibodies. The phrase an antibody or antigen-binding fragment thereof may be used to denote that a given antigen-binding fragment incorporates one or more amino acid segments of the antibody referred to in the phrase.

(38) Specific binding when used in the context of antibodies, or antibody fragments, represents binding via domains encoded by immunoglobulin genes or fragments of immunoglobulin genes to one or more epitopes of a protein of interest, but which do not substantially recognize and bind other molecules in a sample containing a mixed population of antigenic molecules. Typically, an antibody binds to a cognate antigen with a Kd of less than about 110-8 M, as measured by a surface plasmon resonance assay or a cell binding assay.

(39) The term subject refers to human and non-human animals, including all vertebrates, e.g., mammals and non-mammals, such as non-human primates, mice, rabbits, sheep, dogs, cats, horses, cows, chickens, amphibians, and reptiles. In many embodiments of the described methods, the subject is a human.

(40) As used herein, the term folate receptor alpha (also referred to as FR, FR-alpha, FOLR-1 or FOLR1) refers to the alpha isoform of the high affinity receptor for folate. Membrane bound FR is attached to the cell surface by a glycosyl phosphatidylinositol (GPI) anchor. Soluble forms of FR may be derived by the action of proteases or phospholipase on membrane anchored folate receptors. The amino acid sequence for human FR is set forth herein as SEQ ID NO: 1. Variants, for example, naturally occurring allelic variants or sequences containing at least one amino acid substitution, are encompassed by the terms as used herein. As will be appreciated by those skilled in the art, cell associated and non-cell associated forms of human FR may encompass variant forms of SEQ ID NO:1.

(41) The term sample as used herein refers to a collection of similar fluids, cells, or tissues (e.g., surgically resected tumor tissue, biopsies, including fine needle aspiration), isolated from a subject, as well as fluids, cells, or tissues present within a subject. In some embodiments the sample is a biological fluid. Biological fluids are typically liquids at physiological temperatures and may include naturally occurring fluids present in, withdrawn from, expressed or otherwise extracted from a subject or biological source. Certain biological fluids derive from particular tissues, organs or localized regions and certain other biological fluids may be more globally or systemically situated in a subject or biological source. Examples of biological fluids include blood, serum and serosal fluids, plasma, lymph, urine, saliva, cystic fluid, tear drops, feces, sputum, mucosal secretions of the secretory tissues and organs, vaginal secretions, ascites fluids such as those associated with non-solid tumors, fluids of the pleural, pericardial, peritoneal, abdominal and other body cavities, fluids collected by bronchial lavage and the like.

(42) Biological fluids may also include liquid solutions contacted with a subject or biological source, for example, cell and organ culture medium including cell or organ conditioned medium, lavage fluids and the like. The term sample, as used herein, encompasses materials removed from a subject or materials present in a subject.

(43) The term progression, as used in the context of progression of an FR-expressing cancer, includes the change of a cancer from a less severe to a more severe state. This could include an increase in the number or severity of tumors, the degree of metastasis, the speed with which the cancer is growing or spreading, and the like. For example, the progression of ovarian cancer includes the progression of such a cancer from a less severe to a more severe state, such as the progression from stage I to stage II, from stage II to stage III, etc.

(44) The term regression, as used in the context of regression of an FR-expressing cancer, includes the change of a cancer from a more severe to a less severe state. This could include a decrease in the number or severity of tumors, the degree of metastasis, the speed with which the cancer is growing or spreading, and the like. For example, the regression of ovarian cancer includes the regression of such a cancer from a more severe to a less severe state, such as the progression from stage III to stage II, from stage II to stage I, etc.

(45) The term stable as used in the context of stable FR-expressing cancer, is intended to describe a disease condition that is not, or has not, changed significantly enough over a clinically relevant period of time to be considered a progressing cancer or a regressing cancer.

(46) The embodiments described herein are not limited to particular methods, reagents, compounds, compositions or biological systems, which can, of course, vary.

(47) FR-Specific Antibodies and Antigen-Binding Fragments

(48) Described herein are isolated monoclonal antibodies or antigen-binding fragments that specifically bind FR. The general structure of an antibody molecule comprises an antigen binding domain, which includes heavy and light chains, and the Fc domain, which serves a variety of functions, including complement fixation and binding antibody receptors.

(49) The described antibodies or antigen-binding fragments include all isotypes, IgA, IgD, IgE, IgG and IgM, and synthetic multimers of the four-chain immunoglobulin structure. The described antibodies or antigen-binding fragments also include the IgY isotype generally found in hen or turkey serum and hen or turkey egg yolk.

(50) The antibodies or antigen-binding fragments disclosed in the examples section are derived from mice. Similar antibodies may be derived from any species by recombinant means. For example, the antibodies or antigen-binding fragments may be chimeric rat, goat, horse, swine, bovine, chicken, rabbit, camelid, donkey, human, and the like. For use in administration to humans, non-human derived antibodies or antigen-binding fragments may be genetically or structurally altered to be less antigenic upon administration to a human patient.

(51) In some embodiments, the antibodies or antigen-binding fragments are chimeric. As used herein, the term chimeric refers to an antibody, or antigen-binding fragment thereof, having at least some portion of at least one variable domain derived from the antibody amino acid sequence of a non-human mammal, a rodent, or a reptile, while the remaining portions of the antibody, or antigen-binding fragment thereof, are derived from a human. For example, a chimeric antibody may comprise a mouse antigen binding domain with a human Fc or other such structural domain.

(52) In some embodiments, the antibodies are humanized antibodies. Humanized antibodies may be chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab, F(ab)2 or other antigen-binding subsequences of antibodies) that contain minimal sequence derived from non-human immunoglobulin. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a complementary-determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity, and capacity. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin sequence. The humanized antibody may include at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.

(53) The antibodies or antigen-binding fragments described herein can occur in a variety of forms, but will include one or more of the antibody variable domain segments or CDRs shown in Table 1. The isotypes of the antibodies described in Table 1 are shown in parentheses to describe the constant region of each antibody, which are known to have conserved sequences.

(54) TABLE-US-00001 TABLE1 Antibodysegmentsofthedescribedantibodiesandantigen-bindingfragmentsthereof (Lc denoteslightchainandHc denotesheavychain). AntibodySegment SEQIDNO. Sequence Monoclonalantibody9F3(murineIgG2aconstantregion) LcCDR1 2 RASSTVSYSYLH LcCDR2 3 GTSNLAS LcCDR3 4 QQYSGYPLT Lcvariabledomain 5 PAIMSASPGEKVTMTCRASSTVSYSYLHWYQQKSGASPQLWIYGTSNLASG segment VPARFSGSGSGTSYSLTISSVEAEDAATYYCQQYSGYPLTFGAGTKLELKR ADAAP HcCDR1 6 SGYYWN HcCDR2 7 YIKSDGSNNYNPSLKN HcCDR3 8 EWKAMDY Hcvariabledomain 9 ESGPGLVRPSQSLSLTCSVTGYSITSGYYWNWIRQFPGSRLEWMGYIKSDG segment SNNYNPSLKNRISITRDTSKNQFFLKLNSVTTEDTATYFCTREWKAMDYWG QGTSVTVSSAKTTPPSVYPLALGCGDT Monoclonalantibody19D4(murineIgG2aconstantregion) LcCDR1 10 RASESVDTYGNNFIH LcCDR2 11 LASNLES LcCDR3 12 QQNNGDPWT Lcvariabledomain 13 PASLAVSLGQRATISCRASESVDTYGNNFIHWYQQKPGQPPKLLIYLASNL segment ESGVPARFSGSGSRTDFTLTIDPVEADDAATYYCQQNNGDPWTFGGGTKLE IKRADAAP HcCDR1 14 HPYMH HcCDR2 15 RIDPANGNTKYDPKFQG HcCDR3 16 EEVADYTMDY Hcvariabledomain 17 GAELVKPGASVKLSCTASGFNIKHPYMHWVKQRPDQGLEWIGRIDPANGNT segment KYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCGREEVADYTMDYW GQGTSVTVSSAKTTAPSVYPLAPV Monoclonalantibody24F12(murineIgG1constantregion) LcCDR1 18 SASQGINNFLN LcCDR2 19 YTSSLHS LcCDR3 20 QHFSKLPWT Lcvariabledomain 21 TSSLSASLGDRVTISCSASQGINNFLNWYQQKPDGTVKLLIYYTSSLHSGV PSRFSGSGSGTDYSLTISNLEPEDIAIYYCQHFSKLPWTFGGGTKLEIKRA DAAP HcCDR1 22 SYAMS HcCDR2 23 EIGSGGSYTYYPDTVTG HcCDR3 24 ETTAGYFDY Hcvariabledomain 25 SGGGLVRPGGSLKLSCAASGFTFSSYAMSWVR QSPEKRLEWVAEIGSGGSYTYYPDTVTGRFTISR DNAKSTLYLEMSSLRSEDTAIYYCARETTAGYF DYWGQGTTLTVSS Monoclonalantibody26B3(murineIgG1constantregion) LcCDR1 26 RTSENIFSYLA LcCDR2 27 NAKTLAE LcCDR3 28 QHHYAFPWT Lcvariabledomain 29 PASLSASVGETVTITCRTSENIFSYLAWYQQKQGISPQLLVYNAKTLAEGV segment PSRFSGSGSGTQFSLKINSLQPEDFGSYYCQHHYAFPWTFGGGSKLEIKRA DAAP HcCDR1 30 GYFMN HcCDR2 31 RIFPYNGDTFYNQKFKG HcCDR3 32 GTHYFDY Hcvariabledomain 33 GPELVKPGASVKISCKASDYSFTGYFMNWVMQSHGKSLEWIGRIFPYNGDT segment FYNQKFKGRATLTVDKSSSTAHMELRSLASEDSAVYFCARGTHYFDYWGQG TTLTVSSAKTTPPSVYPLAPGSAAQT Monoclonalantibody9F3(murineIgG2aconstantregion) LcCDR1 34 AGGGCCAGCTCAACTGTAAGTTACAGTTACTTGCAC LcCDR2 35 GGCACATCCAACTTGGCTTCT LcCDR3 36 CAGCAGTACAGTGGTTACCCACTCACG Lcvariabledomain 37 CCAGCAATCATGTCTGCATCTCCAGGGGAAAAGGTCACCATGACCTGCAGG segment GCCAGCTCAACTGTAAGTTACAGTTACTTGCACTGGTACCAGCAGAAGTCA GGTGCCTCCCCCCAACTCTGGATTTATGGCACATCCAACTTGGCTTCTGGA GTCCCTGCTCGCTTCAGTGGCAGTGGGTCTGGGACCTCTTACTCTCTCACA ATCAGCAGTGTGGAGGCTGAAGATGCTGCCACTTATTACTGCCAGCAGTAC AGTGGTTACCCACTCACGTTCGGTGCTGGGACCAAGCTGGAGCTGAAACGG GCTGATGCTGCACCAAC HcCDR1 38 AGTGGTTATTACTGGAAC HcCDR2 39 TACATAAAGTCCGACGGTAGCAATAATTACAACCCATCTCTCAAAAAT HcCDR3 40 GAGTGGAAGGCTATGGACTAC Hcvariabledomain 41 GAGTCAGGACCTGGCCTCGTGAGACCTTCTCAGTCTCTGTCTCTCACCTGC segment TCTGTCACTGGCTACTCCATCACCAGTGGTTATTACTGGAACTGGATCCGG CAGTTTCCAGGAAGCAGACTGGAATGGATGGGCTACATAAAGTCCGACGGT AGCAATAATTACAACCCATCTCTCAAAAATCGAATCTCCATCACTCGTGAC ACATCTAAGAACCAGTTTTTCCTGAAGTTGAATTCTGTGACTACTGAGGAC ACAGCTACATATTTCTGTACAAGGGAGTGGAAGGCTATGGACTACTGGGGT CAGGGAACCTCAGTCACCGTCTCCTCAGCCAAAACAACACCCCCATCAGTC TATCCACTGGCCCCTGGGTGTGGAGATACAAC Monoclonalantibody19D4(murineIgG2aconstantregion) LcCDR1 42 AGAGCCAGTGAAAGTGTTGATACTTATGGCAATAATTTTATACAC LcCDR2 43 CTTGCATCCAACCTAGAATCT LcCDR3 44 CAGCAAAATAATGGGGATCCGTGGACG Lcvariabledomain 45 CCAGCTTCTTTGGCTGTGTCTCTAGGGCAGAGGGCCACCATATCCTGCAGA segment GCCAGTGAAAGTGTTGATACTTATGGCAATAATTTTATACACTGGTACCAG CAGAAACCAGGACAGCCACCCAAACTCCTCATTTATCTTGCATCCAACCTA GAATCTGGGGTCCCTGCCAGGTTCAGTGGCAGTGGGTCTAGGACAGACTTC ACCCTCACCATTGATCCTGTGGAGGCTGATGATGCTGCAACCTATTACTGT CAGCAAAATAATGGGGATCCGTGGACGTTCGGTGGAGGCACCAAGCTGGAG ATCAAACGGGCTGATGCTGCACCAA HcCDR1 46 CACCCCTATATGCAC HcCDR2 47 AGGATTGATCCTGCGAATGGTAATACTAAATATGACCCGAAGTTCCAGGGC HcCDR3 48 GAGGAGGTGGCGGACTATACTATGGACTAC Hcvariabledomain 49 GGGGCAGAGCTTGTGAAGCCAGGGGCCTCAGTCAAGTTGTCCTGCACAGCT segment TCTGGCTTCAACATTAAACACCCCTATATGCACTGGGTGAAGCAGAGGCCT GACCAGGGCCTGGAGTGGATTGGAAGGATTGATCCTGCGAATGGTAATACT AAATATGACCCGAAGTTCCAGGGCAAGGCCACTATAACAGCAGACACATCC TCCAACACAGCCTACCTACAGCTCAGCAGCCTGACATCTGAGGACACTGCC GTCTATTACTGTGGTAGAGAGGAGGTGGCGGACTATACTATGGACTACTGG GGTCAAGGAACCTCAGTCACCGTCTCCTCAGCCAAAACAACAGCCCCATCG GTCTATCCACTGGCCCCTGTGTG Monoclonalantibody24F12(murineIgG1constantregion) LcCDR1 50 AGTGCAAGTCAGGGCATTAACAATTTTTTAAAC LcCDR2 51 TACACATCAAGTTTACACTCA LcCDR3 52 CAGCACTTTAGTAAGCTTCCGTGGACG Lcvariabledomain 53 ACATCCTCCCTGTCTGCCTCTCTGGGAGACAGAGTCACCATCAGTTGCAGT segment GCAAGTCAGGGCATTAACAATTTTTTAAACTGGTATCAGCAGAAACCAGAT GGCACTGTTAAACTCCTGATCTATTACACATCAAGTTTACACTCAGGAGTC CCATCAAGGTTCAGTGGCAGTGGGTCTGGGACAGATTATTCTCTCACCATC AGCAACCTGGAACCTGAAGATATTGCCATATACTATTGTCAGCACTTTAGT AAGCTTCCGTGGACGTTCGGTGGAGGCACCAAGCTGGAAATCAAACGGGCT GATGCTGCACCAAC HcCDR1 54 AGCTATGCCATGTCT HcCDR2 55 GAAATTGGTAGTGGTGGTAGTTACACCTACTATCCAGACACTGTGACGGGC HcCDR3 56 GAAACTACGGCGGGCTACTTTGACTAC Hcvariabledomain 57 TCTGGGGGAGGCTTAGTGAGGCCTGGAGGGTCCCTGAAACTCTCCTGTGCA segment GCCTCTGGATTCACTTTCAGTAGCTATGCCATGTCTTGGGTTCGCCAGTCT CCAGAGAAGAGGCTGGAGTGGGTCGCAGAAATTGGTAGTGGTGGTAGTTAC ACCTACTATCCAGACACTGTGACGGGCCGATTCACCATCTCCAGAGACAAT GCCAAGAGCACCCTGTACCTGGAAATGAGCAGTCTGAGGTCTGAGGACACG GCCATCTATTACTGTGCAAGGGAAACTACGGCGGGCTACTTTGACTACTGG GGCCAAGGCACCACTCTCACAGTCTCCTCA Monoclonalantibody26B3(murineIgG1constantregion) LcCDR1 58 CGAACAAGTGAGAATATTTTCAGTTATTTAGCA LcCDR2 59 AATGCAAAAACCTTAGCAGAG LcCDR3 60 CAACATCATTATGCTTTTCCGTGGACG Lcvariabledomain 61 CCAGCCTCCCTATCTGCATCTGTGGGAGAAACTGTCACCATCACATGTCGA segment ACAAGTGAGAATATTTTCAGTTATTTAGCATGGTATCAGCAGAAACAGGGA ATATCTCCTCAGCTCCTGGTCTATAATGCAAAAACCTTAGCAGAGGGTGTG CCATCAAGGTTCAGTGGCAGTGGATCAGGCACACAGTTTTCTCTGAAGATC AACAGCCTGCAGCCTGAAGATTTTGGGAGTTATTACTGTCAACATCATTAT GCTTTTCCGTGGACGTTCGGTGGAGGCTCCAAGCTGGAAATCAAACGGGCT GATGCTGCACCAAC HcCDR1 62 GGCTACTTTATGAAC HcCDR2 63 CGTATTTTTCCTTACAATGGTGATACTTTCTACAACCAGAAGTTCAAGGGC HcCDR3 64 GGGACTCATTACTTTGACTAC Hcvariabledomain 65 GGACCTGAGCTGGTGAAGCCTGGGGCTTCAGTGAAGATATCCTGCAAGGCT segment TCTGATTACTCTTTTACTGGCTACTTTATGAACTGGGTGATGCAGAGCCAT GGAAAGAGCCTTGAGTGGATTGGACGTATTTTTCCTTACAATGGTGATACT TTCTACAACCAGAAGTTCAAGGGCAGGGCCACATTGACTGTAGACAAATCC TCTAGCACAGCCCACATGGAGCTCCGGAGCCTGGCATCTGAGGACTCTGCA GTCTATTTTTGTGCAAGAGGGACTCATTACTTTGACTACTGGGGCCAAGGC ACCACTCTCACTGTCTCCTCAGCCAAAACGACACCCCCATCTGTCTATCCA CTGGCCCCTGGATCTGCTGCCCAAACTAA

(55) Described herein are isolated antibodies and antigen-binding fragments that specifically bind to FR. In some embodiments, the antibodies or antigen-binding fragments are murine IgG, or derivatives thereof. While the antibodies or antigen-binding fragments may be human, humanized, or chimeric, the antibodies or antigen-binding fragments exemplified herein are murine. In some embodiments, antibodies or antigen-binding fragments may include a light chain CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 2. In some embodiments, antibodies or antigen-binding fragments may include a light chain CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 3. In some embodiments, antibodies or antigen-binding fragments may include a light chain CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 4. In some embodiments, antibodies or antigen-binding fragments may include a heavy chain CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 6. In some embodiments, antibodies or antigen-binding fragments may include a heavy chain CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 7. In some embodiments, antibodies or antigen-binding fragments may include a heavy chain CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 8. The antibodies or antigen-binding fragments may include a light chain having a CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 2; a CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 3; and a CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 4. The antibodies or antigen-binding fragments may include a heavy chain having a CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 6; a CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 7; and a CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 8. The antibodies or antigen-binding fragments may include a light chain having a CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 2; a CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 3; and a CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 4, and also have a heavy chain having a CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 6; a CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 7; and a CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 8.

(56) The described antibodies or antigen-binding fragments may include a light chain variable domain that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 5. In some embodiments, an isolated polynucleotide that includes a sequence substantially the same as, or identical to, SEQ ID NO: 37 may encode this light chain variable domain amino acid sequence. The described antibodies or antigen-binding fragments may include a heavy chain variable domain that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 9. In some embodiments, an isolated polynucleotide that includes a sequence substantially the same as, or identical to, SEQ ID NO: 41 may encode this heavy chain variable domain amino acid sequence. The described antibodies or antigen-binding fragments may include a light and a heavy chain variable domains, wherein the light chain variable domain includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 5, and the heavy chain variable domain includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 9.

(57) In some embodiments, the antibodies are produced by antibody-producing cells deposited with the American Type Culture Collection (10801 University Blvd., Manassas, Va. 20110-2209) on May 19, 2011 and have been assigned Accession No. PTA-11887. In some embodiments, the antibodies, or antigen-binding fragments thereof, have the binding affinity for FR of the antibodies produced by the deposited antibody-producing cells. In some embodiments, the disclosed antibodies, or antigen-binding fragments thereof, comprise the light and heavy chain CDRs of the antibodies produced by the deposited antibody-producing cells. In some embodiments, the antibodies, or antigen-binding fragments thereof, comprise the light and heavy chain variable regions of the antibodies produced by the deposited antibody-producing cells.

(58) Also disclosed are isolated polynucleotides that encode antibodies or antigen-binding fragments that specifically bind to FR. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a light chain CDR1 sequence substantially the same as, or identical to, SEQ ID NO: 2, for example SEQ ID NO: 34. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a light chain CDR2 substantially the same as, or identical to, SEQ ID NO: 3, for example SEQ ID NO: 35. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a light chain CDR3 substantially the same as, or identical to, SEQ ID NO: 4, for example SEQ ID NO: 36. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a heavy chain CDR1 substantially the same as, or identical to, SEQ ID NO: 6, for example SEQ ID NO: 38. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a heavy chain CDR2 substantially the same as, or identical to, SEQ ID NO: 7, for example SEQ ID NO: 39. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a heavy chain CDR3 substantially the same as, or identical to, SEQ ID NO: 8, for example SEQ ID NO: 40. The isolated polynucleotides may encode an antibody or antigen-binding fragment thereof having a light chain with a CDR1 substantially the same as, or identical to, SEQ ID NO: 2, for example SEQ ID NO: 34; a CDR2 substantially the same as, or identical to, SEQ ID NO: 3, for example SEQ ID NO: 35; and a CDR3 substantially the same as, or identical to, SEQ ID NO: 4, for example SEQ ID NO: 36. The isolated polynucleotides may encode an antibody or antigen-binding fragment thereof having a heavy chain CDR1 substantially the same as, or identical to, SEQ ID NO: 6, for example SEQ ID NO: 38; a CDR2 substantially the same as, or identical to, SEQ ID NO: 7, for example SEQ ID NO: 39; and a CDR3 substantially the same as, or identical to, SEQ ID NO: 8, for example SEQ ID NO: 40. The isolated polynucleotides may encode an antibody or antigen-binding fragment thereof having a light chain CDR1 substantially the same as, or identical to, SEQ ID NO: 2, for example SEQ ID NO: 34; a CDR2 encoded by a nucleotide sequence substantially the same as, or identical to, SEQ ID NO: 3, for example SEQ ID NO: 35; and a CDR3 encoded by a nucleotide sequence substantially the same as, or identical to, SEQ ID NO: 4, for example SEQ ID NO: 36; and a heavy chain CDR1 substantially the same as, or identical to, SEQ ID NO: 6, for example SEQ ID NO: 38; a CDR2 substantially the same as, or identical to, SEQ ID NO: 7, for example SEQ ID NO: 39; and a CDR3 substantially the same as, or identical to, SEQ ID NO: 8, for example SEQ ID NO: 40. Antigen-binding arrangements of CDRs may also be engineered using antibody-like proteins as CDR scaffolding. Such engineered antigen-binding proteins are within the scope of the disclosure.

(59) Polynucleotides described herein may encode antibodies or antigen-binding fragments that have a light chain variable domain segment that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 5, for example SEQ ID NO: 37. In some embodiments the described isolated polynucleotides may encode antibodies or antigen-binding fragments that have a heavy chain variable domain segment that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 9, for example SEQ ID NO: 41. In some embodiments the described isolated polynucleotides may encode antibodies or antigen-binding fragments that have a light chain variable domain segment that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 5, for example SEQ ID NO: 37; and a heavy chain variable domain segment that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 9, for example SEQ ID NO: 41. The isolated polynucleotides capable of encoding the variable domain segments provided herein may be included on the same, or different, vectors to produce antibodies or antigen-binding fragments.

(60) Described herein are isolated antibodies and antigen-binding fragments that specifically bind to FR. In some embodiments, the antibodies or antigen-binding fragments are murine IgG, or derivatives thereof. While the antibodies or antigen-binding fragments may be human, humanized, or chimeric, the antibodies or antigen-binding fragments exemplified herein are murine. In some embodiments, antibodies or antigen-binding fragments may include a light chain CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 10. In some embodiments, antibodies or antigen-binding fragments may include a light chain CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 11. In some embodiments, antibodies or antigen-binding fragments may include a light chain CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 12. In some embodiments, antibodies or antigen-binding fragments may include a heavy chain CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 14. In some embodiments, antibodies or antigen-binding fragments may include a heavy chain CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 15. In some embodiments, antibodies or antigen-binding fragments may include a heavy chain CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 16. The antibodies or antigen-binding fragments may include a light chain having a CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 10; a CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 11; and a CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 12. The antibodies or antigen-binding fragments may include a heavy chain having a CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 14; a CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 15; and a CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 16. The antibodies or antigen-binding fragments may include a light chain having a CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 10; a CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 11; and a CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 12, and also have a heavy chain having a CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 14; a CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 15; and a CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 16.

(61) The described antibodies or antigen-binding fragments may include a light chain variable domain that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 13. In some embodiments, an isolated polynucleotide that includes a sequence substantially the same as, or identical to, SEQ ID NO: 45 may encode this light chain variable domain amino acid sequence. The described antibodies or antigen-binding fragments may include a heavy chain variable domain that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 17. In some embodiments, an isolated polynucleotide that includes a sequence substantially the same as, or identical to, SEQ ID NO: 49 may encode this heavy chain variable domain amino acid sequence. The described antibodies or antigen-binding fragments may include a light and a heavy chain variable domains, wherein the light chain variable domain includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 13, and the heavy chain variable domain includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 17.

(62) In some embodiments, the antibodies are produced by antibody-producing cells deposited with the American Type Culture Collection (10801 University Blvd., Manassas, Va. 20110-2209) on May 19, 2011 and have been assigned Accession No. PTA-11884. In some embodiments, the antibodies, or antigen-binding fragments thereof, have the binding affinity for FR of the antibodies produced by the deposited antibody-producing cells. In some embodiments, the disclosed antibodies, or antigen-binding fragments thereof, comprise the light and heavy chain CDRs of the antibodies produced by the deposited antibody-producing cells. In some embodiments, the antibodies, or antigen-binding fragments thereof, comprise the light and heavy chain variable regions of the antibodies produced by the deposited antibody-producing cells.

(63) Also disclosed are isolated polynucleotides that encode antibodies or antigen-binding fragments that specifically bind to FR. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a light chain CDR1 sequence substantially the same as, or identical to, SEQ ID NO: 10, for example SEQ ID NO: 42. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a light chain CDR2 substantially the same as, or identical to, SEQ ID NO: 11, for example SEQ ID NO: 43. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a light chain CDR3 substantially the same as, or identical to, SEQ ID NO: 12, for example SEQ ID NO: 44. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a heavy chain CDR1 substantially the same as, or identical to, SEQ ID NO: 14, for example SEQ ID NO: 46. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a heavy chain CDR2 substantially the same as, or identical to, SEQ ID NO: 15, for example SEQ ID NO: 47. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a heavy chain CDR3 substantially the same as, or identical to, SEQ ID NO: 16, for example SEQ ID NO: 48. The polynucleotides may encode an antibody or antigen-binding fragment thereof having a light chain with a CDR1 substantially the same as, or identical to, SEQ ID NO: 10, for example SEQ ID NO: 42; a CDR2 substantially the same as, or identical to, SEQ ID NO: 11, for example SEQ ID NO: 43; and a CDR3 substantially the same as, or identical to, SEQ ID NO: 12, for example SEQ ID NO: 44. The polynucleotides may encode an antibody or antigen-binding fragment thereof having a heavy chain CDR1 substantially the same as, or identical to, SEQ ID NO: 14, for example SEQ ID NO: 46; a CDR2 substantially the same as, or identical to, SEQ ID NO: 15, for example SEQ ID NO: 47; and a CDR3 substantially the same as, or identical to, SEQ ID NO: 16, for example SEQ ID NO: 48. The polynucleotides may encode an antibody or antigen-binding fragment thereof having a light chain CDR1 substantially the same as, or identical to, SEQ ID NO: 10, for example SEQ ID NO: 42; a CDR2 encoded by a nucleotide sequence substantially the same as, or identical to, SEQ ID NO: 11, for example SEQ ID NO: 43; and a CDR3 encoded by a nucleotide sequence substantially the same as, or identical to, SEQ ID NO: 12, for example SEQ ID NO: 44; and a heavy chain CDR1 substantially the same as, or identical to, SEQ ID NO: 14, for example SEQ ID NO: 46; a CDR2 substantially the same as, or identical to, SEQ ID NO: 15, for example SEQ ID NO: 47; and a CDR3 substantially the same as, or identical to, SEQ ID NO: 16, for example SEQ ID NO: 48. Antigen-binding arrangements of CDRs may also be engineered using antibody-like proteins as CDR scaffolding. Such engineered antigen-binding proteins are within the scope of the disclosure.

(64) Polynucleotides described herein may encode antibodies or antigen-binding fragments that have a light chain variable domain segment that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 13, for example SEQ ID NO: 45. In some embodiments the described polynucleotides may encode antibodies or antigen-binding fragments that have a heavy chain variable domain segment that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 17, for example SEQ ID NO: 49. In some embodiments the described polynucleotides may encode antibodies or antigen-binding fragments that have a light chain variable domain segment that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 13, for example SEQ ID NO: 45; and a heavy chain variable domain segment that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 17, for example SEQ ID NO: 49. The polynucleotides capable of encoding the variable domain segments provided herein may be included on the same, or different, vectors to produce antibodies or antigen-binding fragments.

(65) Described herein are isolated antibodies and antigen-binding fragments that specifically bind to FR. In some embodiments, the antibodies or antigen-binding fragments are murine IgG, or derivatives thereof. While the antibodies or antigen-binding fragments may be human, humanized, or chimeric, the antibodies or antigen-binding fragments exemplified herein are murine. In some embodiments, antibodies or antigen-binding fragments may include a light chain CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 18. In some embodiments, antibodies or antigen-binding fragments may include a light chain CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 19. In some embodiments, antibodies or antigen-binding fragments may include a light chain CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 20. In some embodiments, antibodies or antigen-binding fragments may include a heavy chain CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 22. In some embodiments, antibodies or antigen-binding fragments may include a heavy chain CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 23. In some embodiments, antibodies or antigen-binding fragments may include a heavy chain CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 24. The antibodies or antigen-binding fragments may include a light chain having a CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 18; a CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 19; and a CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 20. The antibodies or antigen-binding fragments may include a heavy chain having a CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 22; a CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 23; and a CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 24. The antibodies or antigen-binding fragments may include a light chain having a CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 18; a CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 19; and a CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 20, and also have a heavy chain having a CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 22; a CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 23; and a CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 24.

(66) The described antibodies or antigen-binding fragments may include a light chain variable domain that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 21. In some embodiments, an isolated polynucleotide that includes a sequence substantially the same as, or identical to, SEQ ID NO: 53 may encode this light chain variable domain amino acid sequence. The described antibodies or antigen-binding fragments may include a heavy chain variable domain that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 25. In some embodiments, an isolated polynucleotide that includes a sequence substantially the same as, or identical to, SEQ ID NO: 57 may encode this heavy chain variable domain amino acid sequence. The described antibodies or antigen-binding fragments may include a light and a heavy chain variable domains, wherein the light chain variable domain includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 21, and the heavy chain variable domain includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 25.

(67) In some embodiments, the antibodies are produced by antibody-producing cells deposited with the American Type Culture Collection (10801 University Blvd., Manassas, Va. 20110-2209) on May 19, 2011 and have been assigned Accession No. PTA-11886. In some embodiments, the antibodies, or antigen-binding fragments thereof, have the binding affinity for FR of the antibodies produced by the deposited antibody-producing cells. In some embodiments, the disclosed antibodies, or antigen-binding fragments thereof, comprise the light and heavy chain CDRs of the antibodies produced by the deposited antibody-producing cells. In some embodiments, the antibodies, or antigen-binding fragments thereof, comprise the light and heavy chain variable regions of the antibodies produced by the deposited antibody-producing cells.

(68) Also disclosed are polynucleotides that encode antibodies or antigen-binding fragments that specifically bind to FR. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a light chain CDR1 sequence substantially the same as, or identical to, SEQ ID NO: 18, for example SEQ ID NO: 50. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a light chain CDR2 substantially the same as, or identical to, SEQ ID NO: 19, for example SEQ ID NO: 51. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a light chain CDR3 substantially the same as, or identical to, SEQ ID NO: 20, for example SEQ ID NO: 52. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a heavy chain CDR1 substantially the same as, or identical to, SEQ ID NO: 22, for example SEQ ID NO: 54. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a heavy chain CDR2 substantially the same as, or identical to, SEQ ID NO: 23, for example SEQ ID NO: 55. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a heavy chain CDR3 substantially the same as, or identical to, SEQ ID NO: 24, for example SEQ ID NO: 56. The polynucleotides may encode an antibody or antigen-binding fragment thereof having a light chain with a CDR1 substantially the same as, or identical to, SEQ ID NO: 18, for example SEQ ID NO: 50; a CDR2 substantially the same as, or identical to, SEQ ID NO: 19, for example SEQ ID NO: 51; and a CDR3 substantially the same as, or identical to, SEQ ID NO: 20, for example SEQ ID NO: 52. The polynucleotides may encode an antibody or antigen-binding fragment thereof having a heavy chain CDR1 substantially the same as, or identical to, SEQ ID NO: 22, for example SEQ ID NO: 54; a CDR2 substantially the same as, or identical to, SEQ ID NO: 23, for example SEQ ID NO: 55; and a CDR3 substantially the same as, or identical to, SEQ ID NO: 24, for example SEQ ID NO: 56. The polynucleotides may encode an antibody or antigen-binding fragment thereof having a light chain CDR1 substantially the same as, or identical to, SEQ ID NO: 18, for example SEQ ID NO: 50; a CDR2 encoded by a nucleotide sequence substantially the same as, or identical to, SEQ ID NO: 19, for example SEQ ID NO: 51; and a CDR3 encoded by a nucleotide sequence substantially the same as, or identical to, SEQ ID NO: 20, for example SEQ ID NO: 52; and a heavy chain CDR1 substantially the same as, or identical to, SEQ ID NO: 22, for example SEQ ID NO: 54; a CDR2 substantially the same as, or identical to, SEQ ID NO: 23, for example SEQ ID NO: 55; and a CDR3 substantially the same as, or identical to, SEQ ID NO: 24, for example SEQ ID NO: 56. Antigen-binding arrangements of CDRs may also be engineered using antibody-like proteins as CDR scaffolding. Such engineered antigen-binding proteins are within the scope of the disclosure.

(69) Polynucleotides described herein may encode antibodies or antigen-binding fragments that have a light chain variable domain segment that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 21, for example SEQ ID NO: 53. In some embodiments the described polynucleotides may encode antibodies or antigen-binding fragments that have a heavy chain variable domain segment that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 25, for example SEQ ID NO: 57. In some embodiments the described polynucleotides may encode antibodies or antigen-binding fragments that have a light chain variable domain segment that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 21, for example SEQ ID NO: 53; and a heavy chain variable domain segment that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 25, for example SEQ ID NO: 57. The polynucleotides capable of encoding the variable domain segments provided herein may be included on the same, or different, vectors to produce antibodies or antigen-binding fragments.

(70) Described herein are isolated antibodies and antigen-binding fragments that specifically bind to FR. In some embodiments, the antibodies or antigen-binding fragments are murine IgG, or derivatives thereof. While the antibodies or antigen-binding fragments may be human, humanized, or chimeric, the antibodies or antigen-binding fragments exemplified herein are murine. In some embodiments, antibodies or antigen-binding fragments may include a light chain CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 26. In some embodiments, antibodies or antigen-binding fragments may include a light chain CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 27. In some embodiments, antibodies or antigen-binding fragments may include a light chain CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 28. In some embodiments, antibodies or antigen-binding fragments may include a heavy chain CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 30. In some embodiments, antibodies or antigen-binding fragments may include a heavy chain CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 31. In some embodiments, antibodies or antigen-binding fragments may include a heavy chain CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 32. The antibodies or antigen-binding fragments may include a light chain having a CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 26; a CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 27; and a CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 28. The antibodies or antigen-binding fragments may include a heavy chain having a CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 30; a CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 31; and a CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 32. The antibodies or antigen-binding fragments may include a light chain having a CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 26; a CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 27; and a CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 28, and also have a heavy chain having a CDR1 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 30; a CDR2 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 31; and a CDR3 amino acid sequence substantially the same as, or identical to, SEQ ID NO: 32.

(71) The described antibodies or antigen-binding fragments may include a light chain variable domain that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 29. In some embodiments, an isolated polynucleotide that includes a sequence substantially the same as, or identical to, SEQ ID NO: 61 may encode this light chain variable domain amino acid sequence. The described antibodies or antigen-binding fragments may include a heavy chain variable domain that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 33. In some embodiments, an isolated polynucleotide that includes a sequence substantially the same as, or identical to, SEQ ID NO: 65 may encode this heavy chain variable domain amino acid sequence. The described antibodies or antigen-binding fragments may include a light and a heavy chain variable domains, wherein the light chain variable domain includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 29, and the heavy chain variable domain includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 33.

(72) In some embodiments, the antibodies are produced by antibody-producing cells deposited with the American Type Culture Collection (10801 University Blvd., Manassas, Va. 20110-2209) on May 19, 2011 and have been assigned Accession No. PTA-11885. In some embodiments, the antibodies, or antigen-binding fragments thereof, have the binding affinity for FR of the antibodies produced by the deposited antibody-producing cells. In some embodiments, the disclosed antibodies, or antigen-binding fragments thereof, comprise the light and heavy chain CDRs of the antibodies produced by the deposited antibody-producing cells. In some embodiments, the antibodies, or antigen-binding fragments thereof, comprise the light and heavy chain variable regions of the antibodies produced by the deposited antibody-producing cells.

(73) Also disclosed are polynucleotides that encode antibodies or antigen-binding fragments that specifically bind to FR. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a light chain CDR1 sequence substantially the same as, or identical to, SEQ ID NO: 26, for example SEQ ID NO: 58. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a light chain CDR2 substantially the same as, or identical to, SEQ ID NO: 27, for example SEQ ID NO: 59. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a light chain CDR3 substantially the same as, or identical to, SEQ ID NO: 28, for example SEQ ID NO: 60. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a heavy chain CDR1 substantially the same as, or identical to, SEQ ID NO: 30, for example SEQ ID NO: 62. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a heavy chain CDR2 substantially the same as, or identical to, SEQ ID NO: 31, for example SEQ ID NO: 63. In some embodiments, the isolated polynucleotides encode an antibody or antigen-binding fragment thereof having a heavy chain CDR3 substantially the same as, or identical to, SEQ ID NO: 32, for example SEQ ID NO: 64. The polynucleotides may encode an antibody or antigen-binding fragment thereof having a light chain with a CDR1 substantially the same as, or identical to, SEQ ID NO: 26, for example SEQ ID NO: 58; a CDR2 substantially the same as, or identical to, SEQ ID NO: 27, for example SEQ ID NO: 59; and a CDR3 substantially the same as, or identical to, SEQ ID NO: 28, for example SEQ ID NO: 60. The polynucleotides may encode an antibody or antigen-binding fragment thereof having a heavy chain CDR1 substantially the same as, or identical to, SEQ ID NO: 30, for example SEQ ID NO: 62; a CDR2 substantially the same as, or identical to, SEQ ID NO: 31, for example SEQ ID NO: 63; and a CDR3 substantially the same as, or identical to, SEQ ID NO: 32, for example SEQ ID NO: 64. The polynucleotides may encode an antibody or antigen-binding fragment thereof having a light chain CDR1 substantially the same as, or identical to, SEQ ID NO: 26, for example SEQ ID NO: 58; a CDR2 encoded by a nucleotide sequence substantially the same as, or identical to, SEQ ID NO: 27, for example SEQ ID NO: 59; and a CDR3 encoded by a nucleotide sequence substantially the same as, or identical to, SEQ ID NO: 28, for example SEQ ID NO: 60; and a heavy chain CDR1 substantially the same as, or identical to, SEQ ID NO: 30, for example SEQ ID NO: 62; a CDR2 substantially the same as, or identical to, SEQ ID NO: 31, for example SEQ ID NO: 63; and a CDR3 substantially the same as, or identical to, SEQ ID NO: 32, for example SEQ ID NO: 64. Antigen-binding arrangements of CDRs may also be engineered using antibody-like proteins as CDR scaffolding. Such engineered antigen-binding proteins are within the scope of the disclosure.

(74) Polynucleotides described herein may encode antibodies or antigen-binding fragments that have a light chain variable domain segment that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 29, for example SEQ ID NO: 61. In some embodiments the described polynucleotides may encode antibodies or antigen-binding fragments that have a heavy chain variable domain segment that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 33, for example SEQ ID NO: 65. In some embodiments the described polynucleotides may encode antibodies or antigen-binding fragments that have a light chain variable domain segment that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 29, for example SEQ ID NO: 61; and a heavy chain variable domain segment that includes an amino acid sequence substantially the same as, or identical to, SEQ ID NO: 33, for example SEQ ID NO: 65. The polynucleotides capable of encoding the variable domain segments provided herein may be included on the same, or different, vectors to produce antibodies or antigen-binding fragments.

(75) Polynucleotides encoding engineered antigen-binding proteins also are within the scope of the disclosure. In some embodiments, the polynucleotides described (and the peptides they encode) include a leader sequence. Any leader sequence known in the art may be employed. The leader sequence may include, but is not limited to, a restriction site or a translation start site.

(76) The antibodies or antigen-binding fragments described herein include variants having single or multiple amino acid substitutions, deletions, or additions that retain the biological properties (e.g., binding affinity or immune effector activity) of the described antibodies or antigen-binding fragments. The skilled person may produce variants having single or multiple amino acid substitutions, deletions, or additions. These variants may include: (a) variants in which one or more amino acid residues are substituted with conservative or nonconservative amino acids, (b) variants in which one or more amino acids are added to or deleted from the polypeptide, (c) variants in which one or more amino acids include a substituent group, and (d) variants in which the polypeptide is fused with another peptide or polypeptide such as a fusion partner, a protein tag or other chemical moiety, that may confer useful properties to the polypeptide, such as, for example, an epitope for an antibody, a polyhistidine sequence, a biotin moiety and the like. Antibodies or antigen-binding fragments described herein may include variants in which amino acid residues from one species are substituted for the corresponding residue in another species, either at the conserved or nonconserved positions. In other embodiments, amino acid residues at nonconserved positions are substituted with conservative or nonconservative residues. The techniques for obtaining these variants, including genetic (suppressions, deletions, mutations, etc.), chemical, and enzymatic techniques, are known to the person having ordinary skill in the art.

(77) The antibodies or antigen-binding fragments described herein may embody several antibody isotypes, such as IgM, IgD, IgG, IgA and IgE. Antibody or antigen-binding fragment thereof specificity is largely determined by the amino acid sequence, and arrangement, of the CDRs. Therefore, the CDRs of one isotype may be transferred to another isotype without altering antigen specificity. Alternatively, techniques have been established to cause hybridomas to switch from producing one antibody isotype to another (isotype switching) without altering antigen specificity. Accordingly, such antibody isotypes are within the scope of the described antibodies or antigen-binding fragments

(78) The antibodies or antigen-binding fragments described herein have binding affinities (in M) for FR that include a dissociation constant (K.sub.D) of less than about 110.sup.8 M. In one embodiment the antibody 9F3 has an affinity for FR of 7.1510.sup.10 M. In one embodiment the antibody 19D4 has an affinity for FR of 5.6710.sup.10 M. In one embodiment the antibody 24F12 has an affinity for FR of 1.0210.sup.10 M. In one embodiment the antibody 26B3 has an affinity for FR of 2.7310.sup.11 M. In one embodiment the antibody 9F3 has an affinity for FR of about 6.510.sup.10 M to about 810.sup.10 M. In one embodiment the antibody 19D4 has an affinity for FR of about 510.sup.10 M to about 6.510.sup.10 M. In one embodiment the antibody 24F12 has an affinity for FR of about 0.510.sup.10 M to about 210.sup.10 M. In one embodiment the antibody 26B3 has an affinity for FR of about 110.sup.11 M to about 3.510.sup.11 M.

(79) Also provided are vectors comprising the polynucleotides described herein. The vectors can be expression vectors. Recombinant expression vectors containing a sequence encoding a polypeptide of interest are thus contemplated as within the scope of this disclosure. The expression vector may contain one or more additional sequences such as but not limited to regulatory sequences (e.g., promoter, enhancer), a selection marker, and a polyadenylation signal. Vectors for transforming a wide variety of host cells are well known and include, but are not limited to, plasmids, phagemids, cosmids, baculoviruses, bacmids, bacterial artificial chromosomes (BACs), yeast artificial chromosomes (YACs), as well as other bacterial, yeast and viral vectors.

(80) Recombinant expression vectors within the scope of the description include synthetic, genomic, or cDNA-derived nucleic acid fragments that encode at least one recombinant protein which may be operably linked to suitable regulatory elements. Such regulatory elements may include a transcriptional promoter, sequences encoding suitable mRNA ribosomal binding sites, and sequences that control the termination of transcription and translation. Expression vectors, especially mammalian expression vectors, may also include one or more nontranscribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, other 5 or 3 flanking nontranscribed sequences, 5 or 3 nontranslated sequences (such as necessary ribosome binding sites), a polyadenylation site, splice donor and acceptor sites, or transcriptional termination sequences. An origin of replication that confers the ability to replicate in a host may also be incorporated.

(81) The transcriptional and translational control sequences in expression vectors to be used in transforming vertebrate cells may be provided by viral sources. Exemplary vectors may be constructed as described by Okayama and Berg, 3 Mol. Cell. Biol. 280 (1983).

(82) In some embodiments, the antibody- or antigen-binding fragment-coding sequence is placed under control of a powerful constitutive promoter, such as the promoters for the following genes: hypoxanthine phosphoribosyl transferase (HPRT), adenosine deaminase, pyruvate kinase, beta-actin, human myosin, human hemoglobin, human muscle creatine, and others. In addition, many viral promoters function constitutively in eukaryotic cells and are suitable for use with the described embodiments. Such viral promoters include without limitation, Cytomegalovirus (CMV) immediate early promoter, the early and late promoters of SV40, the Mouse Mammary Tumor Virus (MMTV) promoter, the long terminal repeats (LTRs) of Maloney leukemia virus, Human Immunodeficiency Virus (HIV), Epstein Barr Virus (EBV), Rous Sarcoma Virus (RSV), and other retroviruses, and the thymidine kinase promoter of Herpes Simplex Virus. In one embodiment, the antibody or antigen-binding fragment thereof coding sequence is placed under control of an inducible promoter such as the metallothionein promoter, tetracycline-inducible promoter, doxycycline-inducible promoter, promoters that contain one or more interferon-stimulated response elements (ISRE) such as protein kinase R 2,5-oligoadenylate synthetases, Mx genes, ADAR1, and the like.

(83) Vectors described herein may contain one or more Internal Ribosome Entry Site(s) (IRES). Inclusion of an IRES sequence into fusion vectors may be beneficial for enhancing expression of some proteins. In some embodiments the vector system will include one or more polyadenylation sites (e.g., SV40), which may be upstream or downstream of any of the aforementioned nucleic acid sequences. Vector components may be contiguously linked, or arranged in a manner that provides optimal spacing for expressing the gene products (i.e., by the introduction of spacer nucleotides between the ORFs), or positioned in another way. Regulatory elements, such as the IRES motif, may also be arranged to provide optimal spacing for expression.

(84) The vectors may comprise selection markers, which are well known in the art. Selection markers include positive and negative selection markers, for example, antibiotic resistance genes (e.g., neomycin resistance gene, a hygromycin resistance gene, a kanamycin resistance gene, a tetracycline resistance gene, a penicillin resistance gene), glutamate sythase genes, HSV-TK, HSV-TK derivatives for ganciclovir selection, or bacterial purine nucleoside phosphorylase gene for 6-methylpurine selection (Gadi et al., 7 Gene Ther. 1738-1743 (2000)). A nucleic acid sequence encoding a selection marker or the cloning site may be upstream or downstream of a nucleic acid sequence encoding a polypeptide of interest or cloning site.

(85) The vectors described herein may be used to transform various cells with the genes encoding the described antibodies or antigen-binding fragments. For example, the vectors may be used to generate antibody or antigen-binding fragment-producing cells. Thus, another aspect features host cells transformed with vectors comprising a nucleic acid sequence encoding an antibody or antigen-binding fragment thereof that specifically binds FR, such as the antibodies or antigen-binding fragments described and exemplified herein.

(86) Numerous techniques are known in the art for the introduction of foreign genes into cells and may be used to construct the recombinant cells for purposes of carrying out the described methods, in accordance with the various embodiments described and exemplified herein. The technique used should provide for the stable transfer of the heterologous gene sequence to the host cell, such that the heterologous gene sequence is heritable and expressible by the cell progeny, and so that the necessary development and physiological functions of the recipient cells are not disrupted. Techniques which may be used include but are not limited to chromosome transfer (e.g., cell fusion, chromosome mediated gene transfer, micro cell mediated gene transfer), physical methods (e.g., transfection, spheroplast fusion, microinjection, electroporation, liposome carrier), viral vector transfer (e.g., recombinant DNA viruses, recombinant RNA viruses) and the like (described in Cline, 29 Pharmac. Ther. 69-92 (1985)). Calcium phosphate precipitation and polyethylene glycol (PEG)-induced fusion of bacterial protoplasts with mammalian cells may also be used to transform cells.

(87) Cells suitable for use in the expression of the antibodies or antigen-binding fragments described herein are preferably eukaryotic cells, more preferably cells of plant, rodent, or human origin, for example but not limited to NSO, CHO, CHOK1, PERC.6 production cell line, Tk-ts13, BHK, HEK293 cells, COS-7, T98G, CV-1/EBNA, L cells, C127, 3T3, HeLa, NS1, Sp2/0 myeloma cells, and BHK cell lines, among others. In addition, expression of antibodies may be accomplished using hybridoma cells. Methods for producing hybridomas are well established in the art.

(88) Cells transformed with expression vectors described herein may be selected or screened for recombinant expression of the antibodies or antigen-binding fragments described herein. Recombinant-positive cells are expanded and screened for subclones exhibiting a desired phenotype, such as high level expression, enhanced growth properties, or the ability to yield proteins with desired biochemical characteristics, for example, due to protein modification or altered post-translational modifications. These phenotypes may be due to inherent properties of a given subclone or to mutation. Mutations may be effected through the use of chemicals, UV-wavelength light, radiation, viruses, insertional mutagens, inhibition of DNA mismatch repair, or a combination of such methods.

(89) Provided herein are methods for detecting FR in a sample by contacting the sample with an antibody, or antigen-binding fragment thereof, described herein. As described herein, the sample may be derived from urine, blood, serum, plasma, saliva, ascites, circulating cells, circulating tumor cells, cells that are not tissue associated (i.e., free cells), tissues (e.g., surgically resected tumor tissue, biopsies, including fine needle aspiration), histological preparations, and the like. In some embodiments the described methods include detecting FR in a sample by contacting the sample with:

(90) (a) an antibody, or antigen-binding fragment thereof, that binds the same epitope as any one of antibody 9F3, antibody 19D4, antibody 24F12, or antibody 26B3;

(91) (b) any one of antibody 9F3, antibody 19D4, antibody 24F12, or antibody 26B3, or an antigen-binding fragment thereof;

(92) (c) an antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of any one of antibody 9F3, antibody 19D4, antibody 24F12, or antibody 26B3, as described in Table 1;

(93) (d) an antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment of any one of antibody 9F3, antibody 19D4, antibody 24F12, or antibody 26B3, as described in Table 1; or

(94) (e) an antibody having the amino acid sequence of antibody produced by any one of the cell lines deposited with the ATCC having accession number PTA-11887, PTA-11884, PTA-11886, or PTA-11885, or an antigen binding fragment thereof.

(95) In some embodiments the sample may be contacted with more than one of the antibodies, or antigen-binding fragments described herein. For example, a sample may be contacted with a first antibody, or antigen-binding fragment thereof, and then contacted with a second antibody, or antigen-binding fragment thereof, wherein the first antibody or antigen-binding fragment and the second antibody or antigen-binding fragment are not the same antibody or antigen-binding fragment. In some embodiments, the first antibody, or antigen-binding fragment thereof, may be affixed to a surface, such as a multiwell plate, chip, or similar substrate prior to contacting the sample. In other embodiments the first antibody, or antigen-binding fragment thereof, may not be affixed, or attached, to anything at all prior to contacting the sample.

(96) Various combinations of the antibodies, or antigen-binding fragments thereof, may be used to detect FR in a sample. In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 9F3 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 19D4 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 9F3 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 24F12 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 9F3 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 26B3 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 19D4 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 9F3 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 19D4 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 24F12 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 19D4 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 26B3 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 24F12 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 9F3 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 24F12 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 19D4 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 24F12 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 26B3 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 26B3 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 9F3 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 26B3 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 24F12 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 26B3 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of antibody 19D4 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 9F3 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 19D4 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 9F3 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 24F12 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 9F3 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 26B3 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 19D4 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 9F3 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 19D4 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 24F12 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 19D4 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 26B3 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 24F12 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 9F3 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 24F12 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 19D4 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 24F12 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 26B3 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 26B3 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 9F3 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 26B3 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 24F12 (as provided in Table 1). In one embodiment the sample may be first contacted with an antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 26B3 (as provided in Table 1), and then separately contacted with a second antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment amino acid sequences of antibody 19D4 (as provided in Table 1). In one embodiment the sample may be first contacted with the antibody produced by the cell line having ATCC accession number PTA-11887, or an antigen-binding fragment thereof, and then separately contacted with a second antibody produced by the cell line having ATCC accession number PTA-11884, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with the antibody produced by the cell line having ATCC accession number PTA-11887, or an antigen-binding fragment thereof, and then separately contacted with a second antibody produced by the cell line having ATCC accession number PTA-11885, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with the antibody produced by the cell line having ATCC accession number PTA-11887, or an antigen-binding fragment thereof, and then separately contacted with a second antibody produced by the cell line having ATCC accession number PTA-11886, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with the antibody produced by the cell line having ATCC accession number PTA-11884, or an antigen-binding fragment thereof, and then separately contacted with a second antibody produced by the cell line having ATCC accession number PTA-11887, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with the antibody produced by the cell line having ATCC accession number PTA-11884, or an antigen-binding fragment thereof, and then separately contacted with a second antibody produced by the cell line having ATCC accession number PTA-11885, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with the antibody produced by the cell line having ATCC accession number PTA-11884, or an antigen-binding fragment thereof, and then separately contacted with a second antibody produced by the cell line having ATCC accession number PTA-11886, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with the antibody produced by the cell line having ATCC accession number PTA-11885, or an antigen-binding fragment thereof, and then separately contacted with a second antibody produced by the cell line having ATCC accession number PTA-11884, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with the antibody produced by the cell line having ATCC accession number PTA-11885, or an antigen-binding fragment thereof, and then separately contacted with a second antibody produced by the cell line having ATCC accession number PTA-11887, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with the antibody produced by the cell line having ATCC accession number PTA-11885, or an antigen-binding fragment thereof, and then separately contacted with a second antibody produced by the cell line having ATCC accession number PTA-11886, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with the antibody produced by the cell line having ATCC accession number PTA-11886, or an antigen-binding fragment thereof, and then separately contacted with a second antibody produced by the cell line having ATCC accession number PTA-11884, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with the antibody produced by the cell line having ATCC accession number PTA-11886, or an antigen-binding fragment thereof, and then separately contacted with a second antibody produced by the cell line having ATCC accession number PTA-11885, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with the antibody produced by the cell line having ATCC accession number PTA-11886, or an antigen-binding fragment thereof, and then separately contacted with a second antibody produced by the cell line having ATCC accession number PTA-11887, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with an antibody capable of binding to the same epitope as the antibody produced by the cell line having ATCC accession number PTA-11887, or an antigen-binding fragment thereof, and then separately contacted with a second antibody capable of binding to the same epitope as antibody produced by the cell line having ATCC accession number PTA-11884, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with an antibody capable of binding to the same epitope as the antibody produced by the cell line having ATCC accession number PTA-11887, or an antigen-binding fragment thereof, and then separately contacted with a second antibody capable of binding to the same epitope as antibody produced by the cell line having ATCC accession number PTA-11885, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with an antibody capable of binding to the same epitope as the antibody produced by the cell line having ATCC accession number PTA-11887, or an antigen-binding fragment thereof, and then separately contacted with a second antibody capable of binding to the same epitope as antibody produced by the cell line having ATCC accession number PTA-11886, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with an antibody capable of binding to the same epitope as the antibody produced by the cell line having ATCC accession number PTA-11884, or an antigen-binding fragment thereof, and then separately contacted with a second antibody capable of binding to the same epitope as antibody produced by the cell line having ATCC accession number PTA-11887, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with an antibody capable of binding to the same epitope as the antibody produced by the cell line having ATCC accession number PTA-11884, or an antigen-binding fragment thereof, and then separately contacted with a second antibody capable of binding to the same epitope as antibody produced by the cell line having ATCC accession number PTA-11885, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with an antibody capable of binding to the same epitope as the antibody produced by the cell line having ATCC accession number PTA-11884, or an antigen-binding fragment thereof, and then separately contacted with a second antibody capable of binding to the same epitope as antibody produced by the cell line having ATCC accession number PTA-11886, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with an antibody capable of binding to the same epitope as the antibody produced by the cell line having ATCC accession number PTA-11885, or an antigen-binding fragment thereof, and then separately contacted with a second antibody capable of binding to the same epitope as antibody produced by the cell line having ATCC accession number PTA-11884, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with an antibody capable of binding to the same epitope as the antibody produced by the cell line having ATCC accession number PTA-11885, or an antigen-binding fragment thereof, and then separately contacted with a second antibody capable of binding to the same epitope as antibody produced by the cell line having ATCC accession number PTA-11887, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with an antibody capable of binding to the same epitope as the antibody produced by the cell line having ATCC accession number PTA-11885, or an antigen-binding fragment thereof, and then separately contacted with a second antibody capable of binding to the same epitope as antibody produced by the cell line having ATCC accession number PTA-11886, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with an antibody capable of binding to the same epitope as the antibody produced by the cell line having ATCC accession number PTA-11886, or an antigen-binding fragment thereof, and then separately contacted with a second antibody capable of binding to the same epitope as antibody produced by the cell line having ATCC accession number PTA-11884, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with an antibody capable of binding to the same epitope as the antibody produced by the cell line having ATCC accession number PTA-11886, or an antigen-binding fragment thereof, and then separately contacted with a second antibody capable of binding to the same epitope as antibody produced by the cell line having ATCC accession number PTA-11885, or an antigen-binding fragment thereof. In one embodiment the sample may be first contacted with an antibody capable of binding to the same epitope as the antibody produced by the cell line having ATCC accession number PTA-11886, or an antigen-binding fragment thereof, and then separately contacted with a second antibody capable of binding to the same epitope as antibody produced by the cell line having ATCC accession number PTA-11887, or an antigen-binding fragment thereof.

(97) The described antibodies and antigen-binding fragments may be detectably labeled. In some embodiments labeled antibodies and antigen-binding fragments may facilitate the detection FR via the methods described herein. Many such labels are readily known to those skilled in the art. For example, suitable labels include, but should not be considered limited to, radiolabels, fluorescent labels (such as DYLIGHT 649 fluorescent dye), epitope tags, biotin, chromophore labels, ECL labels, or enzymes. More specifically, the described labels include ruthenium, .sup.111In-DOTA, .sup.111In-diethylenetriaminepentaacetic acid (DTPA), horseradish peroxidase, alkaline phosphatase and beta-galactosidase, poly-histidine (HIS tag), acridine dyes, cyanine dyes, fluorone dyes, oxazin dyes, phenanthridine dyes, rhodamine dyes, ALEXAFLUOR dyes, and the like.

(98) The described antibodies and antigen-binding fragments may be used in a variety of assays to detect FR in a sample. Some suitable assays include, but should not be considered limited to, western blot analysis, radioimmunoassay, immunofluorimetry, immunoprecipitation, equilibrium dialysis, immunodiffusion, electrochemiluminescence (ECL) immunoassay, immunohistochemistry, fluorescence-activated cell sorting (FACS) or ELISA assay.

(99) In some embodiments described herein detection of FR-expressing cancer cells in a subject may be used to determine that the subject may be treated with a therapeutic agent directed against FR. In some embodiments the therapeutic agent directed against FR may be an antibody, such as Farletuzumab.

(100) Methods for Diagnosing Cancer

(101) Provided herein are methods for diagnosing ovarian, breast, thyroid, colorectal, endometrial, fallopian tube, or lung cancer of epithelial origin in a subject. In some embodiments, as described above, detecting FR in a sample, such as a histological sample, a fine needle aspirate sample, resected tumor tissue, circulating cells, circulating tumor cells, and the like, provides the ability to diagnose cancer in the subject from whom the sample was obtained. In some embodiments, it may already be known that the subject from whom the sample was obtained has cancer, but the type of cancer afflicting the subject may not yet have been diagnosed or a preliminary diagnosis may be unclear, thus detecting FR in a sample obtained from the subject can allow for, or clarify, diagnosis of the cancer.

(102) In some embodiments the described methods involve assessing whether a subject is afflicted with FR-expressing cancer by determining the amount of FR that is present in a sample derived from the subject; and comparing the observed amount of FR with the amount of FR in a control sample, wherein a difference between the amount of FR in the sample derived from the subject and the amount of FR in the control sample is an indication that the subject is afflicted with an FR-expressing cancer. In some embodiments the amount of FR in the sample derived from the subject is assessed by contacting the sample with an antibody that binds FR, such as the antibodies described herein. Similar methods may be used to determine if a subject is afflicted with cancer that is not associated with increased FR production. The sample assessed for the presence of FR may be derived from urine, blood, serum, plasma, saliva, ascites, circulating cells, circulating tumor cells, cells that are not tissue associated (i.e., free cells), tissues (e.g., surgically resected tumor tissue, biopsies, including fine needle aspiration), histological preparations, and the like. In some embodiments the subject is a human.

(103) In some embodiments the method of diagnosing an FR-expressing cancer will involve: contacting a biological sample of a subject with an FR-specific antibody, or antigen-binding fragment thereof (such as those derivable from the antibodies and fragments provided in Table 1), quantifying the amount of FR present in the sample that is bound by the antibody or antigen-binding fragment thereof, comparing the amount of FR present in the sample to a known standard; and determining whether the subject's FR levels fall within the levels of FR associated with cancer. In an additional embodiment, the diagnostic method can be followed with an additional step of administering or prescribing a cancer-specific treatment. In some embodiments the cancer-specific treatment may be directed against FR-expressing cancers, such as Farletuzumab.

(104) In some embodiments the described methods involve assessing whether a subject is afflicted with FR-expressing cancer by determining the amount of FR associated with a cell or tissue that is present in a sample derived from the subject; and comparing the observed amount of FR with the amount of FR in a control sample, wherein a difference between the amount of FR in the sample derived from the subject and the amount of FR in the control sample is an indication that the subject is afflicted with an FR-expressing cancer.

(105) In some embodiments the control sample may be derived from a subject that is not afflicted with FR-expressing cancer. In some embodiments the control sample may be derived from a subject that is afflicted with FR-expressing cancer. In some embodiments where the control sample is derived from a subject that is not afflicted with FR-expressing cancer, an observed increase in the amount of FR present in the sample, relative to that observed for the control sample, is an indication that the subject being assessed is afflicted with FR-expressing cancer. In some embodiments where the control sample is derived from a subject that is not afflicted with FR-expressing cancer, an observed decrease or similarity in the amount of FR present in the test sample, relative to that observed for the control sample, is an indication that the subject being assessed is not afflicted with FR-expressing cancer. In some embodiments where the control sample is derived from a subject that is afflicted with FR-expressing cancer, an observed similarity in the amount of FR present in the test sample, relative to that observed for the control sample, is an indication that the subject being assessed is afflicted with FR-expressing cancer. In some embodiments where the control sample is derived from a subject that is afflicted with FR-expressing cancer, an observed decrease in the amount of FR present in the test sample, relative to that observed for the control sample, is an indication that the subject being assessed is not afflicted with FR-expressing cancer.

(106) In some embodiments the amount of FR in the sample derived from the subject is assessed by contacting the sample with an antibody that binds FR, such as the antibodies described herein. The sample assessed for the presence of FR may be circulating cells, circulating tumor cells, cells that are not tissue associated (i.e., free cells), tissues (e.g., surgically resected tumor tissue, biopsies, including fine needle aspiration), histological preparations, and the like.

(107) In some embodiments the described methods involve assessing whether a subject is afflicted with FR-expressing cancer by determining the amount of FR that is not associated with a cell or tissue that is present in a sample derived from the subject; and comparing the observed amount of FR with the amount of FR in a control sample, wherein a difference between the amount of FR in the sample derived from the subject and the amount of FR in the control sample is an indication that the subject is afflicted with an FR-expressing cancer. In some embodiments the amount of FR in the sample derived from the subject is assessed by contacting the sample with an antibody that binds FR, such as the antibodies described herein. The sample assessed for the presence of FR may be urine, blood, serum, plasma, saliva, ascites, histological preparations, and the like.

(108) In various embodiments of the described methods, the cancer may be FR-expressing cancer. In a particular embodiment, the FR-expressing cancer is ovarian cancer. In some embodiments the FR-expressing cancer is endometrial cancer. In some embodiments the FR-expressing cancer is colorectal cancer. In some embodiments the FR-expressing cancer is breast cancer. In some embodiments the FR-expressing cancer is thyroid cancer. In some embodiments the FR-expressing cancer is fallopian tube cancer. In another embodiment, the FR-expressing cancer is non-small cell lung cancer, such as an adenocarcinoma. Alternatively, the described methods may be used to diagnose cancer that does not express FR, such as squamous cell carcinoma.

(109) In various aspects, the amount of FR is determined by contacting the sample with an antibody, or antigen-binding fragment thereof, that binds FR. In some embodiments, the sample may be contacted by more than one type of antibody, or antigen-binding fragment thereof, that binds FR. In some embodiments, the sample may be contacted by a first antibody, or antigen-binding fragment thereof, that binds FR and then contacted by a second antibody, or antigen-binding fragment thereof, that binds FR. Antibodies such as those described herein may be used in this capacity. For example, the antibody is selected from the group consisting of:

(110) (a) an antibody, or antigen-binding fragment thereof, that binds the same epitope as any one of antibody 9F3, antibody 19D4, antibody 24F12, or antibody 26B3;

(111) (b) any one of antibody 9F3, antibody 19D4, antibody 24F12, or antibody 26B3, or an antigen-binding fragment thereof;

(112) (c) an antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of any one of antibody 9F3, antibody 19D4, antibody 24F12, or antibody 26B3, as described in Table 1;

(113) (d) an antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment of any one of antibody 9F3, antibody 19D4, antibody 24F12, or antibody 26B3, as described in Table 1; or

(114) (e) an antibody having the amino acid sequence of antibody produced by any one of the cell lines deposited with the ATCC having accession number PTA-11887, PTA-11884, PTA-11886, or PTA-11885, or an antigen binding fragment thereof.

(115) Various combinations of the antibodies and antigen-binding fragments described in (a)-(e), as detailed above in the general section describing methods of detection, can be used to provide a first and second antibody or antigen-binding fragment to carry out the described diagnostic methods.

(116) In certain embodiments, the amount of FR is determined by western blot analysis, radioimmunoassay, immunofluorimetry, immunoprecipitation, equilibrium dialysis, immunodiffusion, electrochemiluminescence (ECL) immunoassay, immunohistochemistry, fluorescence-activated cell sorting (FACS) or ELISA assay.

(117) In various embodiments of the described diagnostic methods a control sample is used. The control sample may be a positive or negative assay control that ensures the assay used is working properly; for example, an assay control of this nature might be commonly used for immunohistochemistry assays. Alternatively, the control sample may be a standardized control amount of FR in a healthy subject. In some embodiments, the observed FR levels of the tested subject may be compared with FR levels observed in samples from control subjects known to have FR-expressing cancer. In some embodiments, the control subject's FR-expressing cancer is ovarian cancer, endometrial cancer, colorectal cancer, breast cancer, thyroid cancer, fallopian tube cancer, or lung cancer, such as adenocarcinoma. In some embodiments, the control subject is known to have early stage FR-expressing cancer, such as stage I ovarian cancer, endometrial cancer, colorectal cancer, breast cancer, thyroid cancer, fallopian tube cancer, or lung cancer (e.g., adenocarcinoma). In some embodiments, the control subject is known to have intermediate stage FR-expressing cancer, such as stage II ovarian cancer, endometrial cancer, colorectal cancer, breast cancer, thyroid cancer, fallopian tube cancer, or lung cancer (e.g., adenocarcinoma). In some embodiments, the control subject is known to have late stage FR-expressing cancer, such as stage III or stage IV ovarian cancer, endometrial cancer, colorectal cancer, breast cancer, thyroid cancer, fallopian tube cancer, or lung cancer (e.g., adenocarcinoma).

(118) The diagnostic methods provided herein also provide a basis upon which it may be possible to predict whether a subject has a relatively higher or lower likelihood of surviving 5 years following diagnosis. In some embodiments, the described method may be used to predict a favorable outcome for a subject having adenocarcinoma, wherein a favorable outcome is defined as having an increased 5-year survival rate. As data provided herein indicate, subjects determined to have stage I or stage II adenocarcinoma that does not express FR are about 2 times more likely to die within five years than subjects determined to have stage I or stage II adenocarcinoma that does express FR. Accordingly, the diagnostic methods described herein may be combined with this knowledge to allow for a method of predicting 5-year survivorship likelihood for subjects determined to have cancer. In some embodiments the method is used to predict the 5-year survivorship likelihood for subjects determined to have adenocarcinoma.

(119) In some embodiments the described prognostic method will involve: contacting a biological sample of a subject with an FR-specific antibody, or antigen-binding fragment thereof (such as those derivable from the antibodies and fragments provided in Table 1), quantifying the amount of FR present in the sample that is bound by the antibody or antigen-binding fragment thereof, comparing the amount of FR present in the sample to a known standard; and determining whether the subject's FR levels indicate the presence of a FR expressing cancer, thereby allowing for a prediction to be made as to the likelihood the subject will survive five years after being diagnosed with cancer. In some embodiments the subject is known to have or determined to have adenocarcinoma. In some embodiments the subject is a human.

(120) Methods for Monitoring Cancer

(121) Provided herein are methods for monitoring cancer of epithelial origin in a subject. In some embodiments the described methods involve assessing whether FR-expressing cancer is progressing, regressing, or remaining stable by determining the amount of FR that is present in a test sample derived from the subject; and comparing the observed amount of FR with the amount of FR in a sample obtained from the subject at an earlier point in time, wherein a difference between the amount of FR in the test sample and the earlier sample provides an indication of whether the cancer is progressing, regressing, or remaining stable. In this regard, a test sample with an increased amount of FR, relative to the amount observed for the earlier sample, may indicate progression of an FR-expressing cancer. Conversely, a test sample with a decreased amount of FR, relative to the amount observed for the earlier sample, may indicate regression of an FR-expressing cancer. Accordingly, a test sample with an insignificant difference in the amount of FR, relative to the amount observed for the earlier sample, may indicate a state of stable disease for an FR-expressing cancer. In some embodiments the amount of FR in a sample derived from the subject is assessed by contacting the sample with an antibody that binds FR, such as the antibodies described herein. The sample assessed for the presence of FR may be derived from urine, blood, serum, plasma, saliva, ascites, circulating cells, circulating tumor cells, cells that are not tissue associated (i.e., free cells), tissues (e.g., surgically resected tumor tissue, biopsies, including fine needle aspiration), histological preparations, and the like. In some embodiments the subject is a human.

(122) In some embodiments the method of monitoring an FR-expressing cancer will involve: contacting a biological sample of a subject with an FR-specific antibody, or antigen-binding fragment thereof (such as those derivable from the antibodies and fragments provided in Table 1), quantifying the amount of FR present in the sample that is bound by the antibody or antigen-binding fragment thereof, comparing the amount of FR present in the sample to the amount of FR determined to be in a sample from the same subject at an earlier point in time; and determining whether the subject's FR levels have changed over time. A test sample with an increased amount of FR, relative to the amount observed for the earlier sample, may indicate progression of an FR-expressing cancer. Conversely, a test sample with a decreased amount of FR, relative to the amount observed for the earlier sample, may indicate regression of an FR-expressing cancer. Accordingly, a test sample with an insignificant difference in the amount of FR, relative to the amount observed for the earlier sample, may indicate a state of stable disease for an FR-expressing cancer. In some embodiments, the FR levels of the sample may be compared to a known standard, alone or in addition to the FR levels observed for a sample assessed at an earlier point in time. In some embodiments the known standard may be FR protein at a known concentration (e.g., a recombinant or purified FR protein sample). In an additional embodiment, the diagnostic method can be followed with an additional step of administering a cancer-specific treatment. In some embodiments the cancer-specific treatment may be directed against FR-expressing cancers, such as Farletuzumab.

(123) In some embodiments the described methods involve assessing whether FR-expressing cancer is progressing, regressing, or remaining stable by determining the amount of FR associated with a cell or tissue that is present in a test sample derived from the subject; and comparing the observed amount of FR with the amount of FR in a sample obtained from the subject, in a similar manner, at an earlier point in time, wherein a difference between the amount of FR in the test sample and the earlier sample provides an indication of whether the cancer is progressing, regressing, or remaining stable. In this regard, a test sample with an increased amount of FR, relative to the amount observed for the earlier sample, may indicate progression of an FR-expressing cancer. Conversely, a test sample with a decreased amount of FR, relative to the amount observed for the earlier sample, may indicate regression of an FR-expressing cancer. Accordingly, a test sample with an insignificant difference in the amount of FR, relative to the amount observed for the earlier sample, may indicate a state of stable disease for an FR-expressing cancer. In some embodiments the amount of FR in a sample derived from the subject is assessed by contacting the sample with an antibody that binds FR, such as the antibodies described herein. The sample assessed for the presence of FR may be circulating cells, circulating tumor cells, cells that are not tissue associated (i.e., free cells), tissues (e.g., surgically resected tumor tissue, biopsies, including fine needle aspiration), histological preparations, and the like.

(124) In some embodiments the described methods involve assessing whether FR-expressing cancer is progressing, regressing, or remaining stable by determining the amount of FR not associated with a cell or tissue that is present in a test sample derived from the subject; and comparing the observed amount of FR with the amount of FR in a sample obtained from the subject, in a similar manner, at an earlier point in time, wherein a difference between the amount of FR in the test sample and the earlier sample provides an indication of whether the cancer is progressing, regressing, or remaining stable. In this regard, a test sample with an increased amount of FR, relative to the amount observed for the earlier sample, may indicate progression of an FR-expressing cancer. Conversely, a test sample with a decreased amount of FR, relative to the amount observed for the earlier sample, may indicate regression of an FR-expressing cancer. Accordingly, a test sample with an insignificant difference in the amount of FR, relative to the amount observed for the earlier sample, may indicate a state of stable disease for an FR-expressing cancer. In some embodiments the amount of FR in a sample derived from the subject is assessed by contacting the sample with an antibody that binds FR, such as the antibodies described herein. The sample assessed for the presence of FR may be urine, blood, serum, plasma, saliva, ascites, histological preparations, and the like.

(125) In various embodiments of the described methods, the cancer may be FR-expressing cancer. In a particular embodiment, the FR-expressing cancer is ovarian cancer. In some embodiments the FR-expressing cancer is endometrial cancer. In some embodiments the FR-expressing cancer is colorectal cancer. In some embodiments the FR-expressing cancer is breast cancer. In some embodiments the FR-expressing cancer is thyroid cancer. In some embodiments the FR-expressing cancer is fallopian tube cancer. In another embodiment, the FR-expressing cancer is non-small cell lung cancer, such as an adenocarcinoma.

(126) In various aspects, the amount of FR is determined by contacting the sample with an antibody, or antigen-binding fragment thereof, that binds FR. In some embodiments, the sample may be contacted by more than one type of antibody, or antigen-binding fragment thereof, that binds FR. In some embodiments, the sample may be contacted by a first antibody, or antigen-binding fragment thereof, that binds FR and then contacted by a second antibody, or antigen-binding fragment thereof, that binds FR. Antibodies such as those described herein may be used in this capacity. For example, the antibody may be selected from among:

(127) (a) an antibody, or antigen-binding fragment thereof, that binds the same epitope as any one of antibody 9F3, antibody 19D4, antibody 24F12, or antibody 26B3;

(128) (b) any one of antibody 9F3, antibody 19D4, antibody 24F12, or antibody 26B3, or an antigen-binding fragment thereof;

(129) (c) an antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of any one of antibody 9F3, antibody 19D4, antibody 24F12, or antibody 26B3, as described in Table 1;

(130) (d) an antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment of any one of antibody 9F3, antibody 19D4, antibody 24F12, or antibody 26B3, as described in Table 1; or

(131) (e) an antibody having the amino acid sequence of antibody produced by any one of the cell lines deposited with the ATCC having accession number PTA-11887, PTA-11884, PTA-11886, or PTA-11885, or an antigen binding fragment thereof.

(132) Various combinations of the antibodies and antigen-binding fragments described in (a)-(e), as detailed above in the general section describing methods of detection, can be used to provide a first and second antibody or antigen-binding fragment to carry out the described monitoring methods.

(133) In certain embodiments, the amount of FR is determined by western blot analysis, radioimmunoassay, immunofluorimetry, immunoprecipitation, equilibrium dialysis, immunodiffusion, electrochemiluminescence (ECL) immunoassay, immunohistochemistry, fluorescence-activated cell sorting (FACS) or ELISA assay.

(134) Additional aspects of the summarized subject matter are provided in greater detail in the detailed description and provided examples and associated figures.

(135) Kits for Detecting the FR

(136) Provided herein are kits for detecting FR in a sample. These kits include one of more of the FR-specific antibodies described herein, or an antigen-binding fragment thereof, and instructions for use of the kit. In some embodiments the antibody, or antigen-binding fragment, provided in the described kits may be one or more of:

(137) (a) an antibody, or antigen-binding fragment thereof, that binds the same epitope as any one of antibody 9F3, antibody 19D4, antibody 24F12, or antibody 26B3;

(138) (b) any one of antibody 9F3, antibody 19D4, antibody 24F12, or antibody 26B3, or an antigen-binding fragment thereof;

(139) (c) an antibody, or antigen-binding fragment thereof, that comprises heavy chain CDR1, CDR2, and CDR3 amino acid sequences and light chain CDR1, CDR2, and CDR3 amino acid sequences of any one of antibody 9F3, antibody 19D4, antibody 24F12, or antibody 26B3, as described in Table 1;

(140) (d) an antibody, or antigen-binding fragment thereof, that comprises the heavy chain variable domain segment and light chain variable domain segment of any one of antibody 9F3, antibody 19D4, antibody 24F12, or antibody 26B3, as described in Table 1; or

(141) (e) an antibody having the amino acid sequence of antibody produced by any one of the cell lines deposited with the ATCC having accession number PTA-11887, PTA-11884, PTA-11886, or PTA-11885, or an antigen binding fragment thereof.

(142) The provided antibody, or antigen-binding fragment, may be in solution; lyophilized; affixed to a substrate, carrier, or plate; or conjugated to a detectable label.

(143) The described kits may also include additional components useful for performing the methods described herein. By way of example, the kits may comprise means for obtaining a sample from a subject, a control sample, e.g., a sample from a subject having slowly progressing cancer and/or a subject not having cancer, one or more sample compartments, and/or instructional material which describes performance of a method of the invention and tissue specific controls/standards.

(144) The means for determining the level of FR can further include, for example, buffers or other reagents for use in an assay for determining the level of FR. The instructions can be, for example, printed instructions for performing the assay and/or instructions for evaluating the level of expression of FR.

(145) The described kits may also include means for isolating a sample from a subject. These means can comprise one or more items of equipment or reagents that can be used to obtain a fluid or tissue from a subject. The means for obtaining a sample from a subject may also comprise means for isolating blood components, such as serum, from a blood sample. Preferably, the kit is designed for use with a human subject.

(146) The described kits may also include a blocking reagent that can be applied to a sample to decrease nonspecific binding of a primary or secondary antibody. An example of a blocking reagent is bovine serum albumin (BSA), which may be diluted in a buffer prior to use. Other commercial blocking reagents, such as Block Ace and ELISA Synblock (AbD serotec), Background Punisher (BIOCARE MEDICAL), and StartingBlock (Thermo Fisher Scientific) are known in the art. The described kits may also include a negative control primary antibody that does not bind to FR sufficiently to yield a positive result in an antibody-based detection assay. In addition, the described kits may include a secondary antibody capable of binding to a FR primary antibody, such as antibody 9F3, antibody 19D4, antibody 24F12, or antibody 26B3. In some embodiments the secondary antibody may be conjugated to a detectable label, such as horse radish peroxidase (HRP) or a fluorophore, to allow for detection of the primary antibody bound to a sample. The described kits may also include a colorimetric or chemiluminescent substrate that allows the presence of a bound secondary antibody to be detected on a sample. In some embodiments the colorimetric or chemiluminescent substrate may be 2,2-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid) (ABTS); 3,3,5,5-Tetramethylbenzidine (TMB); 3,3-Diaminobenzidine (DAB); SUPERSIGNAL substrate (Thermo Fisher Scientific); ECL reagent (Thermo Fisher Scientific) or other such reagents known to those of ordinary skill in the art.

(147) The following examples are provided to supplement the prior disclosure and to provide a better understanding of the subject matter described herein. These examples should not be considered to limit the described subject matter. It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be apparent to persons skilled in the art and are to be included within the and can be made without departing from the true scope of the invention.

Example 1Expression and Purification of Recombinant, Human FR

(148) To conduct the experiments associated with the studies described herein, several folate receptor alpha (FR)-expressing cell systems or lines were created to generate FR-expressing cell substrates or to generate purified recombinant human FR protein. One expression system used was an Sf9 insect cell line that expressed recombinant human FR via baculovirus. This system was prepared using a human FR sequence, containing a leader sequence optimized for insect cell expression, a N-terminal 6 histidine (6 his) epitope tag, and the native GPI attachment site intact. The cells were then incubated in a 1 L shake flask and log-phase cultures of Sf9 insect cells were infected with the recombinant baculovirus at a multiplicity of infection (MOI) of <1. Cells from 30 L of culture were harvested, lysed and extracted 2 with 1 phosphate-buffered saline (PBS) containing 10 mM 3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonate (CHAPS). The NaCl concentration was adjusted to 300 mM and filtered through a 0.2 um membrane. The clarified supernatant was purified by affinity chromatography, using 1PBS with 2M NaCl, 1 mM CHAPS, pH 7.4 as wash buffer, followed by elution with 10 mM 3-(N-morpholino)propanesulfonic acid (MOPS), 3M MgCl.sub.2, 1 mM CHAPS, pH 6.8. Peak fractions were dialyzed extensively against 1PBS, pH 7.4, analyzed for purity by SDS-PAGE, quantitated by bicinchoninic acid assay (BCA) assay, aliquoted and stored at 80 degrees Celsius.

(149) A Chinese hamster ovary (CHO) cell line stably expressing and secreting human FR was produced using a human folate receptor alpha (FR) sequence, containing a human immunoglobulin kappa leader sequence and a C-terminal 6 his epitope tag replacing the GPI attachment site. Once produced, the FR-expressing CHO cells were grown at 25 L-scale in wave bags. To purify the secreted FR protein, cell supernatant was cleared of cellular debris by depth filtration and then concentrated 10-fold by tangential flow filtration and diafiltered into 50 mM sodium phosphate, 300 mM NaCl, 1 mM imidazole, pH 8.0. This was loaded onto a pre-packed TALON IMAC column using an FPLC. Unbound material was washed out using 50 mM sodium phosphate, 300 mM NaCl, 5 mM imidazole, pH 8.0 and bound protein was eluted using a linear gradient of 5 mM-100 mM imidazole in 50 mM sodium phosphate, 300 mM NaCl, pH 8.0. Peak fractions were dialyzed extensively against 1PBS, pH 7.4, analyzed for purity by SDS-PAGE, quantitated by BCA assay, aliquoted and stored at 80 degrees Celsius.

(150) A similar cell system was also produced for human folate receptor beta (FR), human folate receptor gamma (FR), and human folate receptor delta (FR). Briefly, constructs of either FR, FR, or FR containing a human immunoglobulin kappa leader sequence and a C-terminal 6 his epitope tag replacing the GPI attachment site, were used to transiently transfect 1 L cultures of 293F cells. Recombinant FR proteins were purified as described above for human FR.

(151) A Chinese hamster ovary (CHO) cell line stably expressing and secreting a human mesothelin sequence, containing a human immunoglobulin kappa leader sequence and a C-terminal 6 his epitope tag replacing the GPI attachment site, was also prepared, as mesothelin served as a negative control for many studies. Human mesothelin-expressing CHO cells were grown at 25 L-scale in wave bags. To purify the secreted mesothelin protein, cell supernatant was cleared of debris by hollow-fiber filtration and clarified supernatant was concentrated 10-fold by tangential flow filtration. Supernatant NaCl concentration was adjusted to 300 mM NaCl and 0.5 mM imidazole. This was loaded onto a pre-packed cobalt-charged immobilized metal affinity chromatography TALON IMAC column using an FPLC. Unbound material was washed out using 50 mM sodium phosphate, 300 mM NaCl, 3 mM imidazole, pH 8.0 and bound protein was eluted using 50 mM sodium phosphate, 300 mM NaCl, 150 mM imidazole, pH 8.0. Peak fractions were dialyzed extensively against 50 mM potassium phosphate, pH 7.5. Ammonium sulfate was added to a final concentration of 1M, and final purification was then done on a pre-packed phenyl sepharose column using a step gradient of 1M-0M ammonium sulfate in 50 mM potassium phosphate, pH 7.5. Peak fractions were dialyzed extensively against 1PBS, pH 7.4, analyzed for purity by SDS-PAGE, quantitated by BCA assay, aliquoted and stored at 80 degrees Celsius.

Example 2Production of Purified Reduced and Alkylated FR

(152) Efforts were undertaken to produce a reduced and alkylated antigenic form of FR. To reduce the protein, purified FR was concentrated to 2 mg/mL in phosphate buffered saline (pH 7.4) using centrifugal filters (Amicon Ultra, 3 kD MW limit). The protein concentration was determined using a BCA assay (Thermo Scientific). The resultant FR was diluted 1:1 in 8M urea/PBS to generate a final concentration of 1 mg/mL FR in PBS containing 4M urea. Dithiothreitol solution (500 mM in PBS) was added to a final concentration of 10 mM. The solution was incubated at 65 degrees Celsius for one hour, and cooled to room temperature.

(153) Next 1M of iodoacetamide solution in phosphate buffer saline was added into the reduced folate receptor solution to a final concentration of 10 mM, and the reaction was kept in dark at room temperature for 30 minutes. The protein remained soluble under these conditions. The final reduced FR to be used for immunization was stored in phosphate buffer saline containing 4M of urea, 10 mM of DTT, and 10 mM of iodoacetamide.

(154) FIG. 1 shows the differential migration of native FR protein and a reduced and alkylated form of the protein analyzed by SDS-PAGE under nonreducing conditions.

Example 3Production of Hybridomas Using FR

(155) Eight week old female Balb/c mice were immunized with hexa-histidine tagged FR protein (n=5) or reduced and alkylated FR protein (n=5). Initial intraperitoneal immunizations administered on day 0 comprised 50 g of the respective immunogen mixed 1:1 (v:v) with complete Freund's adjuvant (Rockland, Cat #D614-0050). Mice were then boosted with 50 g immunogen mixed 1:1 (v:v) with incomplete Freund's adjuvant (Rockland, Cat #D615-0050) administered intraperitoneally 14 days later and every 21 days thereafter. Blood samples were collected from immunized mice 24 days after the initial immunization and every 21 days thereafter.

(156) Collected blood samples were analyzed by direct enzyme-linked immunoassay (EIA) against FR. Plates were coated with FR protein (100 ml of a 1 mg/mL solution in PBS, 0.02 M potassium phosphate, 0.15 M Sodium Chloride, pH 7.2) and incubated overnight at 4 C., washed with PBS containing 0.2% polysorbate-20 (TWEEN-20 detergent) (PBST; Rockland, Cat# MB-075-1000) and blocked with 3% fish gel (Sigma) for 1 hr at room temperature. A 3-fold dilution series of individual mouse serum samples were allowed to bind for 1 hr at room temperature, plates were then washed 3 times with PBST and subsequently probed with an HRP-conjugated rabbit-anti-mouse antibody (Rockland, Cat#610-4320) at 1:2500 for 30 minutes at 37 C. TMB substrate (Rockland, Cat# TMBE-100) was added and the reaction was stopped after 30 minutes by addition of 100 mL of 1M HCl prior to absorbance reading at 450 nm (Microplate Reader BENCHMARK; Biorad). All samples were counter-screened against hexa-histidine tagged recombinant mesothelin (mesothelin-His.sub.6) protein as a negative control.

(157) Spleens from mice showing the highest antigen-specific titers were harvested and hybridomas were prepared by electrofusion (HYBRIMUNE Model CEEF-50B Waveform Generator; Cellectis, Romainville, France) of splenocytes with Sp2/0 Ag14 myeloma cells (ATTC CRL1581). Subsequently, hybridoma supernatants were screened by ELISA against FR and recombinant Mesothelin-His.sub.6 as described above to select positive parental fusion cell lines.

(158) Selected parental cell lines determined to produce antibodies reactive to recombinant human FR (rhFR) were then subcloned by limiting dilution. The antibodies produced by these cells were then retested for FR binding and isotyped using the CLONETYPING System (SouthernBiotech, Birmingham, Ala.). Supernatants from these clones were further screened by direct ELISA against three additional isoforms of the human folate receptor (FR, FR and FR) to determine receptor specificity. Plates were coated overnight with 100 L of a 1 g/mL solution of the respective FR isoform at 4 C., washed with PBS containing 0.2% polysorbate-20 (TWEEN-20 detergent) (Rockland, Cat #MB-075-1000) and blocked with 3% fish gel (Sigma). A 3-fold dilution series of culture supernatants was allowed to bind for 1 hr at room temperature, before plates were washed and probed with an HRP-conjugated anti-mouse antibody as described above. Clones producing antibodies reactive to FR, FR and FR were not selected for further analysis.

(159) Four selected hybridoma clones, 19D4.B7, 26B3.F2, 24F12.B1, and 9F3.H9.H3.H3.B5.G2, were deposited with the American Type Culture Collection on May 19, 2011 and were assigned ATCC accession numbers PTA-11884, PTA-11885, PTA-11886, and PTA-11887, respectively.

Example 4Production of Purified Monoclonal Antibodies to FR

(160) Selected cell lines were tested for mycoplasma using a mycoplasma test kit (Rockland, Cat #MAB-012) before seeding into 1 L roller bottles containing serum free medium (Invitrogen, Cat #12045-076) and 5% low IgG FBS (0.1 g/ml) (Gibco, Cat #16250-078) at 0.510.sup.5 cells/mL. Cultures were allowed to grow at 37 C. for either 14 or 21 days, after which supernatant was harvested and concentrated approximately 10-fold through a 50 kDa filtration membrane (Spectrum Labs, Rancho Dominguez Calif.) and then purified using protein A chromatography (Rockland, Cat #PA50-00-0025). Bound antibody was eluted with 0.1M sodium citrate, pH 3.5/4.5 depending on antibody isotype, and buffer was exchanged against PBS by dialysis using a 12-14 kDa membranous tubing (Spectrum Labs, Rancho Dominguez Calif.). Purified antibody was sterile filtered using a 0.22 m EXPRESS PLUS Stericups (Millipore, Billerica Mass.) and stored at 4 C. for further testing.

(161) Efforts were undertaken to sequence the heavy and light chains of four selected hybridomas clones (9F3-H9, 19D4-B7, 24F12-B1, and 26B3-F2). First, total RNA was isolated from each hybridoma cell line (cell pellets of 110.sup.3 to 110.sup.5 cells each) using the RNAQUEOUS kit (Ambion) according to the manufacturer's protocol. RNA was quantified using a NANODROP 8000 spectrophotometer (Thermo Scientific).

(162) Isolated RNA was then amplified via multiplex RT-PCR, performed in triplicate for each hybridoma with a MASTERCYCLER EP Gradient Thermocycler (Eppendorf). First, two separate gene-specific cDNA amplifications were performed for each hybridoma (1 ug RNA/reaction) to determine which Ig heavy and light chain genes were used during Ig rearrangement. Each cocktail consisted of unique family-specific primers designed to anneal to any of the potential murine Ig V gene families (IgHv, IgKv) and Ig constant region genes (IgHc.sub.Gamma, IgKc). cDNA generation and amplification was performed using SUPERSCRIPT III One-Step RT-PCR System with PLATINUM Taq High Fidelity (Invitrogen) under the following conditions: 55 C. for 30 minutes and 95 C. for 2 minutes, followed by 40 cycles of 95 C. for 1 minute, 55 C. for 1 minute, 68 C. for 1 minute, and a final 68 C. for 10 minutes completion step. DNA products were electrophoresed on a 2% agarose gel. Appropriate bands were excised and gel purified using the QIAQUICK Gel Extraction Kit (Qiagen) following the manufacturer's protocol. Purified DNA was submitted for sequencing (GENEWIZ, Inc., South Plainfield, N.J.) to determine the germline gene segments expressed by each hybridoma.

(163) Further RT-PCR analysis suited to the particular genes identified for each hybridoma was then performed using the same RNA source as above and gene-specific primers (in contrast to family-specific primers used in the multiplex RT-PCR mixture). To facilitate cloning, amplified Ig cDNAs were placed into an In-Fusion (IF) expression vector, each gene-specific primer also contained vector-compatible linker sequences which would enable homologous crossover. All other reagents and thermocycler conditions are the same as those used for the multiplex RT-PCR experiments, described above.

Example 5Characterization of Antibody Binding to FR

(164) Binding characteristics of the purified monoclonal antibodies to FR were determined by surface plasmon resonance (SPR) experiments. All of the SPR experiments were performed at 25 C. using a BIACORE T100 with research grade CM5 chips (GE Healthcare), as specified by the manufacturer. Initially, anti-mouse IgG provided in the mouse antibody capture kit (GE Healthcare) was immobilized by amide coupling to CM5 sensor chips. Mouse anti-FR monoclonal antibodies (26B3, 24F12, 19D4, or 9F3) were captured on individual flow cells per binding cycle, while the fourth flow cell was used as a reference. Binding experiments were performed with HBS-P (GE Healthcare) as running buffer and at a flow rate of 30 L/min. Each monoclonal antibody sample (0.5 g/mL) was injected for 3 minutes to capture the antibody. Various concentrations of purified recombinant human FR (rh-FR) (1 nM-30 nM) were then injected over the FR-specific and reference surfaces for 3 minutes to record binding sensograms using a single-cycle kinetics method. The dissociation profile was monitored for 25 minutes. In between bindings, the surface was regenerated with a 30 l injection of 10 mM glycine (pH 1.7). The sensograms were processed and fitted to a 1:1 Langmuir binding model using BIACORE T100 evaluation software (version 2.0.1). Some of the binding characteristics of antibodies 26B3, 24F12, 19D4, and 9F3 are provided in Table 2.

(165) TABLE-US-00002 TABLE 2 Binding characteristics of FR-specific antibodies. Abbreviated Clone Name ka (1/Ms) kd (1/s) KD (M) Chi.Sq 26B3 5.24 10.sup.5 1.43 10.sup.5 2.73 10.sup.11 2.48 24F12 3.93 10.sup.5 3.99 10.sup.5 1.02 10.sup.10 1.08 19D4 4.27 10.sup.5 2.42 10.sup.4 5.67 10.sup.10 0.656 9F3 4.34 10.sup.5 3.10 10.sup.4 7.15 10.sup.10 1.89

Example 6Epitope Mapping of Selected FR-Specific Antibodies

(166) FR-specific antibodies 26B3, 24F12, and 9F3 were further assessed in epitope binding studies using OCTET QK system. The results showed that 26B3 and 24F12, which have high affinities to purified human FR, compete with one another for binding to FR. Thus, these antibodies may share a common epitope, or have epitopes that are immediately adjacent to each other. The results also indicate that the 9F3 antibody has a unique epitope, since it did not compete with other FR-specific antibodies for binding to FR.

(167) Additional epitope mapping studies were carried out by EXSAR using hydrogen/deuterium exchange mass spectrometry and docking methods. The results of these studies for antibodies 9F3, 24F12, and 26B3 are illustrated in FIG. 2. With regard to the epitope for antibody 26B3, these data suggest that it is accessible in the native, membrane-anchored structure, given the ability of 26B3 to recognize native FR by flow cytometry. Furthermore, these data further suggest that the conformational constraints of the epitope recognized by MAb 26B3, as demonstrated by its inability to detect the protein on reduced western blots, are related to the cysteine at position 185 in the FR protein which forms a di-sulfide bridge with cysteine 111.

Example 7Recognition of Denatured and Chemically-Preserved Forms of FR

(168) Experiments were conducted to determine whether any of the FR-specific antibodies, described above, could recognize denatured forms of FR. For these analyses CHOK1 cells stably expressing GPI-linked human FR, , or , were lysed in 1.1% OBG buffer (50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 1.1% OBG) supplemented with COMPLETE Mini Protease Inhibitor Cocktail (Roche Diagnostics, Indianapolis, Ind.) and PMSF (100 nM), and placed on ice for 15 minutes. Lysates were pre-cleared by centrifugation at 13,000 rpm for 15 minutes to remove debris. For reduced and denatured samples, equal amounts of protein (20 g) were boiled for 10 minutes in NUPAGE LDS sample buffer (Invitrogen) containing 5% -mercaptoethanol+40 mM DTT. Proteins were separated using SDS-polyacrylamide gel electrophoresis (SDS-PAGE) on a 4-12% bis-tris gel (Invitrogen) and transferred to a PVDF membrane. The membrane was blocked in PBST+ 5% non-fat milk for 1 h at room temperature after which time, the membrane was washed twice with PBST. Immunoblotting was conducted using purified mouse monoclonal antibodies 9F3, 19D4, 24F12, or 26B3 (1 g/mL) specific for FR, which were detected with a goat-anti-mouse HRP-conjugated antibody and visualized using SUPERSIGNAL West Pico chemiluminescent substrate (Pierce, Rockford, Ill.). Luminescence was visualized using the Omega 12iC molecular imaging system (Ultra-Lum, Claremont, Calif.) with image analysis performed using ULTRAQUANT 6.0 software (Ultra-Lum).

(169) Western blot analyses were also performed using purified folate receptor preparations. For these experiments, 0.5 g of purified human FR, , or , produced as described in Example 1, were incubated in 1SDS-PAGE sample loading buffer (Invitrogen) with or without 20 mM DTT, boiled for 10 min, and electrophoresed on 4-12% gradient SDS-PAGE gels. Protein was transferred to PVDF membrane and blots probed as described above. Gels were run using Benchmark prestained protein ladder (NOVEX). Gels using purified recombinant FR proteins were also visualized via silverstaining to ensure equal amounts of protein were loaded.

(170) Western blot analyses indicate that antibodies 19D4, 9F3, 24F12, and 26B3 recognize nonreduced FR, however, binding to reduced and denatured samples was not detected for any of these antibodies (FIGS. 3(A) and (B)).

(171) Immunohistochemistry (IHC) studies were also conducted to determine whether any of these antibodies could bind to formalin fixed paraffin embedded papillary serous ovarian cancer tissue samples. Indirect IHC testing was performed for FR using a MACH4 Universal HRP-Polymer Detection Kit (Biocare Medical). Formalin-fixed paraffin-embedded specimens were sectioned at 5 microns on positively-charged glass slides and heated for approximately 60 minutes at 60 C. Slides were deparaffinized in 3 sequential baths of xylene for 3 minutes each, transferred to three sequential baths of 100% alcohol for 3 minutes each, followed by three sequential baths of 95% alcohol for 3 minutes each and then rinsed for 5 minutes in deionized (DI) water. Prepared samples were then pretreated with Diva heat-induced epitope retrieval solution (Biocare Medical) diluted to 1:10 in DI water and placed inside a pressurized decloaking chamber already filled with 500 ml of DI water. The samples were incubated for 15 minutes inside the decloaking chamber, where pressurized incubation reached a maximum of 125 C. at 16 PSI for 30 seconds and then was cooled for 15 minutes down to 95 C. Slides were then cooled at room temperature for 15 minutes. After cooling, slides were washed in 3 sequential baths of Tris Buffered Saline/0.1% polysorbate-20 (TWEEN-20 detergent) wash buffer (TBST) for 3 minutes each. All subsequent buffer washes were also performed in this manner. Slides were then blocked in Peroxidase-1 (Biocare Medical) blocking solution for 5 minutes at room temperature, washed with TBST, and then Background Sniper (Biocare Medical) serum-free universal blocking reagent was applied for 10 minutes at room temperature. After the samples were blocked the slides were incubated with 2.5 g/ml of 26B3 antibody diluted in Antibody Diluent (Dako) or Universal Negative Control-Mouse ready-to-use negative control antibody (Dako, for negative isotype tissue) for 60 minutes at room temperature. Slides were then washed with TBST and incubated with MACH4 Mouse Probe Primary Antibody Enhancer (provided in the Biocare Medical MACH4 kit) for 15 minutes at room temperature. Slides were then washed again with TBST and incubated with a Polymer-HRP reagent (provided in the Biocare Medical MACH4 kit) for 20 minutes at room temperature. Following incubation, slides were washed with TBST and incubated with a 3,3-diaminobenzidine tetrahydrochloride (DAB) solution (Dako) for 5 minutes at room temperature. Then slides were thoroughly rinsed with DI water 3 times for 30-60 seconds each and counterstained with hematoxylin (Dako) for 2 minutes, washed with TBST, dehydrated in 3 sequential baths each of 95% and 100% alcohol for 30 seconds each, and cleared in 3 sequential baths of xylene for 30 seconds each. Finally, coverslips were applied to the slides prior to analysis.

(172) It is commonly thought that an antibody must be able to recognize a linear epitope of the antigen of interest to be effective for immunohistochemistry of formalin fixed paraffin embedded tissue because the antigen is devoid of tertiary structure due to the destructive nature of fixation of tissue. Thus it was surprising that antibody 26B3 was able to recognize FR in this assay (FIG. 4), since it does not recognize reduced and denatured FR by western blot. Furthermore, the pattern of FR staining with antibody 26B3 observed for normal tissues was consistent with previously published literature using a variety of other antibodies and techniques, with pancreas, thyroid, lung, salivary gland, kidney, hypophysis, cervix and breast showing expression to various degrees (Table 3). As shown in FIG. 5, the staining pattern in normal tissues, exemplified in normal lung (A) and normal kidney (B) sections, is highly restricted to epithelial cells and typically apical in nature.

(173) TABLE-US-00003 TABLE 3 FR expression in normal human tissues Staining Tissue Type (Number/Intensity) Comments Cerebrum 0/3 Cerebellum 0/3 Adrenal 0/3 Ovary 0/3 Pancreas 3/3; 2+ Limited to luminal borders of ductal and acinar cells Thyroid 2/5; 1+ (sparse) Cytoplasmic staining in follicular cells Hypophysis 3/3; 1+ Predominantly cytoplasmic Testis 0/3 Breast 3/3; 1+/2+ Ductal cells with luminal and membrane staining Spleen 0/3 Tonsil 0/3 Thymus 0/3 Bone Marrow 0/3 Lung 3/3; 2+ Staining in bronchial and alveolar cells Heart 0/3 Esophagus 0/3 Stomach 0/2 Small Intestine 0/3 Colon 0/3 Liver 0/3 Salivary Gland 3/3; 3+ Ductal and acinar cells Kidney 3/3; 3+ Luminal staining of proximal tubular cells Prostate 0/3 Endometrium 0/3 Cervix 1/3; 1+ Endocervical cells Skeletal Muscle 0/3 Skin 0/3 Nerve 0/3 Mesothelium 3/3; 2+ Alveolar cells (pleura and lung)

Example 8Recognition of Native forms of FR

(174) Flow cytometry studies were conducted to assess the ability of selected FR-specific antibodies to bind to the native protein. For these studies Chinese hamster ovary (CHO) cells expressing FR, were harvested, washed, and re-suspended in ice-cold growth media (RPMI supplemented with 10% FBS). Cells were incubated for 1 hour on ice with 9F3, 19D4, 24F12, or 26B3 (1 g/mL), washed and then incubated with FITC-conjugated secondary antibodies [dilution 1:100] (Southern Biotech, Birmingham, Ala.). Prior to analysis, cells were labeled with 7-amino-actinomycin D (7-AAD) (BD Biosciences, Franklin Lakes, N.J.) for the exclusion of nonviable cells. CHO cells not expressing FR were also subjected to the same experimental procedures, as a negative control. Cells were analyzed on an EASYCYTE Flow Cytometer (GUAVA Technologies, Hayward, Calif.). The data provided in Table 4 indicate that all four antibodies are capable of binding native FR.

(175) TABLE-US-00004 TABLE 4 FR-specific antibodies recognize FR expressed on the cell surface Geometric Mean Observed for Antibody: Target 9F3 26B3 24F12 19D4 Cells only 2.7 2.7 2.7 2.0 CHOK1 5.9 5.7 5.9 FR 759.5 853.7 777.0 1130.5 FR 6.1 5.9 6.6 FR 5.6 5.4 5.9

Example 9Detection of FR in the Serum of Subjects Known to have Ovarian Cancer

(176) Electrochemiluminescence studies were conducted to determine whether the FR-specific antibodies described herein could detect FR in the serum of patients known to have ovarian cancer. For these experiments MAb 26B3 was used as the capture MAb and added to ECL plates at a concentration of 75 g/mL. Plates were washed and 50 L of sample serum was added to each well and incubated for 2 hours. Serum samples were obtained from normal healthy females (negative control) and from ovarian cancer patients. Samples were diluted 1:4 in PBST (phosphate buffered saline, pH7.4, containing 0.01% polysorbate-20 (TWEEN-20 detergent)). Following incubation, samples were washed with PBST and 25 L/well of MAb 19D4 (1 g/mL), labeled with Ru at a ratio of approximately 13 labels/IgG molecule, was added to each well to detect bound sample. After a 2-hour incubation period, the plates were washed with PBST and read with 2MSD Buffer T. The results in Table 5 show that FR in serum can be captured and detected using monoclonal antibodies 26B3 and 19D4.

(177) TABLE-US-00005 TABLE 5 Relative serum levels of FR Category (n) Mean FRA pg/mL Standard Deviation Normal (15) 223 74 Ovarian Cancer (15) 1815 3896

Example 10Detection of FR in the Serum and Urine of Subjects Known to have Ovarian Cancer

(178) Electrochemiluminescence studies were then conducted to determine whether the FR-specific antibodies described herein could detect FR in the serum and urine of patients known to have ovarian cancer. For these experiments MAb 26B3 was used as the capture MAb and added to ECL plates at a concentration of 75 g/mL. Plates were washed and 50 L of sample serum was added to each well and incubated for 2 hours. Matched serum and urine samples were obtained from normal healthy females (negative control) and from ovarian cancer patients. Samples (serum or urine) were diluted 1:4 in PBST (phosphate buffered saline, pH7.4, containing 0.01% polysorbate-20 (TWEEN-20 detergent)). Following incubation, samples were washed with PBST and 25 L/well of MAb 19D4 (1 g/mL), labeled with Ru at a ratio of approximately 13 labels/IgG molecule, was added to each well to detect bound sample. After a 2-hour incubation period, the plates were washed with PBST and read with 2MSD Buffer T. The results in Table 6 show that FR in serum and urine can be captured and detected using monoclonal antibodies 26B3 and 19D4.

(179) TABLE-US-00006 TABLE 6 Relative serum and urine levels of FR Patient Designation Serum FRalpha pg/mL Urine FRalpha pg/mL Normal 1 398 3080 Normal 2 236 11508 Normal 3 315 7704 Normal 4 320 13198 Ovarian Cancer 1 19479 368066 Ovarian Cancer 2 4144 23738 Ovarian Cancer 3 986 165826 Ovarian Cancer 4 719 414187

Example 11M-Score as a Metric for Immunohistochemistry Results

(180) A metric for staining (M-score) of each sample was developed and can be defined as follows:

(181) M i = j = 1 3 W j .Math. X ij j = 1 3 W j = j = 1 3 W j .Math. X ij 6

(182) In the equation, x.sub.ij is the percentage of tumor stained at intensity j for patient i and w.sub.j is the absolute value of the intensity (ranging from 0 to 3+). The metric has a theoretical range from zero (no positive staining) to fifty (100% of cells staining at 3+ intensity). As such, the M-score is a weighted score for FR IHC tumor cell membrane staining that captures both the proportion of FR positive cells and staining intensity. M-scores for each patient were averaged over multiple tissue microarray (TMA) samples, where appropriate. If a sample was void of results, i.e. no tumor present or necrotic tissue, the M-score was assigned to the non-void determinations.

(183) A practical application of the above equation is presented below:

(184) TABLE-US-00007 3+ 2+ 1+ 0 M Score x = 40 y = 30 z = 10 M = (3x + 2y + z)/6 3 40 = 120 2 30 = 60 1 10 = 10 (120 + 60 + 10)/6 = 31.67
Here, x=% of tumor stained with intensity 3+; y=% of tumor stained with intensity 2+; z=% of tumor stained with intensity 1+.

(185) The positivity rate for FR expression within a given histology was calculated as the proportion of samples that were stained positive according to the definition of a positive result (5% of the total tumor cells staining). Exact binomial confidence intervals were determined using established methods (Clopper C. J. and Pearson R. C., Biometrika. 26:404-13 (1934)). Summary statistics are presented herein for all demographic variables and for the M-score. Differences for mean values were determined using one-way ANOVA with post-hoc tests controlling for overall type I error. Differences in mean values were statistically different if the p-value associated with the test was less than the Bonferroni adjusted type I error for that test (maximum Type I error=0.05).

Example 12Comparative Staining of Lung Carcinoma Cells with Antibody 26B3 and Antibody BN3.2

(186) There is significant variation in the literature with respect to the percent of various carcinomas that express FR as determined by IHC, in part due to the use of a variety of antibodies, most of which are not commercially available. One FR specific MAb that is commercially available and has been demonstrated to detect FR on FFPE sections by IHC is antibody BN3.2 (Leica Microsystems, Buffalo Grove, Ill.). Therefore studies were conducted to compare antibody BN3.2 to antibody 26B3 for both specificity and sensitivity for the detection of FR using a commercial TMA containing various histological types of lung cancer. Both antibodies were highly specific for adenocarcinoma as compared with other histologic subtypes, particularly squamous cell carcinoma. However, antibody 26B3 was significantly more sensitive than BN3.2, identifying 26/36 (72%; M-score meanSD=19.8418.64) and 22/36 (61%; M-score meanSD=11.3814.25) adenocarcinoma samples, respectively (p<0.0001). These data demonstrate that antibody BN3.2 is significantly less sensitive than antibody 26B3 for detecting FR expression on FFPE tissue samples and, as shown in FIG. 6, the relationship in observed M-scores on lung adenocarcinoma samples for these two antibodies is non-linear.

Example 13Detection of FR in Subjects Known to have Adenocarcinoma of the Lung

(187) Experiments were conducted to determine whether the presence of FR positive histology, as detected by antibody 26B3, was associated with particular forms of lung cancer. A tissue microarray having duplicate samples of normal and cancerous, stage I, stage II, stage III, and stage IV, lung tissue specimens was assessed for FR expression via IHC staining using antibody 26B3, as described in Example 7. As can be seen from the data in Table 6, FR is associated with adenocarcinomas relative to squamous cell carcinomas, which exhibited limited positive staining.

(188) TABLE-US-00008 TABLE 7 Histological evaluation of cancerous tissue samples Membrane Positive Membrane Staining Negative Positive Total Histology Groups Adenocarcinoma Count 11 27 38 % within Histology Groups 28.9% 71.1% 100.0% Squamous Count 28 3 31 % within Histology Groups 90.3% 9.7% 100.0% Other Carcinomas Count 17 4 21 % within Histology Groups 81.0% 19.0% 100.0% Normal Count 2 8 10 % within Histology Groups 20.0% 80.0% 100.0% Total Count 58 42 100 % within Histology Groups 58.0% 42.0% 100.0%

(189) Further analyses were performed on 89 of the histological samples in the tissue microarray where 36 (40%) were adenocarcinoma, 32 (36%) were squamous cell carcinoma, 2 (2%) were adenosquamous carcinomas, and the remaining 19 (21%) represented a variety of histologies (Table 8). The overall rates of FR positivity varied substantially for each of the histologic subtypes. A significantly higher proportion of adenocarcinoma tumors were positive for FR when compared to squamous cell carcinomas (72% versus 13%, p<0.0001). Of the 4 positive squamous cell carcinoma samples, only 1 showed 3+ staining on both samples; 1 had intermediate (2+) staining on both samples and the other 2 were very weakly positive in a single sample (5-10% of tumor cells at 1+). Furthermore, the two adenosquamous carcinoma samples were also shown to be positive for FR, with staining restricted to the adenocarcinoma portion of these samples (FIG. 7).

(190) TABLE-US-00009 TABLE 8 Distribution of FR Expression Across NSCLC Type# FR FR negative positive Variable N (%) N (%) Total P value* Tumor Histology Normal 1 (10%) 9 (90%) 10 Squamous cell carcinoma 28 (87%) 4 (14%) 32 <0.0001 Large cell carcinoma 3 (60%) 2 (40%) 5 Small cell carcinoma 7 (87%) 1 (13%) 8 Neuroendocrine 4 (67%) 2 (33%) 6 carcinoma Adenocarcinoma** 10 (16%) 28 (74%) 38 Tumor Grade Grade 1 1 (20%) 4 (80%) 5 Grade 2 5 (22%) 18 (78%) 23 Grade 3 4 (40%) 6 (60%) 10 0.517 Tumor Stage Stage I 4 (29%) 11 (71%) 15 Stage II 2 (17%) 10 (83%) 12 Stage III + IV*** 4 (36) 7 (64) 11 0.563 Gender Female 3 (18%) 14 (82%) 17 Male 7 (33%) 14 (67%) 21 0.46 #US Biomax Lung Cancer TMA (catalog # BC041114; 90 cases, duplicate cores) *P values determined using Fisher's exact test or chi-square test: squamous cell carcinoma versus adenocarcinoma p < 0.0001; males versus female, p = 0.46; stage, p = 0.563; grade, p = 0.517 **Includes 2 adenosquamous cases, both positive for FR in the adenocarcinoma portion only ***Only 1 stage IV case

(191) M-score analyses of duplicate adenocarcinoma histology samples showed little variation in staining by antibody 26B3 (FIG. 8), a reflection of the robustness of antibody 26B3 staining. Also, an examination of M-scores by stage and grade within the adenocarcinoma histologic subtype indicated that neither stage nor grade of disease was associated with the degree of staining as defined by the M-scores (data not shown).

(192) The M-score distribution for FR staining of lung adenocarcinoma and squamous cell carcinoma samples is shown in FIG. 9. The mean (SD) M-scores for adenocarcinoma and squamous cell carcinoma samples stained with antibody 26B3 were 19.84 (18.64) and 1.39 (5.54), respectively (p<0.0001). The M-score for adenocarcinoma was also significantly higher when compared against all other lung cancer histologic types. In addition, a Tree Analysis was performed to determine the odds for the histology of the cancer being adenocarcinoma. An M-score>21.7 resulted in an odds ratio (OR) of 16, further demonstrating that FR is predominately expressed in the adenocarcinoma histology (analysis not shown).

(193) Formalin-fixed, paraffin-embedded (FFPE) tissue blocks are rarely available from patients diagnosed with late stage lung cancer, as surgical resections are not typically performed. Therefore, studies were performed to determine the suitability of fine needle aspirate (FNA) specimens for FR IHC using MAb 26B3, as late stage lung cancer is most frequently diagnosed via small biopsy or cytology material. For these studies, samples were obtained from nine late-stage adenocarcinoma patients diagnosed by cytological evaluation of a thoracic lymph node aspirate (FIG. 10) and demonstrated that the rate of FR positivity (63%) was comparable to that seen for the histological specimens assessed on the lung cancer TMA. Although only a small sample size, these data suggest that cytologic specimens may be a suitable tissue source for determining FR expression in late stage adenocarcinoma patients.

Example 14FR is Expressed by CK+/CD45 Cells, but Not CK/CD45+ Cells, Isolated from the Blood of Patients Known to have Non-Small Cell Lung Carcinoma

(194) Studies were conducted to determine the expression profile of FR on circulating tumor cells (CTCs) of Patients known to have Non-Small Cell Lung Carcinoma. For these studies, blood samples were obtained from 15 healthy donors and 5 stage IV lung cancer patients and then enriched for CTCs via dielectrophoresis field flow fractionation using ApoCell's APOSTREAM system. After enrichment, each sample was stained for cytokeratin (CK), CD45 (protein tyrosine phosphatase receptor type C), nuclei, and FR. FR staining was performed using antibody 26B3 as the primary antibody, which was then detected using a mouse-specific, secondary antibody conjugated to DYLIGHT 649 fluorescent dye. As shown in Table 9, FR expression was observed by CK+/CD45 CTCs, but not CK/CD45+ CTCs.

(195) TABLE-US-00010 TABLE 9 Expression of FR by circulating tumor cells of patients known to have non-small cell lung carcinoma FR MFI Patient ID CK/CD45+/FR+ % (CK/CD45+) CK/CD45+ count Patient 1 2,270 0.0 NA Patient 2 24,462 0.0 NA Patient 3 26,503 0.0 NA Patient 4 16,540 0.0 NA Patient 5 2,652 0.0 NA CK+/CD45 cell count in 7.5 mL of blood Patient 1 55 15.6 82,195 Patient 2 105 32.8 172,669 Patient 3 216 9.3 146,521 Patient 4 57 16.7 179,027 Patient 5 47 8.1 277,335

Example 155-Year Survivorship of Subjects with and without FR-Expressing Adenocarcinoma of the Lung

(196) Experiments were conducted to determine whether the presence of FR positive histology, as detected by antibody 26B3, could be associated with either improved or diminished 5-year survivorship. Normal and cancerous, stage I or stage II adenocarcinoma, lung tissue specimens were subjected to IHC staining, as described in Example 7, and then read. The percentage of 3+, 2+, 1+ and 0 intensity of the stain on the tumor was recorded. There were 177 slides that were interpretable as duplicate or triplicate of a patient. When combined with the evaluable clinical and histological data 53 evaluable cases were identified. The analyses were performed in view of data relating to demographic, clinical and survival status at 5 years past diagnosis of non-small cell adenocarcinoma of the lung.

(197) To determine an optimal cut-point for the M-score a receiver operating characteristic (ROC) analysis was performed. Diagnostic accuracy was of no importance in this analysis; however, the ratio of the diagnostic likelihood ratio of the positive test to the diagnostic likelihood ratio of the negative test was important. These ratios are defined as described in Pepe M S, The statistical evaluation of medical tests for classification and prediction, New York: Oxford University Press (2003). At a cut-point of 10 the odds ratio achieved a maximum of 6.62. This value of M was chosen to determine the positivity of a stained slide.

(198) Kaplan-Maier survival functions were produced with FR association as the prognostic factor. A log rank test indicated that being positive for FR was beneficial for non-fatal events (Chi-sq=7.34, df=1, p=0.007). FIG. 11 illustrates the survival functions for stage I and stage II adenocarcinoma groups deemed to be FR positive and FR negative by 26B3 detection. At 5 years the hazard ratio is 2.42. This indicates that subjects having tumors that are negative (M<10) for FR are 2.5 times more likely to die within five years of diagnosis than subjects with FR-positive tumors (M10).

Example 16Folate Receptor Alpha Expression is Associated with Triple-Negative Forms of Breast Cancer

(199) Studies were conducted to assess the expression of FR by breast cancer tissue samples. Analyses were conducted using tissue microarray (TMA) samples stained with antibody 26B3 as described in Example 7 and FFPE histology samples prepared and stained with antibody 26B3 as described in Example 7.

(200) The distribution of histologies present on the breast cancer TMA (U.S. BioMAX catalog #BR1503a; 72 cases, duplicate cores) are shown in Table 10, the majority of the cases represented being identified as invasive ductal carcinoma (IDC). The TMA included 2 normal breast samples, which were positive for FR expression as determined by MAb 26B3. Staining in normal breast was restricted to ductal cells with luminal and membrane staining. Two of three fibroadenoma cases (67%), 0/2 cystosarcoma cases (0%) and 1/6 ductal carcinoma in situ cases (17%) were positive for FR. The single invasive lobular carcinoma (ILC) was negative for FR staining. Of the 59 IDC samples 18 (31%) were positive for FR (FIG. 12). Given the small number of positive cases on this TMA a valid analysis of FR expression relative to stage or grade was not possible; however, it should be noted that the majority of samples were either T1 or T2. FR expression was shown to associate with ER/PR negative tumors relative to ER/PR positive tumors (p=0.012) and with triple negative breast cancers (TNBC) (ER/PR+ or Her2+ versus ER/PR/Her2, p<0.0001).

(201) Of the 18 FR positive IDC cases, only 2 (11%) were Her2 positive meaning that the vast majority (89%) were Her2 negative. These data suggest that FR positivity tracks more closely with Her2 negativity. Further, of the 18 FR positive IDC cases, 3 were estrogen receptor (ER) positive and 4 were progesterone receptor (PR) positive, but all ER/PR positive/FR positive cases were Her2 negative. Of the FR positive IDC cases 12/18 (67%) were triple negative breast cancers (TNBC), suggesting that FR may be a marker and target for very poor prognosis TNBC molecular subtype. Looking at the TMA as a whole, only 2/13 (15%) of all Her2 positive cases were also positive for FR while 16/46 (35%) of the Her2 negative cases were also FR positive, supporting the suggestion that FR expression correlates negatively with Her2 expression. A representation of the distribution of M-scores for this TMA relative to molecular subtype (her-2 (+) and her-2 ()) is shown in FIG. 13.

(202) The TMA described above was composed primarily of early stage breast cancers: stage I, 6/60 (10%); stage II, 44/60 (73%); stage III, 10/60 (17%). Therefore, to confirm and extend the results obtained on the TMA, 61 FFPE tissue blocks from stage IV(T4) Her2 negative breast cancers with known ER/PR expression ranging from 0-100% positive were assessed (FFPE tissue blocks were obtained from the archives of Genzyme Genetics). All 61 of these samples were from metastases, not the primary tumor. The results of this study are summarized in Table 11.

(203) TABLE-US-00011 TABLE 10 Distribution of FR positivity across histology types - TMA data FR positive FR negative Tumor Histology N (%) N (%) Total P value* Normal 2 (100%) 0 (0%) 2 Fibroadenoma 2 (67%) 1 (33%) 3 Cystosarcoma 0 (0%) 2 (100%) 2 DCIS - Ductal carcinoma in situ 1 (17%) 5 (83%) 6 ILC - Invasive lobular 0 (0%) 1 (100%) 1 carcinoma IDC 0 Invasive ductal carcinoma 18 (31%) 41 (69%) 59 Total carcinomas: 21 (30%) 50 (70%) 71 IDC Molecular subtype analysis: ER/PR+ 4 (14%) 24 (86%) 28 {close oversize bracket} {close oversize bracket} 0.012 ER/PR 14 (45%) 17 (55%) 31 Her2+ 2 (15%) 11 (85%) 13 {close oversize bracket} {close oversize bracket} 0.307 Her2 16 (35%) 30 (65%) 46 ER/PR/Her2 12 (67%) 6 (33%) 18 <0.0001 (ER/PR+ or Her2+ versus ER/PR/Her2) T1 3 (43%) 4 (57%) 7 T2 10 (26%) 29 (74%) 39 T3 5 (63%) 3 (37%) 8 T4 0 (0%) 5 (100%) 5 N0 18 (35%) 33 (65%) 51 {close oversize bracket} {close oversize bracket} 0.092 N1/N2** 0 (0%) 8 (100%) 8 Grade 1 1 (14%) 6 (86%) 7 {close oversize bracket} {close oversize bracket} 0.393 Grade 2 12 (36%) 21 (64%) 33 {close oversize bracket} {close oversize bracket} Grade 3 5 (26%) 14 (74%) 19 0.6465 *P values calculated via 2X2 contingency table analysis using Fisher's exact test. ** 4/8 (50%) of N1/N2 samples were Her2+

(204) FR expression (FIG. 14) was found in 22/61 (36%) of these patients, demonstrating that the percent of FR positive specimens/tumors determined in early stage disease is retained in late stage metastatic disease in a Her2 negative population (TMA positivity=35%; stage IV metastatic disease=36%). Of the 22 FR positive stage IV metastatic patients, only 3 (14%) showed any positivity for ER/PR with such positivity trending in the low range (up to 30%). As such, 19/22 (86%) FR positive patients were of the triple negative molecular subtype. Again, these data compare favorably with the data obtained in early stage disease on the TMA where 67% of all FR positive patients were of the triple negative subtype.

(205) TABLE-US-00012 TABLE 11 Distribution of FR positivity in molecular subtypes of metastatic breast cancer samples Tumor Molecular FR positive FR negative subtype N (%) N (%) Total P value* Total Samples: 22 (36%) 39 (64%) 61 ER/PR+ 3 (14%) 20 (86%) 23 ER/PR/Her2 19 (50%) 19 (50%) 38 0.0054 (ER/PR+ versus ER/PR/Her2) Grade 1 3 (30%) 7 (70%) 10 Grade 2 11 (28%) 28 (72%) 39 1.0 (Grade 1 versus Grade 2) Grade 3 8 (67%) 4 (33%) 12 0.037 (Grade 1 or 2 versus Grade 3) *P values calculated via 2X2 contingency table analysis using Fisher's exact test.

(206) Additionally, samples from stage IV metastatic disease were obtained from a number of metastatic sites including lymph node, bone, skin and liver as well as fluid and fine needle aspirate (FNA) samples obtained primarily from pleura and paracentesis. Several of these fluid biopsies stained positive for FR (FIG. 15) suggesting the general applicability of the described IHC methodology to multiple samples types.

Example 17Evaluation of Histological Gynecologic Cancer Samples for Expression of Folate Receptor Alpha

(207) Immunohistochemical studies were conducted to evaluate FR expression in gynecologic malignancies involving ovary, endometrium and fallopian tube. Analyses were conducted using tissue microarray (TMA) samples stained with antibody 26B3 as described in Example 7 and FFPE histology samples prepared and stained with antibody 26B3 as described in Example 7. Commercial tissue microarrays were obtained from US Biomax, Inc. (Rockville, Md.) for ovarian carcinomas (catalog #OV1921; 96 cases, duplicate cores); endometrial carcinomas (catalog #EMC1021; 102 cases, single cores); and fallopian tube carcinomas (catalog #UTE601; 30 cases, duplicate cores).

(208) A sample was considered positive for FR expression if the percentage of the tumor cells positive for membranous staining was greater than or equal to 5% at any intensity. A sample was rejected and therefore not included in the analyses if the gynecologic pathologist determined it was either missing entirely or was composed of necrotic tissue with an insufficient number of viable cells for evaluation. Of the endometrial samples, six contained only atypical complex hyperplasia without adenocarcinoma. Histologic classification of cell type and grade were based the WHO Classification of Breast and Female Genital Organs (Tavassoli and Devilee). Clinical stage based on FIGO and TNM system was provided by the manufacturer of the TMA (US Biomax).

(209) The positivity rate for FR expression within a given tumor type was calculated as the proportion of tumors that were stained positive according to the definition of a positive result (5% tumor cell membrane staining). Differences in FR positivity between groups, e.g. histologies, stage or grade, were assessed using 22 contingency tables and Fisher's exact test. Differences in mean values were statistically different if the p-value associated with the test was less than the Bonferroni adjusted type I error for that test (maximum Type I error=0.05).

(210) Membrane and cytoplasmic staining intensity was scored as 0, no staining; 1+, weak; 2+, moderate and 3+, strong. The percent of cells for each intensity in the sample was also determined. Tissue was analyzed under 4, 10, 20 and 40 objectives. Strong membrane staining (3+) was readily visualized under 4 and confirmed at 10. Moderate membrane staining (2+) was visible at 10 and confirmed at 20. Weak staining (1+) required 20 or 40 (FIG. 16). In the presence of 3+ staining, the membrane was thick occurring at apical and lateral cell borders. In tangential sections, a complete circumferential pattern was evident (FIGS. 16(A) and (B)). 2+ membrane staining was weaker in intensity and thinner than 3+, usually localized on the apical luminal borders and occasionally on lateral cell borders. 1+ weak membrane was generally limited to the luminal borders. The accompanying cytoplasmic staining was variable, depending on the type of tumors.

(211) Of the 94 evaluable samples on the ovarian tumor TMA, 70 (74%) were of the serous type, 10 (11%) were mucinous, 4 (4%) endometrioid, 3 (3%) clear cell type and the remaining 7 (8%) were miscellaneous rare tumors. Of the 87 samples of ovarian carcinomas, the FR positive rate for each cell type was as follows: 100% (70/70) in serous type, 80% (8/10) mucinous type, 75% (3/4) endometrioid type, and 67% (2/3) clear cell type. The difference between serous and mucinous type is significant with p value at 0.014 by Fisher's exact test (Table 12). FR status was not significant for histologic grade or clinical stage. Co-existing cytoplasmic staining was usually 2+ or 3+ in serous type and weaker and less frequent in other tumor types.

(212) TABLE-US-00013 TABLE 12 Distribution of FR positivity in relation to histology type, clinical stage and histologic grade in ovarian carcinomas FR negative FR positive Tumor Histology* N (%) N (%) Total P value** Serous carcinoma 0 (0%) 70 (100%) 70 Mucinous carcinoma 2 (20%) 8 (80%) 10 0.014 Endometrioid 1 (25%) 3 (75%) 4 carcinoma Clear cell carcinoma 1 (33%) 2 (67%) 3 Total 4 (5%) 83 (95%) 87 Stage II 4 (9%) 41 (91%) 45 Stage III 0 (0%) 29 (100%) 29 0.15 Stage IV 0 (0%) 13 (100%) 13 Grade 1 2 (15%) 11 (85%) 13 NS*** Grade 2 1 (3%) 31 (97%) 32 NS Grade 3 1 (3%) 39 (97%) 40 NS *1 transitional cell carcinoma, 1 squamous carcinoma, 1 Embryonal carcinoma, 2 yolk sac tumors and 2 granulosa cell tumors not included in analysis **P values determined using Fisher's exact test or chi-square test: serous carcinoma versus mucinous carcinoma p = 0.014 ***NS = Not Significant

(213) In the endometrial samples, FR was expressed in 80% (4/5) of normal (FIG. 17(A)), 100% (6/6) of atypical complex hyperplasia (FIG. 17(B)), and 89% (80/90) of adenocarcinomas, including 88 endometrioid type and 1 clear cell type (FIGS. 18 and 19). Eight endometrioid adenocarcinomas contained areas of squamous metaplasia. In the normal endometrium, membrane staining was weak and limited to the apical luminal borders (FIG. 17(A)). In atypical complex hyperplasia and carcinomas, staining was predominantly luminal with additional staining on lateral cell borders in some cases (FIG. 17(B)). In the presence of 3+ membrane staining, cytoplasmic staining varied in intensity from strong (FIG. 18(A)) to weak (FIGS. 18(B) and (C)). Tumor cells with 1+ or 2+ membrane staining rarely expressed cytoplasmic staining. The majority of metaplastic squamous cells and clear cells exhibited moderate to strong membrane staining. (FIGS. 19(A) and (B)).

(214) FR expression was positive in 100% of grade 1, 96% of grade 2 and 74% of grade 3 tumors (grade 1 vs. grade 3, p value=0.0029; grade 2 vs. grade 3, p=0.034). FR status was not significant in relation to T1 vs. T2/3; N0 vs. N1, and stage I vs. stage II/III.

(215) Seventeen cores of normal fallopian tubes, 16 samples of chronic salpingitis and 20 tubal serous carcinomas were all strongly positive for membrane and cytoplasmic staining (FIGS. 20(A) to (C)).

Example 18Evaluation of Histological Colorectal Samples for Expression of Folate Receptor Alpha

(216) Immunohistochemical studies were conducted to evaluate FR expression in colorectal tissue samples. Analyses were conducted using tissue microarray (TMA) samples obtained from US Biomax (catalog #BC051111). The TMA contained 90 duplicate samples of tissues obtained from subjects known to have colorectal cancer and 10 normal colorectal samples. The samples were stained with antibody 26B3 as described in Example 7. Of the 90 samples obtained from subjects known to have colorectal cancer, 18 (20%) were positive for FR expression, while none of the normal samples were positive. In addition, positive stating was generally medium to weak and no apparent relationship to stage of disease was discernible.

Example 19Evaluation of Histological Thryoid Samples for Expression of Folate Receptor Alpha

(217) Immunohistochemical studies were conducted to evaluate FR expression in thyroid tissue samples. Analyses were conducted using tissue microarray (TMA) samples obtained from US Biomax (catalog #TH802a). The samples were stained with antibody 26B3 as described in Example 7. Thyroid papillary carcinoma was strongly positive for FR membrane expression (26/28, 93%) and was distinguishable from medullary carcinoma, where all 5 samples were negative for FR staining, in agreement with previous reports. Interestingly, follicular adenomas were separable into macrofollicular type and microfollicular type with 3/13 (23%) and 18/22 (82%) showing positivity for FR expression, respectively. Some positivity was also seen in the small number of Hurthle cell tumors (, 67%) and follicular carcinoma ( 3/7, 43%) samples on this TMA. These results are summarized in Table 13.

(218) TABLE-US-00014 TABLE 13 Expression of FR in thyroid tissue samples Thyroid FR positive FR negative Cancer Hisotologic Subtype (N = 78) N (%) N (%) Papillary carcinoma, 28 (36%) 26 (93%) 2 (7%) Medullary carcinoma, 5 (6%) 0 (0%) 5 (100%) Follicular Adenoma, macrofollicular 3 (23%) 10 (77%) type, 13 (17%) Follicular Adenoma, microfollicular 18 (82%) 4 (18%) type, 22 (28%) Hurthle cell tumor, 3 (4%) 2 (67%) 1 (33%) Follicular carcinoma, 7 (9%) 3 (43%) 4 (57%)