Fusion protein with half-life extending polypeptide
11584778 · 2023-02-21
Assignee
Inventors
Cpc classification
C07K2319/35
CHEMISTRY; METALLURGY
C07K16/2875
CHEMISTRY; METALLURGY
C07K14/705
CHEMISTRY; METALLURGY
C07K2317/94
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
C12N9/20
CHEMISTRY; METALLURGY
C07K2319/31
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
International classification
Abstract
A fusion protein is provided, comprising i) a biologically active polypeptide; and ii) a half-life extending polypeptide moiety comprising 2-80 units independently selected the amino acid sequences according to SEQ ID NO: 1: X1-X2-X3-X4-X5-X6-D-X8-X9-X10-X11 (SEQ ID NO: 1) in which, independently: X1 is P or absent; X2 is V or absent; X3 is P or T; X4 is P or T; X5 is T or V; X6 is D, G or T; X8 is A, Q or S; X9 is E, G or K; X10 is A, E P or T; and X11 is A, P or T. The half-life extending polypeptide moiety has a generally unfolded conformation and provides a fusion protein with a large hydrodynamic radius that may avoid renal clearance. As a result, the biological half-life of the fusion protein is increased and the biological effect of the biologically active polypeptide may thus be prolonged.
Claims
1. A fusion protein comprising: i) at least one biologically active polypeptide; and ii) at least one biological half-life extending polypeptide moiety comprising 2-80 units, each unit being independently selected from the amino acid sequence of SEQ ID NO: 1: X1-X2-X3-X4-X5-X6-D-X8-X9-X10-X11 (SEQ ID NO: 1) in which, independently, X1 is P or absent; X2 is V or absent; X3 is P or T; X4 is P or T; X5 is T or V; X6 is D, G or T; X8 is A, Q or S; X9 is E, G or K; X10 is A, E, P or T; and X11 is A, P or T; wherein at least one unit is selected from the amino acid sequences of SEQ ID NO: 10 and 11.
2. The fusion protein according to claim 1, wherein said half-life extending polypeptide moiety form a contiguous sequence of 4-80 units, each unit being independently selected from the amino acid sequence of SEQ ID NO:1.
3. The fusion protein according to claim 1, comprising multiple half-life extending polypeptide moieties, each polypeptide moiety comprising 2-80 units, each unit being independently selected from the amino acid sequence of SEQ ID NO:1.
4. The fusion protein according to claim 1, wherein at least one of said half-life extending polypeptide moieties, is positioned N-terminally or C-terminally of said biologically active polypeptide.
5. The fusion protein according to claim 1, wherein said half-life extending polypeptide moiety, or at least one of said multiple half-life extending polypeptide moieties, constitutes an insertion into, the amino acid sequence of the biologically active polypeptide.
6. The fusion protein according to claim 1, wherein said half-life extending polypeptide moiety comprises 2-80 units of one or more amino acid sequence(s) selected from SEQ ID NOs: 2-11.
7. The fusion protein according to claim 6, wherein said half-life extending polypeptide moiety comprises at least one amino acid of the sequences selected from the group consisting of SEQ ID NOs: 12-21 and 57-66.
8. The fusion protein according to claim 6, wherein said half-life extending polypeptide moiety consists of at least one of the amino acid sequences selected from the group consisting of SEQ ID NOs: 12-21 and 57-66.
9. The fusion protein according to claim 6, wherein said half-life extending polypeptide moiety comprises at least one of the amino acid sequences selected from the group consisting of SEQ ID NOs: 100-105.
10. The fusion protein according to claim 9, wherein said half-life extending polypeptide moiety consists of at least one of the amino acid sequences selected from the group consisting of SEQ ID NOs: 100-105.
11. The fusion protein according to claim 1, wherein said half-life extending polypeptide moiety comprises 6-70 units, each unit being independently selected from the amino acid sequence of SEQ ID NO:1.
12. The fusion protein according claim 1, comprising at least one of: i) a hydrodynamic radius of at least 3.8 nm, and ii) an apparent size in solution of at least 60 kDa as determined by size exclusion chromatography.
13. The fusion protein of claim 1, wherein the amino acid sequence of SEQ ID NO:1 is of human origin.
14. The fusion protein according to claim 13, wherein the half-life extending polypeptide moiety corresponds to a naturally occurring human amino acid sequence.
15. The fusion protein according to claim 1, wherein each unit according to SEQ ID NO:1 comprises at most one O-glycosylation.
16. The fusion protein according to claim 1, comprising a plurality of biologically active polypeptides.
17. A pharmaceutical composition comprising the fusion protein according to claim 1 and a pharmaceutically acceptable carrier.
18. The pharmaceutical composition of claim 17, formulated for subcutaneous or intravenous administration.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
DETAILED DESCRIPTION
(6) The human lactating mammary gland and pancreas produce a lipolytic enzyme, bile salt-stimulated lipase (BSSL), also referred to as bile salt-activated lipase (BAL) or carboxylic ester lipase (CEL) (EC 3.1.1.13). The protein is arranged in two domains, a large globular amino-terminal domain and a smaller but extended carboxy-terminal (C-terminal) domain (for a review, see e.g. Wang & Hartsuck (1993) Biochim. Biophys Acta 1166: 1-19).
(7) The present inventors surprisingly found that repetitive sequences based on or derived from the C-terminal domain of human BSSL can be successfully fused to biologically active proteins or peptides and confer increased biological half-life of the fusion partner, thereby extending its biological or therapeutic effect in vivo, as demonstrated in the Examples below.
(8) The C-terminal domain of human BSSL consists of repeating units of, or similar to, the formula “PVPPTGDSGAP” (SEQ ID NO: 5). Table 2 in Example 1 below lists the repeating units from human BSSL variants. The most common form of the C-terminal domain contains 18 repeating units (UniProt entry P19835). However, there are variations in the human population, both with regard to the number of repeating units, and the amino acid sequence of the individual repeating units. Furthermore, each repeating unit has one site that may be 0-glycosylated, increasing the hydrophilicity and size of the region (Stromqvist et al. Arch. Biochem. Biophys. 1997). The C-terminal end of the domain is however hydrophobic, and has been shown to bind into the active site of BSSL and cause auto-inhibition of the enzyme. The most frequent human sequence of this hydrophobic portion is “QMPAVIRF” (SEQ ID NO: 106) (Chen et al. Biochemistry 1998).
(9) It has previously been speculated that the C-terminal domain may be responsible for the stability of BSSL in vivo, for example its resistance to denaturation by acid and aggregation under physiological conditions (Loomes et al., Eur. J. Biochem. 1999, 266, 105-111). In contrast, another study of the cholesterol esterase structure showed that the C-terminal domain, which is enriched with Pro, Asp, Glu, Ser and Thr residues, is reminiscent of the PEST-rich sequences in short-lived proteins, suggesting that the protein may have a short half-life in vivo due to the repetitive sequences in the C-terminal domain (Kissel et al., Biochimica et Biophysica Acta 1989, 1006).
(10) In the present invention, the extended biological half-life of a fusion protein comprising a half-life extending polypeptide moiety as defined herein, based on or derived from the C-terminal domain of human BSSL, is believed to be due mainly to the increased hydrodynamic radius of the protein. However, it is also envisaged that other mechanisms may contribute to the increased biological half-life.
(11) As used herein, the expressions “fused” and “fusion” refer to the artificial joining of two or more portions of chemical entities of the same kind, such as peptides, polypeptides, proteins, or nucleic acid sequences. A fusion protein as referred to herein typically comprises at least two polypeptide portions, which may be of different origin; for instance, a biologically active polypeptide, which is not BSSL, and a half-life extending polypeptide moiety, which may be derived from BSSL. Generally, a fusion may contain the fused portions in any order and at any position; however, a fusion of genes is typically made in-frame (in-line), such that the open reading frames (ORFs) of the fused genes are maintained, as appreciated by persons of skill in the art.
(12)
(13) As shown in
(14) The biologically active polypeptide(s) constituting the fusion partner(s) of the half-life extending polypeptide moiety may be any biologically active polypeptide, or combination of biologically active polypeptides, that may be suitable for use in treatment or prevention of any condition or disorder, where the biological function requires a certain systemic concentration of the biologically active polypeptide.
(15) Typically, the biologically active polypeptide is a biopharmaceutical, also referred to as a biologic. Examples of suitable biologically active polypeptides include peptide hormones, growth factors, cytokines, enzymes, co-factors, ligands, binders (including natural and artificial binders), and antibodies and antibody fragments. In embodiments of the invention, the biologically active polypeptide may be a receptor agonist. In other embodiments, the biologically active polypeptide may be a receptor antagonist.
(16) The biologically active polypeptide as such may be a naturally occurring polypeptide, or it may be a non-naturally occurring polypeptide. However, fused to the half-life extending polypeptide moiety, the resulting fusion protein will always be a non-naturally occurring entity. The biologically active polypeptide is not part of human BSSL such that the fusion protein would correspond to a native BSSL protein. The fusion protein comprising a naturally or non-naturally occurring polypeptide may be recombinantly produced or chemically synthesized, e.g. as described in the examples below.
(17)
(18) However, as explained above with reference to
(19) In some embodiments, the half-life extending polypeptide moiety may replace a specific sequence segment of the biologically active polypeptide. For instance, when positioned as an insert, the half-life extending polypeptide moiety may replace a part of a surface-exposed loop on the biologically active polypeptide. Alternatively, a half-life extending polypeptide may replace an entire domain, such as a N-terminal or a C-terminal domain, or an internal domain, of the biologically active polypeptide.
(20) In yet other embodiments, an in-line inserted half-life extending polypeptide moiety may be combined with either an N-terminal moiety, a C-terminal moiety, or both N-terminal and C-terminal half-life extending polypeptide moieties (
(21) Finally, the present invention is not limited to the use of a single biologically active polypeptide as fusion partner; rather, as illustrated in
(22) In the case of multiple biologically active polypeptides, these may be the same or different. For example, the fusion protein may comprise two different biologically active polypeptides, optionally separated by a linker or spacer sequence and/or a half-life extending polypeptide moiety. Alternatively, the fusion protein may comprise three different biologically active polypeptides. In embodiments of the fusion protein including multiple biologically active polypeptides, one of these may be selected from the group consisting of growth factors, cytokines, enzymes and ligands, and that the remaining biologically active polypeptide(s) may be selected from antibodies or antibody fragments. As an example, the half-life extending polypeptide moiety may be positioned as a linker between different antigen-binding regions.
(23) According to the invention, the half-life extending polypeptide moiety used for fusion with a biologically active polypeptide comprises an amino acid sequence comprising 2-80 repeating units, each unit being independently selected from the group of amino acid sequences defined by SEQ ID NO: 1: X1-X2-X3-X4-X5-X6-D-X8-X9-X10-X11 (SEQ ID NO: 1)
in which, independently, X1 is P or absent; X2 is V or absent; X3 is P or T; X4 is P or T; X5 is T or V; X6 is D, G or T; X8 is A, Q or S; X9 is E, G or K; X10 is A, E P or T; X11 is A, P or T.
(24) As used herein, a “unit” refers to an occurrence of an amino acid sequence of the general formula according to SEQ ID NO: 1 as defined above, including for instance any of the sequences according to SEQ ID NOs: 2-11. The half-life extending polypeptide comprises from 2 to 80 such units, which may be the same or different, within the definition set out above. The units of the half-life extending polypeptide may also be referred to as “repeating units” although there is some variation in the amino acid sequence between individual units, and hence “repeating units” is not to be understood exclusively as the repetition of one and the same sequence. Stated differently, the half-life extending polypeptide moiety comprises from 2 to 80 units, wherein each unit is an amino acid sequence independently selected from the group consisting of the individual sequences falling within the definition of SEQ ID NO:1.
(25) The half-life extending polypeptide moiety may comprise a contiguous sequence of at least 18 amino acids (corresponding to two units that are both 9-meric versions of SEQ ID NO:1), and typically up to 880 amino acids (corresponding to 80 units which are all 11-mer versions of SEQ ID NO:1). The repeating units may be contiguous with one another, although it is also possible that the repeating units are separated by short spacing sequences. For instance, two repeating units may be separated by up to 10 amino acid residues that do not correspond to SEQ ID NO: 1; for instance, the short spacing sequence may be a peptide linker of the formula (G.sub.4S).sub.2 (SEQ ID NO: 108). In some embodiments, a spacing sequence may be up to 5 amino acid residues. In some embodiments one or more amino acid residue(s) may be positioned between two repeating units, e.g. to impart a desired functionality such as an N-glycosylation site, or to provide a site for another type of modification, for instance employing a single Cys residue. In some embodiments, a linker, such as one or more G.sub.4S linkers, may be used as spacing sequences between adjacent repeating units. Hence, in view of this possibility, the contiguous sequence comprising up to 80 repeating units may be longer than 880 amino acids, for instance up to 900 amino acids or up to 1000 amino acids.
(26) The repeating units of the half-life extending polypeptide moiety are defined by SEQ ID NO: 1, which is based on the repeating units of human variants of the BSSL C-terminal domain, and which allows some variation of amino acid residues in positions X3, X4, X5, X6, X8, X9, X10 and X11. In contrast, the residues at positions X1, X2 and X7 are fixed, although positions X1 and X2 may be absent. In embodiments, both X1 and X2 are absent, and in such embodiments, a repeating unit consists of 9 amino acids only.
(27) A half-life extending polypeptide moiety comprising 2 to 80 units (repeating units) typically comprises several variants of the amino acid sequence motif generally defined by SEQ ID NO:1, such as at least two different variants according to SEQ ID NO:1. For instance, in embodiments of the invention where the half-life extending polypeptide moiety comprises at least 4 units, it may comprise at least one unit of each of SEQ ID NO:3, SEQ ID NO:4 and SEQ ID NO:5. In embodiments of the invention where the half-life extending polypeptide moiety comprises at least 2 units, these may be independently selected from the group consisting of SEQ ID NO:3, SEQ ID NO:4 and SEQ ID NO:5. Advantageously, the half-life extending polypeptide moiety may comprise SEQ ID NOs: 3-5 in this order, optionally preceded by SEQ ID NO: 2. A unit according to SEQ ID NO: 2 may especially be located at the N-terminal end of the half-life extending polypeptide moiety, representing the first unit of the half-life extending polypeptide moiety. While other specific variations of the repeating units (e.g. the units according to SEQ ID NOs:3-11) may appear repeatedly, SEQ ID NO: 2, if present, typically only appears once, as the first repeating unit of the half-life extending polypeptide moiety.
(28) The conformation of the half-life extending polypeptide moiety is generally unstructured. For instance, in embodiments of the invention, the half-life extending polypeptide does not contribute to the α-helix and/or β-sheet content of the fusion protein as determined by circular dichroism or FTIR (Fourier Transform Infrared Spectroscopy).
(29) In embodiments of the invention, a repeating unit defined by SEQ ID NO:1 is of human origin, and preferably all of the repeating units of the half-life extending polypeptide moiety correspond(s) to naturally occurring repeating units of a variant of the C-terminal domain of human BSSL. Such repeating units are represented by SEQ ID NOs: 2-11 (See also Table 2 in the Examples). In embodiments of the invention, all repeating units of the half-life extending polypeptide moiety are selected from the group consisting of SEQ ID NOs: 2-11, e.g. SEQ ID NOs: 3-11. That is, the half-life extending polypeptide moiety may comprise 2-80 units, each independently selected from the group consisting of SEQ ID NO: 2-11, e.g. SEQ ID NOs: 3-11. The use of a sequence of human origin may be advantageous as it is expected to contribute to a lower immunogenicity in human subjects compared to half-life extending moieties with repeating units of non-human or partly human origin, whether polypeptide based or other as used in the prior art. As described in more detail below in Example 14, no peptides derived from an exemplary half-life extending polypeptide of human origin were presented on antigen presented cells from human healthy donors. This indicates that a half-life extending polypeptide moiety consisting of repeating units selected from SEQ ID NO: 2-11 has a low immunogenic potential in humans.
(30) Furthermore, in embodiments of the invention, the half-life extending polypeptide moiety comprises, or consists of, a sequence of repeating units that corresponds to a naturally occurring human sequence of repeating units. Examples of such natural human sequences of repeating units are presented in SEQ ID NO: 12-21 and 57-66. Typically, such sequences comprise, as the first five repeating units, in this order: [SEQ ID NO: 2]-[SEQ ID NO: 3]-[SEQ ID NO: 4]-[SEQ ID NO: 5]-[SEQ ID NO: 5], or, alternatively, as the first four repeating units, in this order: [SEQ ID NO: 3]-[SEQ ID NO: 4]-[SEQ ID NO: 5]-[SEQ ID NO: 5].
(31) Thus, in embodiments of the invention, the half-life extending polypeptide moiety comprises an amino acid sequence according to any one of in SEQ ID NO: 12-21 or 57-66. In some embodiments the half-life extending polypeptide moiety consists of a multiple of any one of SEQ ID NO: 12-21 or 57-66. For instance, the half-life extending polypeptide moiety may consist of three contiguous multiples, or copies, of an amino acid sequence according to any one of SEQ ID NOs: 12-21 or 57-66; for instance SEQ ID NO: 57. SEQ ID NO: 57 comprises 17 units of an amino acid sequence according to SEQ ID NO:1, and thus a three-copy multiple of SEQ ID NO: comprises at least 51 units. However, it should be noted that the repeating units of the half-life extending polypeptide moiety can be independently selected from all units according to SEQ ID NO:1 and the invention is thus not limited to certain sequences of units being repeated. Accordingly, for instance a 51-unit half-life extending polypeptide moiety is not necessarily formed of three copies of a 17-unit sequence, but may be formed of any combination of units according to SEQ ID NO:1, and in particular of any combination of repeating units selected from SEQ ID NOs: 2-11.
(32) In embodiments, a half-life extending polypeptide moiety having at least 34 units may comprise, or consist of, an amino acid sequence selected from the group consisting of SEQ ID NOs: 100-105. For instance, a half-life extending polypeptide moiety of 34 units may consist of a sequence according to SEQ ID NO: 100 or SEQ ID NO: 101; a half-life expending polypeptide of 51 units may consist of a sequence according to SEQ ID NO: 102 or SEQ ID NO: 103; and a half-life extending polypeptide moiety of 68 units may consist of a sequence according to SEQ ID NO: 104 or SEQ ID NO: 105.
(33) It was found that each repeating unit as defined above carries one potential O-glycosylation site. That is, upon expression in a mammalian environment allowing glycosylation, each repeating unit may be glycosylated at at most one predetermined position, typically at a threonine (T, Thr) residue. For the repeating units of SEQ ID Nos: 2-11, the potential sites of O-glycosylation are indicated in Table 2 (see Example 1). There may be an upper limit to the number of glycans, which is lower than the total number of units. That is, typically, less than all of the units of the half-life extending polypeptide moiety are glycosylated. For instance, out of a sequence of 17 units (such as SEQ ID NO: 14, SEQ ID NO: 15, or SEQ ID NO: 19) typically only 10 units are glycosylated. Hence, in embodiments, a majority of the units may be glycosylated, whereas a minority of the units may be non-glycosylated. Furthermore, the degree of glycosylation (e.g. the ratio of glycosylated units to non-glycoslyated units, or the like) may be possible to adjust according to known measures, e.g. by appropriately selecting the expression system and/or controlling the cultivation or expression conditions of the producer cells.
(34) As mentioned above, the fusion protein comprising the half-life extending polypeptide moiety according to the invention benefits from an increased biological half-life compared to that of the biologically active polypeptide alone. The increased biological half-life is mainly due to the increased size of the fusion protein vis-à-vis the biologically active polypeptide alone. The size of the fusion protein according to the invention is large enough to decrease clearance from circulation by the kidneys (renal clearance).
(35) The radius of the majority of the pores of the glomerular membrane are 4.5-nm. The membrane is negatively charged and thus are proteins that are negatively charged less prone to be cleared by the kidneys. For instance, negatively charged molecules may be significantly protected from renal clearance already at a hydrodynamic radius of 2.5 nm, while neutral molecules need a size of 3.5 nm to get a similar protection of renal clearance (Haraldsson et al Physiological Reviews 88 (2) 451-487). For an uncharged globular protein, the size limit for renal clearance (below which a protein is secreted) is a molecular weight of about 60 kDa.
(36) The actual molecular weight of a protein, as determined for instance by Multi Angle Light Scattering (MALS), corresponds to the theoretical molecular weight based on the amino acid composition, and any glycans bound. In contrast, the apparent size (or apparent molecular weight) in solution of a protein can be determined by Size Exclusion Chromatography (SEC), e.g. as described in Example 4 below, and yields an apparent molecular weight, or apparent size, of a protein that corresponds to the actual molecular weight of a globular protein. For proteins and peptides that do not have a globular conformation, the actual molecular weight may differ from the apparent molecular weight, or apparent size, in solution.
(37) Typically, a non-globular protein or polypeptide may exhibit an apparent size in solution that is larger than its actual molecular weight. In the case of the present half-life extending polypeptides moieties, which typically have an unstructured, unfolded conformation, the inventors found that each repeating unit represented approximately 9 kDa, as determined by SEC (
(38) In total, the fusion protein may have an apparent size in solution, as determined by SEC, larger than the size of the biologically active polypeptide alone by a factor of at least 1.5, at least 1.8, at least 2, at least 3, at least 5, at least 10, at least 20, or at least 50, and up to 10, up to 20, up to 40, up to 60, up to 80, up to 100, up to 200, up to 250, up to 270, and even up to a factor of 300. The increase facor will, naturally, depend on the size of the biologically active polypeptide in question. However, for a biologicvally active polypeptide in the range of from 6 kDa to 60 kDa apparent size, the fusion protein may have an apparent size that is larger by a factor of at least 1.5, and up to a factor of about 250. For smaller biologically active peptides, e.g. about 3 kDa, it may still be preferable to aim for a size increase not exceeding a factor of 250, e.g. about 240.
(39) The size of the half-life extending polypeptide moiety and of the fusion protein, respectively, may also be defined by the hydrodynamic radius, also referred to as the Stokes radius, measured in nanometers (nm). Both the apparent size in solution and the hydrodynamic radius are determined by Size Exclusion Chromatography (SEC), e.g. as described in Example 4 below.
(40) In accordance with what has been said above with regard to apparent size in solution, the hydrodynamic radius of the fusion protein is typically large enough to avoid renal clearance. For comparison, human serum albumin, which has a size above the limit of renal clearance, has a hydrodynamic radius of 3.8 nm. The fusion protein may have a hydrodynamic radius that is at least 1.25 times as large, or at least 1.5 times as large, as the hydrodynamic radius of the biologically active polypeptide alone. For instance, the hydrodynamic radius of the fusion protein may represent an increase at least by a factor of 2, 3, 5, 10, 20 or 50 of the hydrodynamic radius of the biologically active polypeptide alone. The hydrodynamic radius of the fusion protein may be larger than the hydrodynamic radius of the biologically active polypeptide by a factor of up to 8, up to 10, up to 12, or up to 30 or even up to 100. It was found that each repeating unit of the half-life extending polypeptide moiety generally contributes to the increase in hydrodynamic radius by 0.11 nm.
(41) In addition to the number of repeating units in the half-life extending polypeptide moiety, also the location of the polypeptide moiety within the fusion protein may affect the size increase. For example, N-terminal or C-terminal location of a half-life extending polypeptide moiety is expected to provide a larger hydrodynamic radius compared to a half-life extending moiety located as an insert within the amino acid sequence of the biologically active polypeptide (e.g. forming a surface loop).
(42) Furthermore, the unfolded structure of the half-life extending moiety not only as such provides a large hydrodynamic radius, but it may contribute to the size increase because of the hydrophilic character of many of the amino acids of the repeating units, by binding of water molecules to the half-life extending polypeptide moiety, to further increase the hydrodynamic radius.
(43) Finally, glycosylation of some of the repeating units may further contribute to a larger size, as demonstrated in Example 4 below. It was found that a half-life extending polypeptide moiety of 17 repeating units exhibited an apparent size of a further 60-70 kDa compared to the same sequence of repeating units without glycosylation.
(44)
(45) Notably, also above the size limit for renal clearance (which is about 60 kDa for uncharged globular protein), an increase in the apparent size in solution of the fusion protein may be useful in that it still contributes to an increased biological half-life (see Example 8). However, for biologically active polypeptides which as such already have an apparent size in solution of at least 60 kDa, it may be desirable to increase the apparent size by at least a factor 2, such that the fusion protein would have an apparent size at least twice that of the biologically active polypeptide alone.
(46) For market approved therapeutic products, accurate characterization is a necessary regulatory requirement, and for a glycosylated protein the exact position of any glycans must be known. The fact that each unit of the present half-life extending polypeptide moiety carries at most one O-glycosylation site may facilitate characterization of a fusion protein expressed in mammalian systems.
(47) A suitable protease for characterization of the half-life extending polypeptides according to the invention is pepsin, which cleaves after the acidic residues: glutamic acid (Glu, E) and aspartic acid (Asp, D). However, as pepsin typically will not cleave proximal to a glycosylated residue due to steric interference of the glycan with the protease, the repeating units that carry an O-glycosylation will have different cleavage patterns compared to non-glycosylated units. Based on this knowledge and in view of the limited and relatively predictable glycosylation pattern, characterization of the present fusion proteins using established methods, such as chromatographic methods and mass spectrometry, is greatly simplified compared to half-life extended moieties that are potentially glycosylated to a massive or unknown extent, making industrial expression of the present fusion proteins in mammalian systems more practically feasible.
(48) Another potential advantage of glycosylation of the half-life extending polypeptide moiety is that glycosylation may provide a means of increasing immune tolerance towards the fusion protein. O-glycans ending with a α2,6-linked terminal sialic acid can bind to CD22 or to Siglec-10, which are two inhibitory receptors of the sialic acid binding immunoglobulin-like lectin (Siglec) family. These receptors act by damping the signal from the B-cell receptor (BCR), which may lead to development of B-cell tolerance towards the fusion protein. Glycans of human proteins possess both α2,6- and α2,3-linked terminal sialic acid. In order to increase the sialic acid content with α2,6- linked terminal sialic acid in fusion proteins expressed in cells of human origin, the fusion protein of interest may be co-expressed with α2,6-sialyltransferase. Fusion proteins produced in Chinese hamster ovary (CHO) cells only have α2,3-linkage due to the absence of α2,6-sialyltransferase expression. In order to introduce α2,6- linked terminal sialic acid in the 0-glycans of fusion proteins produced in CHO cells, the fusion protein of interest may be co-expressed with α2,6-sialyltransferase.
(49) As indicated above with reference to
(50) The fusion proteins described herein can be produced by recombinant techniques using prokaryotic or eukaryotic, such as mammalian, expression systems, using conventional methods known to persons of skill in the art. Example 2 below describes cloning and production of fusion proteins in which half-life extending polypeptide moieties are fused to biologically active polypeptides. It should be noted that the invention is by no means limited to use of those strains and cell types of Example 2; in contrast, suitable cell lines for production of fusion proteins are known to persons of skill in the art, and examples include E. coli, Pichia pastoris, Saccharomyces cerevisiae, algae, moss cells, plant cells such as carrot cells, and mammalian cells such as CHO, HEK-293, and HT1080.
(51) Regarding the design of DNA constructions encoding the half-life extending polypeptide moiety, it may be advantageous to use synthetic genes which utilize the redundancy of the genetic code by including different, or all, codon variants for each amino acid that is to be encoded. The use of more variable DNA sequences may facilitate characterization of the nucleic acid components, as characterization of highly repetivitve sequences may be problematic.
(52) The fusion protein according to the invention has an increased hydrodynamic radius and apparent size in solution compared to the size of the biologically active polypeptide alone. As a consequence at least in part of reduced renal clearance due to the size increase, the pharmacokinetic properties of the fusion protein are altered. Most notably, the biological half-life is extended, as demonstrated in Examples 8-10 and 15 below. These Examples also show that the half-life extending effect of the half-life extension polypeptide moiety is a function of the length of the moiety (the number of units, see in particular
(53) Preferably, the half-life extending polypeptide moiety extends the biological half-life of the biologically active polypeptide by a factor of at least 1.5 in at least one species, typically humans. In other words, the fusion protein preferably has a biological half-life that is at least 1.5 times that of the biologically active polypeptide alone. For example, the fusion protein may extend the biological half-life of the biologically active polypeptide by a factor of at least 1.8, at least 2, at least 3, at least 5, at least 10, at least 20, or at least 50, and up to a factor of 500 or less, such as a factor of 60. For instance, for biologically active polypeptides having a biological half-life of less than 1 hour, the biological half-life may be extended by a factor of up to 500, whereas for biologically active polypeptides having a biological a half-life of 1 hour and above, it may suffice if the biological half-life is extended by a factor of up to 60.
(54) From a pharmacokinetic perspective, it may be desirable to extend the biological half-life as much as possible. However, as the half-life extending effect has been shown to be proportional to the size of the half-life extending moiety, and very large half-life extending polypeptide moieties may be undesirable for various reasons, such as feasibility of production or impediment of the biological activity of the biologically active polypeptide, the half-life extension for a given biologically active polypeptide may have to be balanced against other requirements, and the optimum half-life extension may thus be less than the theoretical maximum half-life extension achievable by the present invention. For instance, it may be desirable to use no more more than three half-life extending polypeptide moieties of 80 units each (i.e. a total of 240 units distributed over three moieties), or no more than two half-life extending polypeptide moieties of 80 units each (i.e., a total of 160 units distributed over two moieties). An alternative conceivable upper limit to the half-life extending polypeptide moiety may be two moieties (e.g. one at the N-terminal and one at the C-terminal) of 68 units each.
(55) Furthermore, the half-life extending polypeptide moiety, may provide increased solubility to the fusion protein. In particular, the hydrophilic nature of the half-life extending polypeptide moiety, may be beneficial in that it may increase the bioavailavility of a fusion protein that is administered subcutaneously, relative to the bioavailability of the biologically active polypeptide alone. In such cases, the increased solubility of the fusion protein may promote transfer to the blood stream rather than remaining in the tissue extracellular matrix after injection. This could mean that for some biologically active polypeptides that otherwise require intravenous administration due to limited bioavailability, subcutaneous administration may be a realistic option if the biologically active polypeptides are fused to a half-life extending polypeptide moiety as described herein.
(56) Thus, the half-life extending polypeptide moiety used in the present invention may be used as a means of extending the biological-half life of a biologically active polypeptide and possibly of adapting other pharmacokinetic properties thereof.
(57) The fusion protein of the invention may be formulated as a pharmaceutical composition, for use in therapy and/or prevention of a condition, disorder or disease. The term “composition” as used herein should be understood as encompassing solid and liquid forms. A composition may preferably be a pharmaceutical composition, suitable for administration to a patient (e.g. a mammal) for example by injection or orally. The pharmaceutical composition typically includes the fusion protein according to the invention and at least one pharmaceutically acceptable carrier or substituent. The pharmaceutical composition may for instance comprise any one of a salt, a pH regulator, an oil, a preservative, an osmotically active agent, and any combination thereof.
(58) The pharmaceutical composition may be formulated for any route of administration, including intravenous, subcutaneous, nasal, oral, and topical administration. For example, the composition may be formulated for intravenous or subcutaneous administration.
(59) The condition, disorder or disease to be treated is not limited by the half-life extending polypeptide; rather, suitability of the fusion protein for treatment of a particular condition, disorder or disease may be determined solely by the biologically active polypeptide, which may be an existing biopharmaceutical. Examples of suitable biologically active polypeptides that may benefit from fusion with the half-life extending polypeptide moiety described herein include growth factors, cytokines, enzymes, ligands, binders, and antibody fragments.
(60) The fusion protein of the invention may be used in a method of treatment of a condition, disorder or disease, comprising the step of administering to a patient suffering from said condition, disorder or disease a fusion protein comprising a biologically active polypeptide useful for treatment of said condition, disorder or disease, fused to a half-life extending polypeptide moiety as described herein. The patient is typically a mammal, such as a human. In this method, administration may occur less frequently compared to a treatment regimen involving administration of the biologically active polypeptide alone. For instance, Kineret®, containing the biologically active polypeptide anakinra (Met-huIL-1Ra) is typically administered daily via subcutaneous injection. However, a fusion protein of IL-1Ra and a half-life extending polypeptide moiety as described herein may increase the biological half life by at least a factor 2, such that the fusion protein may be administered every other day, or by a factor of at least 3, or at least 7, such that it could be administered twice or even once a week. For some biologically active polypeptides, such as growth hormone, it may be desirable to even further extend the time period between each dose; for instance, dosing once per month is envisaged.
(61) The invention will be further described in the following examples.
EXAMPLES
Example 1: Identification of Repeating Units of Human Origin
(62) A blast search was performed with the catalytic domain of Bile salt-stimulated lipase (BSSL) versus the non-redundant protein sequence database at the National Institute of Health (NIH), USA and identified 10 reported protein sequences for the protein of human origin that contained the whole or part of the C-terminal repetitive unstructured domain.
(63) Material and Methods
(64) Blast at NIH was used to search for proteins of human origin that match the catalytic domain of Bile salt stimulated lipase with UniProt ID P19835 (Accession number CEL_HUMAN).
(65) Results
(66) The BLAST search resulted in finding 10 entries that contained both a significant portion of the catalytic domain and the C-terminal repetitive unstructured domain. The number of the repeating units in the domains differed and some variability among the sequence of the repeating units was noted, see Table 1 for the different hits. Each repeating domain is initiated by a truncated sequence of 9 residues, while the most prevalent repeating units are 11 residues long. In the table below, the repeating units are separated by a “˜” sign for clarity. The final sequence stretch of the unstructured domain shares no sequence similarity with the repeating units and are underlined in Table 1. In the enclosed sequence listing, the repetitive portions (i.e., excluding the underlined hydrophobic motifs) are represented by SEQ ID NOs: 12-21.
(67) TABLE-US-00001 TABLE 1 Variants of human BSSL-CTD Repetitive portion Description represented by Sequence P19835.3 Bile salt-activated lipase SEQ ID NO: 12 PTVTDQEAT~PVPPTGDSEAT~PVPPTGDSETA~PVPPTGDSGAP~ PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGAP~ PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGPP~ PVPPTGDSGAP~PVPPTGDSGAP~PVTPTGDSETA~PVPPTGDSGAP~ PVPPTGDSEAA~PVPPTDDSKEA~QMPAVIRF NP_001798.2 bile salt-activated SEQ ID NO: 13 PTVTDQEAT~PVPPTGDSEAT~PVPPTGDSETA~PVPPTGDSGAP~ lipse precursor [Homo sapiens] PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGAP~ PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGPP~ PVPPTGDSGAP~PVPPTGDSGAP~PVTPTGDSETA~PVPPTGDSGAP~ PVPPTGDSEAA~PVPPTDDSKEA~QMPAVIRF CAA38325.1 unnamed protein SEQ ID NO: 14 PTVTDQEAT~PVPPTGDSEAT~PVPPTGDSETA~PVPPTGDSGAP~ product [Homo sapiens] PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGAP~ >AAA51973.1 carboxyl ester lipase PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGPP~PVPPTGDSGAP~ [Homo sapiens] >AAC26514.1 PVPPTGDSGAP~PVTPTGDSETA~PVPPTGDSGAP~PVPPTGDSEAA~ carboxyl ester lipase [Homo PVPPTDDSKEA~QMPAVIRF sapiens] >EAW88033.1 carboxyl ester lipase (bile salt-stimulated lipase), isoform CRA_d [Homo sapiens] >prf||1702227A bile salt stimulated milk lipase AAA63511.1 bile salt-activated SEQ ID NO: 15 PTVTDQEAT~PVPPTGDSEAT~PVPPTGDSETA~PVPPTGDSGAP~ lipase [Homo sapiens] PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGAP~ >prf||1717328A carboxy ester PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDAGPP~PVPPTGDSGAP~ lipase PVPPTGDSGAP~PVTPTGDSETA~PVPPTGDSGAP~PVPPTGDSEAA~ PVPPTDDSKEA~QMPAVIRF AAA52014.1 cholesterol esterase SEQ ID NO: 16 PTVTDQEAT~PVPPTGDSEAT~PVPPTGDSETA~PVPPTGDSGAP~ [Homo sapiens] PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGAP~ PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDAGPP~PVPPTGDSGAP~ PVPPTGDSGAP~PVTPTGDSETA~PVPPTGDSGAP~ CAPRVTLRLPLCPPQMTPRKLRCLQSIGFSVP AAC71012.1 bile salt-dependent SEQ ID NO: 17 PTVTDQEAT~PVPPTGDSEAT~PVPPTGDSETA~PVPPTGDSGAP~ lipse oncofetal isoform, partial PVPPTGDSGAP~PVPPTGDSEAA~PVPPTGDSKEA~QMPAVIRF [Homo sapiens] AAH42510.1 CEL protein [Homo SEQ ID NO: 18 PTVTDQEAT~PVPPTGDSEAT~PVPPTGDSETA~PVPPTGDSGAP~ sapiens] PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGAP~ PVPPTGDAGPP~PVPPTGDSGAP~PVPPTGDSGAP~PVTPTGDSETA~ PVPPTGDSGAP~PVPPTGDSEAA~PVPPTDDSKEA~QMPAVIRF AAB35488.2 bile salt-dependent SEQ ID NO: 19 PTVTDQEAT~PVPPTGDSEAT~PVPPTGDSETA~PVPPTGDSGAP~ lipse [Homo sapiens] PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGAP~ PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDAGPP~PVPPTGDSGPP~ PVPPTGDSGAP~PVTPTGDSETA~PVPPTGDSGAP~PVPPTGDSEAA~ PVPPTDDSKEA~QMPAVIRF EAW88031.1 carboxyl ester lipase SEQ ID NO: 20 PTVTDQEAT~PVPPTGDSEAT~PVPPTGDSETA~PVPPTGDSGAP~ (bile salt-stimulated lipase), isoform PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGAP~ CRA_b, partial [Homo sapiens] PVPPTGDSGAP~PVPPTGDSGAP~PVPPTDDSKEA~QMPAVIRF BAG61791.1 unnamed protein SEQ ID NO: 21 PTVTDQEAT~PVPPTGDSEAT~PVPPTGDSETA~PVPPTGDSGAP~ product [Homo sapiens] PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGAP~PVPPTGDSGAP~ PRAAHG
(68) Table 2 below lists the unique sequences of repeating units of human origin, with reference to the sequence identity number in the enclosed sequence listing. Absent residues of the first sequence are marked by a dash. Potential sites of O-glycosylation are underlined.
(69) TABLE-US-00002 TABLE 2 Units corresponding to repeating units found in human BSSL-CTD. Potential glycosylation site is underlined. SEQ ID NO Sequence SEQ ID NO: 2 --PTVTDQEAT SEQ ID NO: 3 PVPPTGDSEAT SEQ ID NO: 4 PVPPTGDSETA SEQ ID NO: 5 PVPPTGDSGAP SEQ ID NO: 6 PVPPTGDAGPP SEQ ID NO: 7 PVTPTGDSETA SEQ ID NO: 8 PVPPTGDSEAA SEQ ID NO: 9 PVPPTDDSKEA SEQ ID NO: 10 PVPPTGDSGPP SEQ ID NO: 11 PVPPTGDSKEA
(70) Hence, there exists a variety of lengths of the C-terminal domain in the human population. Furthermore the order of the repeating units can vary in the human population. This could imply that variations in the order of the repeating units and the length of the entire domain motifs are allowed. Each unit carries one site that may be 0-glycosylated.
(71) The most prevalent human form is made up of the combination of the following sequence of repeating units:
(72) [SEQ ID NO: 2]-[SEQ ID NO: 3]-[SEQ ID NO: 4]-[SEQ ID NO: 5]-[SEQ ID NO: 5]-[SEQ ID NO: 5]-[SEQ ID NO: 5]-[SEQ ID NO: 5]-[SEQ ID NO: 5]-[SEQ ID NO: 5]-[SEQ ID NO: 5]-[SEQ ID NO: 6]-[SEQ ID NO: 5]-[SEQ ID NO: 5]-[SEQ ID NO: 7]-[SEQ ID NO: 5]-[SEQ ID NO: 8]-[SEQ ID NO: 9]
Expressed differently:
[SEQ ID NO: 2]-[SEQ ID NO: 3]-[SEQ ID NO: 4]-[SEQ ID NO: 5]x8-[SEQ ID NO: 6]-[SEQ ID NO: 5]x2-[SEQ ID NO: 7]-[SEQ ID NO: 5]-[SEQ ID NO: 8]-[SEQ ID NO: 9]
Example 2: Cloning and Production of Fusion Proteins
(73) This Example describes the general strategies for cloning and production of fusion proteins in different formats, which were used in the Examples below.
(74) Materials and Methods
(75) DNA constructions: DNA sequences (see Table 3 below) encoding a set of fusion proteins including half-life extending polypeptides were codon optimized for expression in E. coli or for expression in human (Expi293) cells and synthesized by the Invitrogen GeneArt Gene Synthesis service at Thermo Fisher Scientific. The genes were cloned in expression vectors for subsequent expression in E. coli or in Expi293 cells.
(76) TABLE-US-00003 TABLE 3 Number of units of Number of the half-life extending biologically active Nucleotide Name Description polypeptide moiety polypeptides(s) sequence PSI0540 IL1RA-G4SG4SG4S-[half-life extending polypeptide moiety] 17 1 SEQ ID NO: 22 PSI0541 IL1RA-G4SG4SG4S-[half-life extending polypeptide moiety]- 17 2 SEQ ID NO: 23 GS-IL1RA PSI0542 IL1RA-G4SG4SG4S-[half-life extending polypeptide moiety]-GS 34 1 SEQ ID NO: 24 PSI0543 IL1RA-G4SG4SG4S-[half-life extending polypeptide moiety]-GS 34 1 SEQ ID NO: 25 PSI0544 M-IL1RA-G4SG4S-[half-life extending polypeptide moiety]-GS 34 1 SEQ ID NO: 26 PSI0545 M-IL1RA-G4SG4S-[half-life extending polypeptide moiety]-GS 34 1 SEQ ID NO: 27 PSI0546 M-IL1RA-G4SG4S-[half-life extending polypeptide moiety]-GS 51 1 SEQ ID NO: 28 PSI0547 M-IL1RA-G4SG4S-[half-life extending polypeptide moiety]-GS 51 1 SEQ ID NO: 29 PSI0548 M-IL1RA-G4SG4S-[half-life extending polypeptide moiety]-GS 68 1 SEQ ID NO: 30 PSI0549 M-IL1RA-G4SG4S-[half-life extending polypeptide moiety]-GS 68 1 SEQ ID NO: 31 PSI0550 M-IL1RA-G4SG4S-[half-life extending polypeptide moiety]- 34 2 SEQ ID NO: 32 GSG4SG4S-IL1RA PSI0551 M-IL1RA-G4SG4S-[half-life extending polypeptide moiety]- 34 2 SEQ ID NO: 33 GSG4SG4S-IL1RA PSI0493 Z06178(bb1)-GS-[half-life extending polypeptide moiety] 17 1 SEQ ID NO: 34
(77) Cultivation and purification: E. coli cells were transformed with expression vectors containing the gene fragments encoding the recombinant fusion proteins and then cultivated in bioreactors using fed-batch techniques or in shake flasks, followed by protein expression and harvest of cells by centrifugation. Cell pellets were stored at −20° C. or directly subjected to osmotic shock, released proteins were clarified by centrifugation and stored at −20° C. Expression of recombinant fusion proteins was also performed using the Expi293 expression system (Thermo Fisher Scientific), essentially according to the manufacturer's protocol. Supernatants were harvested by centrifugation 6 days after transfection of expression vectors and stored at −70° C. Table 4 lists the encoded protein sequences.
(78) Frozen E. coli cell pellets were resuspended and then disrupted by sonication and the cell debris subsequently removed by centrifugation followed by filtration (0.22 μm). Osmotic shock samples and supernatants from the Expi293 cultures were thawed and filtered (0.22 μm) before purification. Each supernatant, containing the recombinant fusion proteins was purified using conventional chromatography methods, such as affinity chromatography, ion exchange chromatography, hydrophobic interaction chromatography and size exclusion chromatography. Recombinant fusion proteins for use in animal studies were also subjected to an endotoxin removal purification using Detoxi-Gel Endotoxin Removing Columns (Pierce, cat. no. 20344). Purified fusion proteins were buffer exchanged to PBS and, unless otherwise stated, PBS was also the formulation buffer used in subsequent experiments. The purity of the fusion proteins was analyzed by SDS-PAGE stained with Coomassie Blue and the molecular weight of each protein was analyzed using mass spectrometry (HPLC/MS or MALDI-TOF/MS).
(79) Results
(80) All of the fusion proteins were expressed in E. coli or Expi293 cells as soluble proteins.
(81) Purification resulted in protein preparations with high purity, which was analyzed by SDS-PAGE stained with Coomassie Blue. The correct identity and molecular weight of each fusion protein were confirmed by mass spectrometry analysis.
(82) TABLE-US-00004 TABLE 4 Protein name, expression system and SEQ ID of proteins produced Number of PSI number Description Units Protein sequence PSI0162 Met-huIL-1Ra (Anakinra) — SEQ ID NO: 35 PSI0493 Z06175(bb1)-GS-[half-life extending polypeptide moiety] 17 SEQ ID NO: 37 PSI0540 IL1RA-G4SG4SG4S-[half-life extending polypeptide moiety] 17 SEQ ID NO: 38 PSI0541 IL1RA-G4SG4SG4S-[half-life extending polypeptide moiety]- 17 SEQ ID NO: 39 GS-IL1RA PSI0542 IL1RA-G4SG4SG4S-[half-life extending polypeptide moiety]-GS 34 SEQ ID NO: 40 PSI0543 IL1RA-G4SG4SG4S-[half-life extending polypeptide moiety]-GS 34 SEQ ID NO: 41 PSI0544 M-IL1RA-G4SG4S-[half-life extending polypeptide moiety]-GS 34 SEQ ID NO: 42 PSI0545 M-IL1RA-G4SG4S-[half-life extending polypeptide moiety]-GS 34 SEQ ID NO: 43 PSI0546 M-IL1RA-G4SG4S-[half-life extending polypeptide moiety]-GS 51 SEQ ID NO: 44 PSI0547 IL1RA-G4SG4S-[half-life extending polypeptide moiety]-GS 51 SEQ ID NO: 45 PSI0548 M-IL1RA-G4SG4S-[half-life extending polypeptide moiety]-GS 68 SEQ ID NO: 46 PSI0549 M-IL1RA-G4SG4S-[half-life extending polypeptide moiety]-GS 68 SEQ ID NO: 47 PSI0550 M-IL1RA-G4SG4S-[half-life extending polypeptide moiety]- 34 SEQ ID NO: 48 GSG4SG4S-IL1RA PSI0551 M-IL1RA-G4SG4S-[half-life extending polypeptide moiety]- 34 SEQ ID NO: 49 GSG4SG4S-IL1RA PEG(L30kDa)-Met-huIL-1Ra — PEG-L30K-[SEQ ID NO: 35]
Conclusions
(83) Fusion proteins containing half-life extending polypeptides of various lengths can be produced by constructing synthetic genes followed by expression in either E. coli or mammalian systems and purification to high purity using conventional techniques.
Example 3: Chemical Synthesis of Fusion Proteins
(84) This Example describes the general strategies for production of polypeptides in different formats by chemical synthesis, which were used in the further Examples below.
(85) Materials and Methods
(86) Chemically synthesized versions of GLP-1(7-37) (Bachem AG, catalogue number H5102), GLP-2(1-33) (Bachem AG, catalogue number H-7742), GLP-1(7-37)-half-life extending polypeptide (2 units of 11 residues each), GLP-2(1-33)-half-life extending polypeptide (one unit), GLP-2(1-33)-half-life extending polypeptide (two units) were ordered from BACHEM AG. The lyophilized proteins were dissolved in a buffer containing 25 mM NaP and 125 mM NaCl at pH 7 with a target concentration of 10 mg/mL. The C5 binding compounds PSI0400 and its PEGylated version PSI0489 were also ordered from BACHEM AG, PSI0489 was dissolved in the aforementioned buffer at a concentration of 35 mg/ml and PSI0400 was dissolved at a concentration of 29 mg/ml. The details of the proteins are summarized in Table 5.
(87) TABLE-US-00005 TABLE 5 Name and sequence of chemically synthesized fusion proteins PSI number Description Sequence PSI0400 Z06175(N52S, D53E) SEQ ID NO: 50 PSI0489 Z06175-Cys-PEG(L30kDa) [SEQ ID NO: 51]- PEG-L30K PSI0611 GLP-2 BSSL CTD 22 aa SEQ ID NO: 52 PSI0612 GLP-2 BSSL CTD 11 aa SEQ ID NO: 53 PSI0614 GLP-1(7-37) BSSL CTD 22 aa SEQ ID NO: 54 PSI0632 GLP-1(7-37) SEQ ID NO: 55 PSI0633 GLP-2 (1-33) SEQ ID NO: 56
(88) The integrity and the identity of the chemically synthesized proteins was confirmed using mass spectrometry (HPLC/MS or MALDI-TOF/MS).
(89) Results
(90) The chemically synthesized proteins containing a half-life extending polypeptide could all be dissolved at the desired concentration, while GLP-1 displayed some precipitation at 10 mg/mL and GLP-2 could only be dissolved at half of the concentration, 5 mg/mL. This showed the hydrophilic nature of the half-life extending polypeptide repeating units and the utility of increasing solubility of a protein by fusing them to these sequences. PSI0400 and PSI0489 could both readily be dissolved to concentrations above 20 mg/ml. The correct identity and molecular weight of each variant were confirmed by mass spectrometry analysis.
(91) Conclusions
(92) Fusion of peptides and half-life extending polypeptides can be produced by chemical synthesis. The fusion proteins containing a half-life extension polypeptide display an increased solubility evident by allowing to create solutions with higher concentration.
Example 4: Biophysical Characterization of Fusion Proteins
(93) This Example describes the characterization of fusion proteins containing half-life extending polypeptides, using unfused proteins or peptides and PEGylated proteins as references, with respect to biophysical characteristics such as apparent size and molecular weight in solution and determination of hydrodynamic radius in solution by size exclusion chromatography (SEC) and column calibration and Multi Angle Light Scattering (MALS).
(94) Material and Methods
(95) The size of the fusion proteins, unfused proteins and PEGylated proteins in solution, were assessed by analytical gel filtration on an ÄKTA Micro (GE Healthcare Life Sciences) using a calibrated column Superdex 200 Increase 3.2/300 (GE Healthcare Life Sciences). The column was calibrated with Gel Filtration Calibration Kit LMW (code no. 28-4038-41, GE Healthcare Life Sciences) and Calibration Kit HMW (code no. 28-4038-42, GE Healthcare Life Sciences), containing 8 globular proteins in the size range of 6 to 669 kDa and Blue Dextran 2000, using a running buffer of 25 mM NaP and 125 mM NaCl pH 7.0 with a flow rate of 75 μl/min at a temperature of 25° C. The corresponding size and hydrodynamic radius in solution can be calculated from the elution volume of a protein on a calibrated column by the methods described in appendix 10 of Handbook of Size Exclusion Chromatography Principles and Methods (order no 18-1022-18, GE Healthcare Life Sciences).
(96) The proteins of interest were analyzed under the same conditions as during the calibration. The molecular weight of the proteins was determined by the MALS-RI system: Static light scattering detector DAWN HELEOS 8+ and Differential refractometer Optilab T-rEX, and the Astra 6 software (Wyatt Technology Europe, Germany) connected to an Agilent 1100 HPLC (Agilent Technologies) using an AdvanceBio SEC 300 A 2.7 um 7.8×300 mm column (Agilent Part no: PL1180-5301, Agilent Technologies). The column temperature was 30 C and the running buffer was PBS, pH 7.0 with a flow rate of 0.7 mL/min.
(97) Results
(98) Tables 6, 7 and 8 present the results for IL-1Ra fusions, Affibody® molecule fusions, and the GLP-1 and GLP-2 peptides, respectively.
(99) TABLE-US-00006 TABLE 6 IL-1Ra based molecules Theorectical MW MW by Stokes MW MALS elution volume radius Size No. of Sequence Name (kDa) (kDa) (kDa) (nm) Expression increase units SEQ ID NO: 44 PSI0546 68.3 76.6 533 7.6 E. coli 36.8 51 SEQ ID NO: 45 PSI0547 69.2 72.7 587 7.8 E. coli 40.5 51 SEQ ID NO: 43 PSI0545 52.1 47.6 299 6.6 E. coli 20.6 34 SEQ ID NO: 40 PSI0542 51.9 66.3 352 6.9 Expi293 24.3 34 SEQ ID NO: 38 PSI0540 35.3 43.2 132 5.3 Expi293 9.1 17 (batch BB1595) SEQ ID NO: 38 PSI0540 35.3 50.0 204 6.0 Expi293 14.1 17 (batch BB1596) SEQ ID NO: 49 PSI0551 69.9 67.0 334 6.8 E. coli 11.5 34 SEQ ID NO: 39 PSI0541 52.4 53.9 156 5.6 Expi293 5.4 17 SEQ ID NO: 35 Met-huIL-1Ra 17.3 17.6 14.5 1.6 E. coli — 0 PEGL10K-Met- 27.6 29.8 112 4.3 E. coli 7.7 PEG 10K huIL-1Ra PEGL20K-Met- 38.7 39.0 253 5.6 E. coli 17.4 PEG 20K huIL-1Ra PEGL30K-Met- 49.8 48.8 392 6.4 E. coli 27.0 PEG 30K huIL-1Ra
(100) TABLE-US-00007 TABLE 7 Affibody ® based molecules Theorectical MW MW by Stokes MW MALS elution volume radius Size No. of Sequence Construct (kDa) (kDa) (kDa) (nm) Expression increase units SEQ ID NO: 37 PSI0493 23.9 25 146 4.7 E. coli 10.1 17 [SEQ ID NO: 51]- PSI0489- 36 39.6 346 6.1 synthetic 23.9 — PEGL30K PEGL30K SEQ ID NO: 50 PSI0400 6.6 7.2 14.5 1.6 synthetic — 0
(101) TABLE-US-00008 TABLE 8 Synthetic GLP-1/GLP-2 peptides Theorectical MW MW by Stokes MW MALS elution volume radius Size No. of Sequence Description (kDa) (kDa) (kDa) (nm) increase units SEQ ID NO: 55 GLP-1(7-37) 3.4 6.4 6.3 0.3 — 0 SEQ ID NO: 54 GLP-1(7-37)-22 BSSL CTD 5.5 7.5 16 1.7 2.5 2 SEQ ID NO: 56 GLP-2(1-33) 3.8 8.8 9.8 1.0 — 0 SEQ ID NO: 53 GLP-2(1-33)-11 BSSL CTD 4.8 8.7 17.7 1.8 1.8 1 SEQ ID NO: 52 GLP-2(1-33)-22 BSSL CTD 5.9 17.4 20.6 2.1 2.1 2
(102) Additionally,
(103)
(104) Conclusions
(105) A correlation of length of the half-life extension polypeptide fusion and size in solution was observed: each unit of 11 residues, with an actual molecular weight on average of 1 kDa, corresponded to the size of a globular protein of MW 9 kDa in solution, due to its unfolded nature.
(106) On a sidenote, the hydrodynamic radius or Stokes radius of albumin is 3.8 nm, which could serve as a marker of minimal size required to avoid renal clearance, in view of the fact that albumin as such is above the size limit of renal clearance.
(107) The glycosylation that the fusion protein receives in mammalian system further increases the size of the fusion protein, as evident by the increased size of the glycosylated PSI0540:BB1596 compared to the unglycosylated PSI0540:BB1595 which has the same amino acid sequence.
Example 5: In Vitro Pharmacological Activity Analysis Using a Cell-Based Assay
(108) Normal human dermal fibroblasts (NHDF) respond to IL-1β by production of IL-6, a feature that can be exploited for blocking studies in vitro. In this experiment, the ability of recombinant fusion proteins of IL-1Ra and half-life extending polypeptides to block IL-1β was tested in an NHDF assay.
(109) Materials and Methods
(110) Cells were seeded three days prior to treatment with proteins. Proteins (recombinant IL-1Ra fusion proteins according to embodiments of the invention, PEGylated Met-huIL-1Ra or Anakinra/Met-huIL-1Ra) were diluted to a starting concentration of 100 nM and subsequently serially diluted 1:4 nine times resulting in a concentration range of 100 nM to 0.38 pM in serum-free growth medium in the presence of 9 uM recombinant human serum albumin (rHSA). The recombinant IL-1Ra fusion proteins with half-life extending polypeptides and Met-huIL-1Ra were tested in presence of a challenge dose of 3.4 pM IL-1β and the cells were incubated for 22 hours with proteins at 37° C., followed by harvesting of medium. Harvested medium was diluted 41× before IL-6 content was analyzed using a human IL-6 ELISA kit (R&D Systems) according to manufacturer's recommendations. Data was analyzed using XLfit and IC50 values were calculated from concentration-response curves.
(111) Results
(112) The IL-1β induced IL-6 release from NHDF cells was reduced in a concentration-dependent manner by IL-1Ra fusion proteins, PEGylated Met-huIL-1Ra as well as by Anakinra/Met-huIL-1Ra. The data from the experiments is presented in Table 9.
(113) TABLE-US-00009 TABLE 9 In vitro inhibition of IL-1 signalling Number NHDF IC50 Sequence Name Description of units (pM) SEQ ID NO: 45 PSI0547 IL1RA-G4SG4S-[half-life extending 51 2500 polypeptide moiety]-GS SEQ ID NO: 43 PSI0545 M-IL1RA-G4SG4S-[half-life extending 34 914 polypeptide moiety]-GS SEQ ID NO: 40 PSI0542 IL1RA-G4SG4SG4S-[half-life extending 34 6490 polypeptide moiety]-GS SEQ ID NO: 38 PSI0540 IL1RA-G4SG4SG4S-[half-life extending 17 2520 polypeptide moiety] SEQ ID NO: 39 PSI0541 IL1RA-G4SG4SG4S-[half-life extending 17 400 polypeptide moiety]-GS-IL1RA SEQ ID NO: 49 PSI0551 M-IL1RA-G4SG4S-[half-life extending 34 146 polypeptide moiety]-GSG4SG4S-IL1RA SEQ ID NO: 35 Met-huIL-1Ra 0 70 PEG(L30kDa)- PEGylated — 900 [SEQ ID NO: 35] Met-huIL-1Ra
(114) The result showed that the cytokine secretion response induced by IL-1β was reduced in a concentration-dependent manner by the antagonistic effect of the recombinant IL-1Ra fusions with half-life extending polypeptides, leading to a reduced IL-6 release from the NHDF cells.
(115) Conclusions
(116) The fusion to the half-life extending polypeptide decreased the activity of the IL-1Ra in a size-dependent matter, but did not abolish the biological function.
Example 6: Inhibition of Hemolytic Activity in C5 Deficient Serum
(117) For studies of classical complement pathway function and inhibition thereof by PSI0493 (SEQ ID NO: 37), PSI0489 ([SEQ ID NO: 51]-PEG30K), and PSI0400 (SEQ ID NO: 50), sheep erythrocytes were prepared from fresh sheep whole blood in Alsever's solution (Swedish National Veterinary Institute) and thereafter treated with rabbit anti-sheep erythrocyte antiserum (Sigma) to become antibody sensitized sheep erythrocyte (EA). The whole process was conducted under aseptic conditions. All other reagents were from commercial sources.
(118) The in vitro assay was run in 96-well U-form microtiter plate by consecutive additions of a test protein, a complement serum and EA suspension. The final concentrations of all reagents, in a total reaction volume of 50 μL per well and at pH 7.3-7.4, were: 0.15 mM CaCl.sub.2); 0.5 mM MgCl.sub.2; 3 mM NaN 3; 138 mM NaCl; 0.1% gelatin; 1.8 mM sodium barbital; 3.1 mM barbituric acid; 5 million EA; complement protein C5 serum at suitable dilution, and C5 binding polypeptides at desired concentrations.
(119) The investigated proteins were pre-incubated with the above described complement serum for 20 min on ice prior to starting the reaction by the addition of EA suspension. The hemolytic reaction was allowed to proceed at 37° C. during agitation for 45 min and was then ended by addition of 100 μL ice-cold saline containing 0.02% TWEEN20® (Polyethylene glycol sorbitan monolaurate). The cells were centrifuged to the bottom and the upper portion, corresponding to 100 μL supernatant, was transferred to a transparent microplate having half-area and flat-bottom wells. The reaction results were analyzed as optical density using a microtiter plate reader at a wavelength of 415 nm.
(120) The inhibitory potencies (IC 50-values) of tested C5 binding polypeptides were defined by applying the same assay in the presence of a controlled concentration of human C5 added to C5 depleted serum. For highly potent inhibitors (low nanomolar to sub-nanomolar), a final C5 concentration of the reaction mixture was controlled at 0.1 nM. The results are presented in Table 10.
(121) TABLE-US-00010 TABLE 10 The inhibitory potencies of tested C5 binding polypeptides Sequence Name No. of units IC 50 (nM) SEQ ID NO: 37 PSI0493 17 0.5 SEQ ID NO: 50 PSI0400 0 2.9 [SEQ ID NO: 51]-PEG30K PSI0489:PEG30K -(PEG30K) 1.5
Conclusions
(122) The fusion to the half-life extension polypeptide did not affect inhibition of hemolytic activity in C5 deficient serum.
Example 7: Binding to Human C5
(123) Material and Methods
(124) The binding affinity of the C5 binding polypeptides for human C5 was analyzed using a Biacore T200 instrument (GE Healthcare). Human C5 (A403, Quidel Corporation) was coupled to a CM5 sensor chip (900 RU) using amine coupling chemistry according to the manufacturer's protocol. The coupling was performed by injecting hC5 at a concentration of 7.5 pg/mL in 10 mM Na-acetate buffer pH=S (GE Healthcare). The reference cell was treated with the same reagents but without injecting human C5. Binding of the C5 binding polypeptides to immobilized hC5 was studied with the single cycle kinetics method, in which five concentrations of sample, typically 25, 12.5, 6.25, 3.12 and 1.56 nM in HBS-EP buffer (10 mM HEPES pH 7.4, 150 mM NaCl, 3 mM EDTA, 0.005% Surfactant P20, GE Healthcare) were injected one after the other at a flow rate of 30 μL/min at 25° C. in the same cycle without regeneration between injections. Data from the reference cell were subtracted to compensate for bulk refractive index changes. In most cases, an injection of HBS-EP was also included as control so that the sensorgrams were double blanked. The surfaces were regenerated in HBS-EP buffer. Kinetic constants were calculated from the sensorgrams using the Langmuir 1:1 analyte model of the Biacore T200 Evaluation Software version 1.0.
(125) Results
(126) The resulting KD values are tabulated in Table 11.
(127) TABLE-US-00011 TABLE 11 Binding to immobilized human complement C5 in Biacore No. of Biacore KD Sequence Name units (nM) SEQ ID NO: 37 PSI0493 17 2.4 SEQ ID NO: 50 PSI0400 0 0.5 [SEQ ID NO: 51]-PEG30K PSI0489:PEG30K (PEG30K) 1.4
Conclusions
(128) Although no difference in hemolytic activity was observed in example 6 binding to C5 was marginally influenced by the fusion protein as measured by Biacore equipment in this example. The PEGylated molecule displays a matching binding affinity to hemolytic inhibition.
Example 8: In Vivo Pharmacokinetics
(129) In this Example, the pharmacokinetics of IL-1Ra fusion proteins PSI0540 (SEQ ID NO:38), PSI0541 (SEQ ID NO: 39), PSI0542 (SEQ ID NO: 40), PSI0545 (SEQ ID NO: 43), PSI0547 (SEQ ID NO: 45) and PSI0551 (SEQ ID NO: 49) were evaluated in a single dose study in male rats.
(130) Material and Methods
(131) Test items: PSI0540, PSI0541, PSI0542, PSI0545, PSI0547 and PSI0551. All six test items were constituted as a solution in 25 mM sodium phosphate and 250 mM sodium chloride, pH 7.0.
(132) In-life phase: The pharmacokinetic properties were investigated in male Sprague-Dawley rats following intravenous and subcutaneous single-dose administration. The dose levels tested and number of animals per dose group are presented in Table 12.
(133) TABLE-US-00012 TABLE 12 Doses levels of IL-1Ra fusion proteins tested in a single-dose PK study in male Sprague-Dawley rats. For details of the fusion proteins, see Tables 4, 6 and 9. Route of No. of Dose Dose Sequence Name administration animals (mg/kg) (nmol/kg) SEQ ID NO: PSI0551 s.c. 2 10 149 49 i.v. 2 5 73 SEQ ID NO: PSI0545 s.c. 3 8 160 43 s.c. 3 24 483 i.v. 3 4 77 i.v. 3 12 230 SEQ ID NO: PSI0547 s.c. 3 10 149 45 s.c. 3 30 448 i.v. 3 5 73 i.v. 3 15 219 SEQ ID NO: PSI0541 s.c. 1 8 166 39 i.v. 1 4 75 SEQ ID NO: PSI0542 s.c. 3 8 156 40 i.v. 3 4 78 SEQ ID NO: PSI0540 s.c. 2 6 182 38 i.v. 2 3 82
(134) The subcutaneous doses were injected in the neck region at a dose volume of 5 ml/kg. The intravenous doses were injected in the lateral tail vein at a dose volume of 2.5 ml/kg. Blood samples were collected from the sublingual plexus using standard vials without serum clotting activator. Following s.c. administration blood samples for serum preparation were collected pre-dose and at 20 min and 1, 4, 8, 24, 30, 48, 72 and 96 hours post dosing, except for PSI0545 at dose level 24 mg/kg and for PSI0547 at dose level 30 mg/kg where samples were collected pre-dose and at 20 min and 1, 4, 8, 24, 48, 72, 96 and 120 hours post dosing. Following intravenous administration, blood samples for serum preparation were collected pre-dose and at 5 and 20 min and 1, 4, 8, 24, 30, 48 and 72 hours post dosing, except for PSI0545 at dose level 12 mg/kg and for PSI0547 at dose level 15 mg/kg where samples were collected pre-dose and at 5 and 20 min and 1, 4, 8, 24, 48, 72 and 96 hours post dosing.
(135) Quantitative ELISA: Determination of modified anakinra levels in rat serum samples was performed by enzyme-linked immunosorbent assay (ELISA). A polyclonal Goat Anti-Human IL-1RA antibody (AF280, R&D Systems), was coated onto a microplate (96 well High binding Half area plate, Corning 3690) 0.25 μg/ml in PBS (Medicago), 50 μl per well, for 2 hours RT. Unbound polyclonal antibodies were washed away with 2×150 μl PBS-Tween (Medicago) using a microplate washer (MultiWash+, Molecular Devices) and 150 μl of 1% Casein Blocker in PBS (Thermo Scientific) was added to the wells for 2 hours RT.
(136) Serum samples were analyzed from a 100-fold dilution and up against standards diluted in PBS supplemented with 0.5% casein and 1% rat normal serum. For each construct standards were prepared by a 2-fold dilution series between 40 ng/ml and 20 pg/ml. The serum samples were initially diluted 100-fold in PBS supplemented with 0.5% casein, followed by serial dilutions in PBS supplemented with 0.5% casein and 1% rat normal serum (Adlego).
(137) Serial dilutions of samples in steps of 1/5 were prepared in a polypropylene plate (Corning 3365) using a liquid handling robot (Biomek 4000, Beckman Coulter).
(138) Unbound blocking protein was removed by washing with 2×150 μl PBS-Tween and 25 μl of samples and standards were pipetted to the wells and incubated for one hour RT with 600 rpm shake followed by an overnight incubation at +4° C. After washing away any unbound substances with 3×150 μl PBS-Tween, 50 μl of a Biotin conjugated polyclonal detection antibody specific for human IL-1RA (BAF280, R&D Systems) was added to the wells and incubated for 2 hours RT. The detection antibody was diluted to 0.4 μg/ml in PBS supplemented with 0.5% casein. Unbound detection antibody was washed away with 3×150 μl PBS-Tween and 50 μl of HRP labeled Streptavidin (MabTech) was added to the wells and incubated for one hour RT with 400 rpm shake. The SA-HRP conjugate was diluted 1/10000 in PBS supplemented with 0.5% casein. Following a wash with 3×150 μl PBS-Tween to remove any unbound SA-HRP conjugate, 50 μl substrate solution (Easy Blue Enhanced TMB Substrate, Medicago) was added to the wells and color developed in proportion to the amount of anakinra constructs bound. The color development was stopped after approx. 30 min by adding 25 μl of 2 M HCl to the wells and the intensity of the color was measured at 450 nm, with 540 nm as reference wavelength for plate background, in a microplate reader (SpectraMax i3, Molecular Devices).
(139) A standard curve was created with a four-parameter logistic function (equation 200 using XLfit for MS Excel). Read concentrations were multiplied with the dilution factor of the sample to obtain the concentration in neat sera.
(140) Pharmacokinetic analysis: The pharmacokinetic analysis was based on mean serum concentration versus time data from each dose group. The observed maximum concentration (C.sub.max) and the time to maximum serum concentration (t.sub.max) were taken directly from the bioanalytical concentration versus time data. Other pharmacokinetic parameters: dose-normalized C.sub.max (C.sub.max/Dose), area under the concentration versus time curve (AUC), clearance (CL), apparent clearance following subcutaneous administration (CL/F), apparent volume of distribution at steady-state (V.sub.ss), mean residence time (MRT) and terminal half-life (t.sub.1/2z), were estimated by non-compartmental analysis using Phoenix WinNonlin software version 6.3 (Pharsight Corp., USA). Calculation of the subcutaneous bioavailability (F) was performed using Microsoft Excel.
(141) Results
(142) Single-dose pharmacokinetic parameter estimates of PSI0540, PSI0541, PSI0542, PSI0545, PSI0547 and PSI0551 in rat are presented in Tables 13 and 14.
(143) The clearance and other intravenous pharmacokinetic parameters of PSI0551 were not determined due to bioanalytical anomalies. For the other five test items, the results following intravenous dosing showed that the clearance (ml/h.Math.kg) increased in the rank order: PSI0547 (SEQ ID NO: 45) (3.73)<PSI0545 (SEQ ID NO: 43) (9.25)<PSI0542 (SEQ ID NO: 40) (12.9)<PSI0540 (SEQ ID NO: 38) (21.2)<PSI0541 (SEQ ID NO: 39) (30.5). The apparent volume of distribution (V.sub.ss) was small, ranging between 41.2 ml/kg (PSI0547 (SEQ ID NO: 45)) and 98.9 ml/kg (PSI0541 (SEQ ID NO: 39)). The mean residence time (hrs), i.e. the ratio V.sub.ss over CL, increased in the rank order: PSI0540 (SEQ ID NO: 38) (3.03)≈PSI0541 (SEQ ID NO: 39) (3.24)<PSI0545 (SEQ ID NO: 43) (5.59)≈PSI0542 (SEQ ID NO: 40) (6.72)<PSI0547 (SEQ ID NO: 45) (11.0).
(144) The results following subcutaneous dosing showed that PSI0547 had the lowest clearance, the highest dose-normalized C.sub.max, and the longest mean residence time of the six test items. The clearance, CL/F (ml/h.Math.kg), which is inversely proportional to the AUC, increased in the rank order: PSI0547 (SEQ ID NO: 45) (12)<PSI0545 (SEQ ID NO: 43) (34)<PSI0551 (SEQ ID NO: 49) (50)<PSI0542(SEQ ID NO: 40) (87)<PSI0540 (SEQ ID NO: 38) (128)<PSI0541 (SEQ ID NO: 39) (439).
(145) TABLE-US-00013 TABLE 13 Pharmacokinetic parameter estimates following iv administration. CL V.sub.ss MRT t.sub.1/2z SEQ ID NO Name (ml/h .Math. kg) (ml/kg) (hrs) (hrs) 38 PSI0540 21 .sup. 64 3.0.sup. 3.8.sup. 39 PSI0541 31 .sup. 99 3.2.sup. 3.3.sup. 40 PSI0542 13 .sup. 87 6.7.sup. 6.1.sup. 43 PSI0545 9.3.sup.a .sup. 52.sup.a 5.6.sup.a 6.2.sup.a (10, 8.4) (56, 47) (5.6, 5.6) (5.3, 7.0) 45 PSI0547 3.7.sup.b .sup. 41.sup.b 11.sup.b 8.6.sup.b (3.7, 3.8) (39, 43) (11,11) (8.0, 9.3) 49 PSI0551 n.d.* n.d.* n.d.* n.d.* *Not Determined; the estimates were judged as unreliable due to bioanalytical anomalies. .sup.aMean estimate for the two doses tested; estimate at 4 and 12 mg/kg, respectively, in brackets. .sup.bMean estimate for the two doses tested; estimate at 5 and 15 mg/kg, respectively, in brackets.
(146) TABLE-US-00014 TABLE 14 Pharmacokinetic parameter estimates following sc administration. SEQ F t.sub.max CL/F MRT t.sub.1/2z ID NO Name (%) C.sub.max/Dose* (hrs) (ml/h .Math. kg) (hrs) (hrs) 38 PSI0540 17 0.43 8 128 15 5.8 39 PSI0541 6.9 0.096 8 439 17 5.1 40 PSI0542 15 0.36 24 87 24 7.6 43 PSI0545 27 .sup.a 0.91 .sup.a 16 .sup.a 34 .sup.a 22 .sup.a 7.4 .sup.a (31, 24) (0.99, 0.84) (8, 24) (33, 35) (21,22) (7.4, 7.4) 45 PSI0547 31 .sup.b 2.2 .sup.b 24 .sup.b 12 .sup.b 34 .sup.b 10.9 .sup.b (26, 36) (1.9, 2.5) (24, 24) (14, 10) (32, 35) (9.9, 11.9) 49 PSI0551 n.d.** 0.74 8 50 18 4.6 *Dose-normalized Cmax in unit nM per nmol/kg **The subcutaneous bioavailability was not determined due to lack of reliable i.v. exposure data .sup.a Mean estimate for the two doses tested; estimate at 8 and 24 mg/kg, respectively, in brackets .sup.b Mean estimate for the two doses tested; estimate at 10 and 30 mg/kg, respectively, in brackets
(147) Further, the estimated terminal half-life, t.sub.1/2z, (hours) after intravenous infusion of the fusion proteins PSI0540, PSI0542, PSI0545, and PSI0547, which include M-IL-1Ra with half-life extending polypeptide moieties having 17, 34, 34 and 51 units, respectively, was plotted against apparent size by elution volume calibrated against globular proteins (
(148) Conclusions
(149) The half-life extending properties of the half-life extending polypeptide was shown to be a function of the length of the domain with PSI0547 with 51 units showing consistently the best properties. In general the fusion proteins containing two IL-1Ra molecules display shorter half-lives than the corresponding single fusion proteins. Furthermore, it was found that the bioavailability of the compounds does not decrease with length of the added half-life extending polypeptide. Instead, a trend of increased bioavailability was noted in the larger fusion proteins compared to smaller fusion proteins with the same architecture, in the series of PSI0540, PSI0542, PSI0545, PSI0547, and PSI0541 and PSI0551, respectively.
Example 9: In Vivo Pharmacokinetics of Met-huIL-1Ra and its PEGylated Variants
(150) This comparative example described investigation of the pharmacokinetics of Met-huIL-1Ra and Met-huIL-1Ra PEGylated at the N-terminus with linear 10 kDa PEG, linear 20 kDa PEG and linear 30 kDa PEG, respectively, in two separate studies in male rats.
(151) Materials and Methods
(152) The two separate studies followed the same general design as in Example 8. Met-huIL-1Ra proteins with or without PEG were administered to male Sprague-Dawley rats, for the subcutaneous part n=3, for the intravenous part n=1. The sampling time-points were as follows: subcutaneous sampling—0 (pre dose), 15 min, 30 min, 1, 2, 4, 6, 8, 24, 48, 72, 96, 120 and 144 hrs; intravenous sampling—0 (pre dose), 5 min, 20 min, 1, 2, 4, 6, 8, 24, 48, 72, 96, 120 and 144 hrs. The concentration of the proteins in the serum samples as determined by a sandwich ELISA using standards reagents and a standard protocol.
(153) Results
(154) Single-dose pharmacokinetic parameter estimates in rat are presented in Tables 15 and 16.
(155) TABLE-US-00015 TABLE 15 Pharmacokinetic parameter estimates following intravenous administration PEG(L10k)- PEG(L20k)- PEG(L30k)- Met-huIL- Met-huIL- Met-huIL- Met-huIL- Parameter 1Ra 1Ra 1Ra 1Ra V.sub.ss (ml/kg) 73 108 50 74 V.sub.z (ml/kg) ~700 205 110 172 CL (ml/h .Math. kg) 442 22 9.4 6.9 t1/2z (h) 1.1 6.4 8.1 17 MRT (h) 0.20 4.9 5.3 11
(156) TABLE-US-00016 TABLE 16 Pharmacokinetic parameter estimates following subcutaneous administration PEG(L10k)- PEG(L20k)- PEG(L30k)- Met-huIL- Met-huIL- Met-huIL- Met-huIL- Parameter 1Ra 1Ra 1Ra 1Ra F (%) 62 46 35 37 C.sub.max/Dose 458 539 933 1308 t.sub.max (h) 1.4 24 24 24 CL/F (ml/h .Math. kg) ~650 47 27 20 V.sub.z/F (ml/kg) ~800 311 377 513 t.sub.1/2z (h) 0.89 4.6 9.9 19 MRT (h) 2.2 26 26 37
Conclusions
(157) Clearance (CL) decreases with increasing size of PEG (442 (Met-huIL-1Ra)>22.2 (L10k)>9.43 (L20k)>6.93 (L30k)). Mean residence time increases with increasing size of PEG (IV: 0.20 (Met-huIL-1Ra)<4.9 (L10k)˜5.3 (L20k)<11 (L30k); SC: 2.2 (Met-huIL-1Ra)<26 (L10k)=26 (L20k)<37 (L30k)). The bioavailability after subcutaneous dose (F) decreases with increasing size of PEG; this property of the PEG conjugates is in contrast to the effect of the half-life extending polypeptide, where fusion proteins with longer half-life extending polypeptides in fact exhibited a greater bioavailability. For all PEGs, maximum plasma levels were observed at 24 hrs.
Example 10: Comparative Study of Pharmacokinetic Properties of Variants of C5 Binding Polypeptides
(158) In this comparative Example, the pharmacokinetics of fusion protein according to embodiments of the invention, C5 binding protein and a PEGylated C5 binding protein (PSI0493, PSI0489 and PSI0257) were evaluated in three single dose studies in male rats.
(159) Materials and Methods
(160) The three studies followed the same general design with a single intravenous (iv) or subcutaneous (sc) dose in male Sprague-Dawley rat (N=3 per administration route and protein). Blood samples for preparation of serum for determination of PSI0257 concentration were taken at the following nominal time points: 0 (pre dose), 5 min, 20 min, 1, 2, 4, 8, 12, 24, 48, 96 and 168 hrs. For PSI0489 and PSI0493 blood samples were taken at 0 (pre dose), 5 min (IV only), 15 min (SC only), 1, 4, 8, 24, 48, 72, 120 and 192 hrs after the dose. PSI0257, PSI0489 and PSI0493 serum concentrations were determined by pepsin digestion followed by LC/LC/MS/MS analysis using a synthetic radioisotope labeled peptide common for all three fusion proteins. Individual concentration versus time profiles were compiled from the actual measurements and nominal time points. The maximum PSI0257, PSI0489 or PSI0493 concentration in serum, C.sub.max, and the time to reach this maximum serum concentration following administration, t.sub.max, were determined from individual data. The individual pharmacokinetic profiles were subjected to Non-Compartmental Analysis to calculate terminal half-life, t.sub.1/2z, mean residence time (MRT), area under the plasma concentration-time curve from time zero to infinity, AUC∞, and clearance, CL.
(161) Results
(162) The results are summarized in Table 17.
(163) TABLE-US-00017 TABLE 17 Pharmacokinetic parameter estiamtes following intravenous or subcutaneous administration. PSI0257 PSI0489 PSI0493 iv sc iv sc iv sc Dose (mg/kg) 2 4 9.2 22.5 6.2 15.3 Dose (umol/kg) 0.29 0.57 0.25 0.61 0.26 0.64 C.sub.max (umol/L) 1.9 0.7 5.7 1.7 5.1 1.4 C.sub.max/dose (kg/L) 6.6 1.4 23 2.8 20 2.3 t.sub.max (h) 0.083 0.8 0.083 24 0.083 6.7 t.sub.1/2z (h) 6.2 4.5 45 48 20 21 MRT (h) 6.2 6.1 53 76 24 30 CL (mL/h/kg) 81 — 1.8 — 9.2 — AUC.sub.∞ (h * umol/L) 3.6 4.9 142 138 28.3 52.0 AUC.sub.∞/dose (h * kg/L) 12.4 8.6 570 224 109 81.4 F (%) — 70 — 39 — 75
Conclusions
(164) The t.sub.1/2z of the fusion protein comprising the half-life extending polypeptide according to embodiments of the invention is extended to 20 h compared with 6 h for the parent molecule alone, with a 9-fold higher AUC∞ and hence a 9-fold reduction in clearance. Compared to PSI0489 which is the same targeting molecule chemically conjugated to a 30 kDa linear PEG at a Cys in the C-terminus the terminal half-life is 20 h compared to 45 h. This is in line with the data presented in Example 4, Table 7, where the size increase of the target is 10× for the fusion protein including the half-life extending polypeptide but is 24× for the PEGylated target.
Example 11: Cloning and Production of Antibody Fragment Based Fusion Proteins
(165) This Example describes the general strategies for cloning and production of fusion proteins of Ruplizumab antibody fragment sequences with half life extending polypeptides as disclosed herein. Half life extending polypeptides were fused to either the light chain (LC) or the heavy chain (HC) of the antibody fragments. The fusion proteins produced in this Example were used in the Examples 12 to 15 below.
(166) Materials and Methods
(167) DNA constructions: DNA sequences encoding a set of antibody fragments with or without half-life extending polypeptides were codon optimized for expression in E. coli or CHO cells and synthesized by the Invitrogen GeneArt Gene Synthesis service at Thermo Fisher Scientific (see Table 18 below for the nucleotide sequences of the region that correspond to the mature protein sequence, signalling peptides not included). The genes were cloned in expression vectors for subsequent expression in E. coli, Expi293 cells or ExpiCHO cells. For PSI0716, PSI0717, PSI0762 and PSI0761 a bicistronic vector was used to incorporate both the nucleotide sequences for the heavy and the light chain.
(168) TABLE-US-00018 TABLE 18 Overview of antibody fragment based fusion proteins and corresponding nucleotide sequences # of units of the half-life extending polypeptide Name Description Heavy chain/Light chain (where applicable) moiety Nucleotide sequence PSI0698 Ruplizumab Fab (hu5c8) HC/Ruplizumab Fab (hu5c8) LC —/— SEQ ID NO: 84/SEQ ID NO: 89 PSI0699 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]/ 17/17 SEQ ID NO: 85/SEQ ID NO: 90 Ruplizumab Fab (hu5c8) LC-[half-life extending polypeptide moiety] PSI0700 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]/ 34/34 SEQ ID NO: 86/SEQ ID NO: 91 Ruplizumab Fab (hu5c8) LC-[half-life extending polypeptide moiety] PSI0701 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]/ 51/— SEQ ID NO: 87/SEQ ID NO: 89 Ruplizumab Fab (hu5c8) LC-[half-life extending polypeptide moiety] PSI0702 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]/ 68/— SEQ ID NO: 88/SEQ ID NO: 89 Ruplizumab Fab (hu5c8) LC-[half-life extending polypeptide moiety] PSI0706 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]/ 34/— SEQ ID NO: 86/SEQ ID NO: 89 Ruplizumab Fab (hu5c8) LC-[half-life extending polypeptide moiety] PSI0707 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]/ —/34 SEQ ID NO: 84/SEQ ID NO: 91 Ruplizumab Fab (hu5c8) LC-[half-life extending polypeptide moiety] PSI0716 Ruplizumab Fab (hu5c8) HC/Ruplizumab Fab (hu5c8) LC —/— SEQ ID NO: 94/SEQ ID NO: 97 PSI0717 Ruplizumab Fab (hu5c8) HC/Ruplizumab Fab (hu5c8) LC —/— SEQ ID NO: 95/SEQ ID NO: 97 PSI0718 Ruplizumab ScFv (VH-VL) 0 SEQ ID NO: 93 PSI0719 Ruplizumab ScFv (VH-VL) 0 SEQ ID NO: 92 PSI0762 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]/ 34/— SEQ ID NO: 96/SEQ ID NO: 98 Ruplizumab Fab (hu5c8) LC PSI0761 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]/ 34/— SEQ ID NO: 99/SEQ ID NO: 97 Ruplizumab Fab (hu5c8) LC
(169) Cultivation and purification: E. coli cells were transformed with expression vectors containing the gene fragments encoding the recombinant antibody fragments or fusion proteins and then cultivated in bioreactors using fed-batch techniques or in shake flasks, followed by protein expression and harvest of cells by centrifugation. Cell pellets were stored at −20° C. or directly subjected to osmotic shock, released proteins were clarified by centrifugation and stored at −20° C. Expression of recombinant antibody fragments or fusion proteins was performed using the Expi293 and ExpiCHO expression systems (Thermo Fisher Scientific), essentially according to the manufacturer's protocol. Supernatants were harvested by centrifugation 6 days after transfection of expression vectors and stored at −70° C. Table 19 lists the encoded protein sequences.
(170) Frozen E. coli cell pellets were resuspended and then disrupted by sonication and the cell debris subsequently removed by centrifugation followed by filtration (0.22 μm). Osmotic shock samples and supernatants from the ExpiCHO and the Expi293 cultures were thawed and filtered (0.22 μm) before purification. Each supernatant, containing the recombinant antibody fragments or fusion proteins was purified using conventional chromatography methods. Recombinant fusion proteins for use in animal studies were also subjected to an endotoxin removal purification using Detoxi-Gel Endotoxin Removing Columns (Pierce, cat. no. 20344). Purified antibody fragments or fusion proteins were buffer exchanged to PBS and, unless otherwise stated, PBS was also the formulation buffer used in subsequent experiments. The purity of the fusion proteins was analyzed by SDS-PAGE stained with Coomassie Blue and the molecular weight of each protein was analyzed using mass spectrometry (HPLC/MS or MALDI-TOF/MS).
(171) Results
(172) Purification resulted in protein preparations with high purity, which was analyzed by SDS-PAGE stained with Coomassie Blue. The correct identity and molecular weight of each fusion protein were confirmed by mass spectrometry analysis.
(173) Table 19 below lists the amino acid sequences of the produced proteins. A half life extending polypeptide was fused to the C terminal of either the light chain (LC in the table below) or heavy chain (HC in the table below), or both of the light chain and the heavy chain of the Ruplizumab Fab.
(174) Conclusions
(175) Fusion proteins containing antibody fragments and half-life extending polypeptides of various lengths can be produced by constructing synthetic genes followed by expression in mammalian or bacterial systems and purified to high purity using conventional techniques.
(176) TABLE-US-00019 TABLE 19 Description, expression system and SEQ ID NOs of proteins produced # of units of the half-life extending PSI Expression polypeptide reference Description system moiety SEQ ID NO PSI0698 Ruplizumab Fab (hu5c8) HC/Ruplizumab Fab (hu5c8) LC ExpiCHO —/— SEQ ID NO: 67/SEQ ID NO: 68 PSI0699 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]/ ExpiCHO 17/17 SEQ ID NO: 69/SEQ ID NO: 70 Ruplizumab Fab (hu5c8) LC-[half-life extending polypeptide moiety] PSI0699 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]/ Expi293 17/17 SEQ ID NO: 69/SEQ ID NO: 70 Ruplizumab Fab (hu5c8) LC-[half-life extending polypeptide moiety] PSI0700 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]/ ExpiCHO 34/34 SEQ ID NO: 71/SEQ ID NO: 72 Ruplizumab Fab (hu5c8) LC-[half-life extending polypeptide moiety] PSI0700 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]/ Expi293 34/34 SEQ ID NO: 71/SEQ ID NO: 72 Ruplizumab Fab (hu5c8) LC-[half-life extending polypeptide moiety] PSI0701 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]/ ExpiCHO 51/— SEQ ID NO: 73/SEQ ID NO: 68 Ruplizumab Fab (hu5c8) LC-[half-life extending polypeptide moiety] PSI0701 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]/ Expi293 51/— SEQ ID NO: 73/SEQ ID NO: 68 Ruplizumab Fab (hu5c8) LC-[half-life extending polypeptide moiety] PSI0702 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]/ ExpiCHO 68/— SEQ ID NO: 74/SEQ ID NO: 68 Ruplizumab Fab (hu5c8) LC-[half-life extending polypeptide moiety] PSI0706 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]/ ExpiCHO 34/— SEQ ID NO: 71/SEQ ID NO: 68 Ruplizumab Fab (hu5c8) LC-[half-life extending polypeptide moiety] PSI0707 Ruplizumab Fab (hu5c8) HC/Ruplizumab Fab (hu5c8) LC-[half-life ExpiCHO —/34 SEQ ID NO: 67/SEQ ID NO: 72 extending polypeptide moiety] PSI0716 Ruplizumab Fab (hu5c8) HC-GS/Ruplizumab Fab (hu5c8) LC E. coli —/— SEQ ID NO: 76/SEQ ID NO: 68 PSI0717 Ruplizumab Fab (hu5c8) HC-GS/Ruplizumab Fab (hu5c8) LC E. coli —/— SEQ ID NO: 77/SEQ ID NO: 78 PSI0718 Ruplizumab ScFv (VL-VH)-C-tag Expi293 — SEQ ID NO: 79 PSI0719 Ruplizumab ScFv (VL-VH)-C-tag Expi293 — SEQ ID NO: 80 PSI0761 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]-GS/ E. coli 34/— SEQ ID NO: 82/SEQ ID NO: 68 Ruplizumab Fab (hu5c8) LC PSI0762 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]-GS/ E. coli 34/— SEQ ID NO: 83/SEQ ID NO: 68 Ruplizumab Fab (hu5c8) LC PSI0724 Ruplizumab-N297A-Avitag HC/Ruplizumab Fab (hu5c8) LC ExpiCHO —/— SEQ ID NO: 81/SEQ ID NO: 68 PSI0773 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]/ Expi293 17/— SEQ ID NO: 69/SEQ ID NO: 68 Ruplizumab Fab (hu5c8) LC PSI0774 Ruplizumab Fab (hu5c8) HC/Ruplizumab Fab (hu5c8) LC-[half-life Expi293 —/17 SEQ ID NO: 67/SEQ ID NO: 70 extending polypeptide moiety] PSI0775 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]/ Expi293 34/17 SEQ ID NO: 71/SEQ ID NO: 70 Ruplizumab Fab (hu5c8) LC-[half-life extending polypeptide moiety] PSI0776 Ruplizumab Fab (hu5c8) HC-[half-life extending polypeptide moiety]/ Expi293 17/34 SEQ ID NO: 69/SEQ ID NO: 72 Ruplizumab Fab (hu5c8) LC-[half-life extending polypeptide moiety]
Example 12: Biophysical Characterization of Fusion Proteins
(177) This Example describes the characterization of fusion proteins containing Ruplizumab Fab and half-life extending polypeptides, using unfused proteins and PEGylated proteins as references, with respect to biophysical characteristics such as apparent size and molecular weight (MW) in solution and determination of hydrodynamic radius in solution by size exclusion chromatography (SEC) and column calibration and Multi Angle Light Scattering (MALS).
(178) Material and Methods
(179) The size of the fusion proteins, unfused proteins and PEGylated proteins in solution, was assessed by analytical gel filtration on an ÄKTA Micro (GE Healthcare Life Sciences) using a calibrated column Superdex 200 Increase 3.2/300 (GE Healthcare Life Sciences). The column was calibrated with Gel Filtration Calibration Kit LMW (code no. 28-4038-41, GE Healthcare Life Sciences) and Calibration Kit HMW (code no. 28-4038-42, GE Healthcare Life Sciences), containing 8 globular proteins in the size range of 6 to 669 kDa and Blue Dextran 2000, using a running buffer of 25 mM NaP and 125 mM NaCl pH 7.0 with a flow rate of 75 μl/min at a temperature of 25° C. The corresponding size and hydrodynamic radius in solution can be calculated from the elution volume of a protein on a calibrated column by the methods described in appendix 10 of Handbook of Size Exclusion Chromatography Principles and Methods (order no 18-1022-18, GE Healtcare Life Sciences). The molecular weight of the proteins was determined by a connected MALS-RI system: Static light scattering detector miniDawn Tristar and Differential refractometer Optilab rEX, and the Astra V software (Wyatt Technology Europe, Germany).
(180) The proteins of interest were analyzed under the same conditions as during the calibration.
(181) Results
(182) Table 20 presents the results for the fusion proteins and reference proteins.
(183) TABLE-US-00020 TABLE 20 Characterization of Ruplizumab Fab fusion proteins and reference proteins Theorectical MW MW by Stokes No. of Expression MW MALS elution volume radius Size units Name SEQ ID NO system (kDa) (kDa) (kDa) (nm) increase on HC/LC PSI0698 SEQ ID NO: 67/ ExpiCHO 48 46 39 2.9 — —/— SEQ ID NO: 68 PSI0699 SEQ ID NO: 69/ ExpiCHO 83 84 457 6.7 12 17/17 SEQ ID NO: 70 PSI0699 SEQ ID NO: 69/ Expi293 83 83 441 6.6 11 17/17 SEQ ID NO: 70 PSI0700 SEQ ID NO: 71/ ExpiCHO 116 110 752 8.5 19 34/34 SEQ ID NO: 72 PSI0700 SEQ ID NO: 71/ Expi293 116 108 757 8.5 19 34/34 SEQ ID NO: 72 PSI0701 SEQ ID NO: 73/ ExpiCHO 99 97 626 7.7 16 51/— SEQ ID NO: 68 PSI0702 SEQ ID NO: 74/ ExpiCHO 107 115 759 8.5 19 68/— SEQ ID NO: 68 PSI0706 SEQ ID NO: 71/ ExpiCHO 82 76 450 6.7 12 34/— SEQ ID NO: 68 PSI0707 SEQ ID NO: 67/ ExpiCHO 82 80 454 6.7 12 —/34 SEQ ID NO: 72 PSI0717 SEQ ID NO: 76/ E. coli 48 47 42 2.9 1 —/— SEQ ID NO: 68 PSI0718 SEQ ID NO: 79 Expi293 27 27 28 2.4 0.7 — PSI0719 SEQ ID NO: 80 Expi293 27 27 29 2.4 0.7 — PSI0762 SEQ ID NO: 83/ E. coli 82 78 430 6.6 11 34/— SEQ ID NO: 78 Certolizumab — Purchased 88 77 572 7.5 15 40kDa pegol PEG/— Dapirolizumab — Purchased 48 49 29 2.5 0.7 —/— Fab
Conclusions
(184) A correlation of total length of the half-life extension polypeptide comprised in the fusion protein and its size in solution was observed: the size in solution did not depend upon the positioning of the half-life extension polypeptide, since the size of the different fusion proteins was similar if all units of the half-life extending polypeptide were fused to the heavy chain (HC), to the light chain (LC), or if the same number of units was distributed between both the heavy and the light chain of the Fab.
(185) It has been noted that the hydrodynamic radius or Stokes radius of albumin, which is above the size limit of renal clearance, is 3.8 nm. This could serve as a limit of the minimal size required to avoid renal clearance. All the above tested fusion proteins had a size above that of albumin.
Example 13: Binding to Human CD40
(186) This Example describes the binding characteristics of fusion proteins of Ruplizumab Fab and half-life extending polypeptides, wherein Ruplizumab, unfused Fab protein and another Fab targeting human CD40L, were used as reference proteins.
(187) Material and Methods
(188) The binding affinities of the fusion proteins containing Ruplizumab Fab and half-life extending polypeptides for human CD40 ligand (CD40L or CD154) were analyzed using an OctetRED96 instrument (Pall/ForteBio). Polypeptides, immobilized using anti-human Fab-CH1 2.sup.nd generation (FAB2G, Pall/ForteBio) sensors were tested for binding to the extracellular part of human CD40L (aa 108-261 recombinantly produced in E. coli) typically over a concentration range from 2.5 to 80 nM in 1:2 step increments.
(189) Typically, association for each concentration of CD40L was monitored for 180s followed by a dissociation of 600 s. The sensors were regenerated by 3×10 s pulses at pH 2 between each cycle and data for each sensor were referenced against buffer exposure. Kinetic constants were calculated from the sensorgrams using the Langmuir 1:1 analyte model (Global fit) of the software “Octet System Data Analysis, Release 10.0—kinetics module (ForteBio, Pall Life Sciences).
(190) Results
(191) The resulting K.sub.D values are tabulated in Table 21. When dissociation was below 5% over the 600 s monitoring time (kd<1e.sup.−4), this value was used as K.sub.D.
(192) TABLE-US-00021 TABLE 21 Binding of immobilized human Fab fusion protein to human CD40L Number of units of the half-life extending polypeptide Dissociation SEQ ID NOs Cell/ moiety constant K.sub.D Name (HC/LC) Batch (HC/LC) (nM) PSI0698 SEQ ID NO:67/ CHO —/— <0.3 SEQ ID NO:68 PSI0717 SEQ ID NO: 77/ E.coli 17/17 <0.3 SEQ ID NO:78 PSI0699 SEQ ID NO:69 / CHO 17/17 <0.3 SEQ ID NO:70 PSI0699 SEQ ID NO:69/ HEK 17/17 <0.3 SEQ ID NO:70 PSI0700 SEQ ID NO:71/ CHO 34/34 <0.3 SEQ ID NO:72 PSI0701 SEQ ID NO:73/ CHO 51/— <0.3 SEQ ID NO:68 PSI0702 SEQ ID NO:74/ CHO 68/— <0.3 SEQ ID NO:68 PSI0707 SEQ ID NO:67/ CHO —/34 <0.3 SEQ ID NO:72 PSI0762 SEQ ID NO:83/ E.coli 34/— <0.3 SEQ ID NO:78 Ruplizumab Purchased 0.66 Dapirolizumab Purchased —/— <0.3 Fab
Conclusions
(193) The fusion of the Fab to the half-life extending polypeptide has no measurable influence on affinity of said Fab to the soluble part of human CD40L. The affinities of all tested fusion proteins for human CD40L were comparable to the control proteins Ruplizumab and Dapirolizumab Fab.
Example 14: In Vitro and in Silico Immunogenic Propensity Investigation
(194) This Example aims to identify potentially immunogenic regions present in PSI0699 (SEQ ID NO: 69/SEQ ID NO: 70). The ProImmune ProPresent® Antigen Presentation assay were performed by ProImmune (UK). Immunogenic regions were determined by identifying peptides that would be naturally processed by monocyte derived dendritic cells and consequently presented by the MHC antigen presentation system. Detection of putative immunogenic peptides was performed utilizing mass spectrometry LC/MS/MS-based analysis.
(195) Material and Methods
(196) The ProImmune ProPresent® Antigen Presentation assay was used to identify potentially immunogenic regions present in PSI0699. They were determined by identifying peptides naturally processed by monocyte-derived dendritic cells, and consequently presented by Class II MHC (HLA-DR) molecules. Dendritic cells used in this assay were isolated from 11 normal healthy blood donors that had an adequate coverage of HLA types present in the human population. Putative immunogenic peptides were identified by LC/MS/MS-based analysis sequencing mass spectrometry.
(197) The in silico immunogenicity analysis was performed using the software TEPredict (Antonets & Maksyutov TEpredict: Software for T-Cell Epitope Prediction Molecular Biology, 2010, Vol. 44, No. 1, pp. 119-127).
(198) Results
(199) Overall there were 4 potentially immunogenic peptides identified in the assay, 1 was from the heavy chain of the Fab of PSI0699 and 3 were from the light chain of the Fab. Out of these, 2 were previously published as a potential Tregitope sequence, termed Treg 134, that encompasses both of these peptides. All peptides originate from constant regions of the antibody derived portion of the molecule. No immunogenic peptides derived from the half-life extending polypeptide were presented in the assay.
(200) Moreover, the in silico evaluation did not predict any peptide from the half-life extending polypeptide to have propensity to bind to any MHC class of molecules. However, the in silico analysis predicted that further peptides from the Fab portion are likely to bind to to various MHC molecules, including peptides from the variable regions inferring target specificity of the Fab.
(201) Conclusions
(202) As no peptides were presented from the half-life extending polypeptide in the current assay setup the potential for immunogenicity of the half-life extending polypeptide is judged to be low. The overall immunogenic potential is also judged to be low as only regions that are common to many antibodies are presented in the assay. The presentation of a previously published Tregitope peptide also suggests a low response.
Example 15: Comparative Study of Pharmacokinetic Properties of Fab Based Fusion Proteins
(203) In this Example, the intravenous and subcutaneous pharmacokinetic properties of PSI0699 (SEQ ID NO:69/SEQ ID NO:70) and PSI0701 (SEQ ID NO: 73), including unfused CD40L Fab as a control (PSI0698, Ruplizumab Fab, (SEQ ID NO:67/SEQ ID NO:68) were assessed.
(204) Materials and Methods
(205) The study followed the same general design with a single intravenous (IV) or subcutaneous (SC) dose in male Sprague-Dawley rat (N=3 per administration route and protein) for both PSI0699 and PSI0701. For PSI0698 only the IV portion of the experiment was performed.
(206) For PSI0699 and PSI0701 the dose and timepoints for IV experiment were as follows, 2 mg/kg: 5 and 20 min and 1, 4, 8, 24, 48, 72, 96 and 120 hours. For the SC experiments a dose of 4 mg/kg was used and blood samples were taken at these time points: 20 min and 1, 4, 8, 24, 48, 72, 96, 120 and 168 hours. For the IV experiment of PSI0698 a dose of 13 mg/kg was used and blood was withdrawn at the following timepoints: 5 and 20 min and 1, 2, 4, 8, 24, 30 and 48 hours. PSI0698, PSI0699 and PSI0701 serum concentrations were determined by a sandwich assay on the Meso Scale Discovery platform (Meso Scale Diagnostics). Active drug was captured using biotinylated CD40L and detected using a Rutenium conjugated anti-human IgG (Fab specific) antibody produced in goat (15260, Sigman-Aldrich). Individual concentration versus time profiles were compiled from the actual serum concentration measurements and nominal time points. The maximum PSI0698, PSI0699 and PSI0701 concentration in serum, C.sub.max, and the time to reach this maximum serum concentration following administration, t.sub.max, were determined from individual data. Other exposure and pharmacokinetic parameter estimates were determined profiles by Non-Compartmental Analysis (using Phoenix WinNonlin 8.0); i.e. AUC (area under the plasma serum concentration-time curve from time zero to infinity), CL (clearance), CL/F, (clearance following SC administration), V.sub.ss (apparent volume of distribution at steady-state), MRT (mean residence time) and t.sub.1/2z (terminal half-life). The subcutaneous bioavailability, F, was calculated based on individual AUC/Dose (SC) divided by the median AUC/Dose (IV).
(207) Results
(208) The results are summarized in Table 22 for the IV experiment and Table 23 for the SC experiment.
(209) TABLE-US-00022 TABLE 22 Median (range) PK parameter estimates following an intravenous single dose. PSI0699 PSI0701 PSI0698 (SEQ ID NO: 69/ (SEQ ID NO: 73/ (SEQ ID NO: 67/ SEQ ID NO: 70) SEQ ID NO: 68) SEQ ID NO: 68) Dose (nmol/kg) 47.1 (44.3-50.9) 39.0 (36.7-49.9) 277 (243-279) CL (ml/h .Math. kg) 0.79 (0.74-0.80) 0.77 (0.72-0.79) 120 (100-148) Vss (ml/kg) 50.1 (49.4-52.8) 42.2 (38.4-43.2) 90.0 (54.2-544) MRT (hrs) 63.1 (61.9-71.9) 55.1 (48.6-60.1) 0.75 (0.55-3.7) t1/2z (hrs) 47.1 (44.3-50.9) 39.0 (36.7-49.9) 4.2 (3.3-13.4)
(210) TABLE-US-00023 TABLE 23 Median (range) PK parameter estimates following a subcutaneous single dose PSI0699 PSI0701 (SEQ ID NO:69/ (SEQ ID NO:73/ SEQ ID NO:70) SEQ ID NO:68) Dose (nmol/kg) 48.6 (48.2-49.4) 41.6 (41.2-42.8) F (%) 67.8 (60.5-69.3) 49.8 (33.7-54.8) t.sub.max (hrs) 24 (24-48) 48 (24-48) CL/F (ml/h .Math. kg) 1.14 (1.12-1.28) 1.52 (1.38-2.25) MRT (hrs) 93.9 (75.5-95.2) 77.3 (71.2-80.7) t.sub.1/2z (hrs) 52.9 (32.8-54.8) 40.2 (32.0-43.8) C.sub.168h (nM) 77.2* (47.9-82.8) 39.6 (19.8-42.4)
Conclusions
(211) The clearance of PSI0699 and PSI0701 was more than 100 times lower than the CL of the CD40L Fab. The intravenous PK of PSI0699 and PSI0701, respectively, was characterized by a low clearance and a small volume of distribution. Both PSI0699 and PSI0701 showed a relatively high SC bioavailability, with C.sub.max levels observed at 24 or 48 hrs after dose, and then declining monophasically with a t.sub.1/2z in the order of 32-55 hrs. Based on median estimates, PSI0699 showed a somewhat higher bioavailability (68 vs. 50%), longer biological half-life (53 vs. 40 hrs) and C.sub.168h/Dose levels (1.6 vs. 0.96), compared to PSI0701.