NOVEL ANTIGENS AND T CELL EPITOPES FROM COCKROACH AND METHODS OF MAKING AND USING SAME

20180291071 ยท 2018-10-11

Assignee

Inventors

Cpc classification

International classification

Abstract

The specificity of CD4+ TH responses of German cockroach (Bla g) antigens, and whether differences exist in magnitude or functionality as a function of disease severity, is disclosed. Also disclosed are novel German cockroach allergens and epitopes.

Claims

1. A protein or peptide having an amino acid sequence comprising, consisting of or consisting essentially of an amino acid sequence set forth in Tables 5-8, or a subsequence, portion, homologue, variant or derivative thereof.

2. The protein or peptide of claim 1, wherein the protein or peptide modulates, inhibits or reduces an anti-allergen immune response.

3. The protein or peptide of claim 2, wherein the anti-allergen immune response comprises a T cell response.

4. The protein or peptide of claim 2 or 3, wherein the anti-allergen immune response comprises a T cell response against a Cockroach allergen.

5. The protein or peptide of claim 1, wherein the protein or peptide is an amino acid sequence set forth in Table 6, or a subsequence, portion, homologue, variant or derivative thereof.

6. The protein or peptide of claim 1, wherein the protein or peptide is an amino acid sequence of any of: TIPYYTKKFDEVVKA, ISDFRAAIANYHYDA, YFVAILDYLNHMAKE, VAISRYLGKQFGLSG, MIVDTISDFRAAIAN, DLVANQPNLKALREK, HDDRLGFLTFCPTNL, KNRTTIRGRTKFEGN, DRKMYWQFKMDKIQI, ALREKVLGLPAIKAW, IRGRTKFEGNKFTID, NDIEKRVPFSHDDRL, HMAKEDLVANQPNLK, VLEKLEAGFAKLAAS, NYAIVEGCPAAANGH, GIRIYVDVVLNQMSG, RWRQIFNMVGFRNAV, NIACLLHNKYDSTKS, NGGYLAAGKLTWADF, LNIFTNNLGRINTHV, KTPVLEIDGKQTHQS, PAYFKMNSPSLWKYN, PKSMLLNIFTNNLGR, or a subsequence, portion, homologue, variant or derivative thereof, or a combination thereof.

7. The protein or peptide of claim 1, wherein the protein or peptide is an amino acid sequence of any of: TIPYYTKKFDEVVKA, ISDFRAAIANYHYDA, YFVAILDYLNHMAKE, VAISRYLGKQFGLSG, MIVDTISDFRAAIAN, DLVANQPNLKALREK, HDDRLGFLTFCPTNL, KNRTTIRGRTKFEGN, DRKMYWQFKMDKIQI, ALREKVLGLPAIKAW, IRGRTKFEGNKFTID, NDIEKRVPFSHDDRL, HMAKEDLVANQPNLK, VLEKLEAGFAKLAAS, NYAIVEGCPAAANGH, GIRIYVDVVLNQMSG, RWRQIFNMVGFRNAV, NIACLLHNKYDSTKS, NGGYLAAGKLTWADF, LNIFTNNLGRINTHV, KTPVLEIDGKQTHQS, PAYFKMNSPSLWKYN, PKSMLLNIFTNNLGR, or a combination thereof.

8. The protein or peptide of claim 1, wherein the protein or peptide is not identical to an amino acid sequence of any of: FETIVVTVDSLPEFK, LIDDVLAILPLDDLK, FAVATITHAAELQRV, PLYKLVHVFINTQYA, GNQNFLTVFDSTSCN, ISSQYYIQQNGNLC, HFFIGDFFVDHYYSE, GEPIRFLLSYGEKDF, FLLSYGEKDFEDYRF, SMPFGKTPVLEIDGK, VAISRYLGKQFGLSG, ISDFRAAIANYHYDA, YFVAILDYLNHMAKE, HMAKEDLVANQPNLK, DLVANQPNLKALREK, ALREKVLGLPAIKAW, VLGLPAIKAWVAKRP, EQISVLRKAFDAFDR, LRKAFDAFDREKSGS, EFVTLAAKFIIEEDS, EAMEKELREAFRLYD, or SGTVDFDEFMEMMTG.

9. A composition comprising the protein or peptide of claims 1-8.

10. The composition of claim 9, further comprising a pharmaceutically acceptable carrier, diluent or excipient.

11. The composition of claim 9, further comprising an adjuvant.

12. A vaccine comprising the protein or peptide of claims 1-11.

13. A unit dosage form comprising the composition or vaccine of any of claims 9 to 13.

14. A method of modulating immune activity of a cell against a Cockroach allergen, the method comprising contacting the cell with an amount of protein or peptide having an amino acid sequence comprising, consisting of or consisting essentially of an amino acid sequence set forth in Tables 5-8, or a subsequence, portion, homologue, variant or derivative thereof, sufficient to modulate the immune activity of the cell against the Cockroach allergen.

15. The method of claim 14, wherein the method comprises inducing in the cell immunological tolerance to the Cockroach allergen.

16. A method of modulating immune response against a Cockroach allergen in a subject, comprising administering to the subject an amount of protein or peptide having and an amino acid sequence comprising, consisting of or consisting essentially of an amino acid sequence set forth in Tables 5-8, or a subsequence, portion, homologue, variant or derivative thereof, sufficient to modulate the immune response against the Cockroach allergen in the subject.

17. A method of providing a subject protection against an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with a Cockroach allergen, comprising administering to the subject an amount of protein or peptide having an amino acid sequence comprising, consisting of or consisting essentially of an amino acid sequence set forth in Tables 5-8, or a subsequence, portion, homologue, variant or derivative thereof, sufficient to provide the subject with protection against the allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with the Cockroach allergen.

18. A method of treating a subject for an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with a Cockroach allergen, comprising administering to the subject an amount of protein or peptide having an amino acid sequence comprising, consisting of or consisting essentially of an amino acid sequence set forth in Tables 5-8, or a subsequence, portion, homologue, variant or derivative thereof, sufficient to treat the subject for the allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with the Cockroach allergen.

19. The method of any one of claims 16 to 18, wherein the method comprises inducing in the subject immunological tolerance to the allergen.

20. The method of any one of claims 16 to 18, comprising administering to the subject two or more proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof set forth in Tables 5-8

21. The method of any one of claims 16 to 18, comprising administering to the subject an amino acid sequence set forth in Table 6, or a subsequence, portion, homologue, variant or derivative thereof.

22. The method of any one of claims 16 to 18, comprising administering to the subject an amino acid sequence of any of: TIPYYTKKFDEVVKA, ISDFRAAIANYHYDA, YFVAILDYLNHMAKE, VAISRYLGKQFGLSG, MIVDTISDFRAAIAN, DLVANQPNLKALREK, HDDRLGFLTFCPTNL, KNRTTIRGRTKFEGN, DRKMYWQFKMDKIQI, ALREKVLGLPAIKAW, IRGRTKFEGNKFTID, NDIEKRVPFSHDDRL, HMAKEDLVANQPNLK, VLEKLEAGFAKLAAS, NYAIVEGCPAAANGH, GIRIYVDVVLNQMSG, RWRQIFNMVGFRNAV, NIACLLHNKYDSTKS, NGGYLAAGKLTWADF, LNIFTNNLGRINTHV, KTPVLEIDGKQTHQS, PAYFKMNSPSLWKYN, PKSMLLNIFTNNLGR, or a subsequence, portion, homologue, variant or derivative thereof, or a combination thereof.

23. The method of any one of claims 16 to 18, comprising administering to the subject an amino acid sequence of any of: TIPYYTKKFDEVVKA, ISDFRAAIANYHYDA, YFVAILDYLNHMAKE, VAISRYLGKQFGLSG, MIVDTISDFRAAIAN, DLVANQPNLKALREK, HDDRLGFLTFCPTNL, KNRTTIRGRTKFEGN, DRKMYWQFKMDKIQI, ALREKVLGLPAIKAW, IRGRTKFEGNKFTID, NDIEKRVPFSHDDRL, HMAKEDLVANQPNLK, VLEKLEAGFAKLAAS, NYAIVEGCPAAANGH, GIRIYVDVVLNQMSG, RWRQIFNMVGFRNAV, NIACLLHNKYDSTKS, NGGYLAAGKLTWADF, LNIFTNNLGRINTHV, KTPVLEIDGKQTHQS, PAYFKMNSPSLWKYN, PKSMLLNIFTNNLGR, or a combination thereof.

24. The method of any one of claims 16 to 18, comprising administering to the subject a protein or peptide that is not identical to an amino acid sequence of any of: FETIVVTVDSLPEFK, LIDDVLAILPLDDLK, FAVATITHAAELQRV, PLYKLVHVFINTQYA, GNQNFLTVFDSTSCN, ISSQYYIQQNGNLC, HFFIGDFFVDHYYSE, GEPIRFLLSYGEKDF, FLLSYGEKDFEDYRF, SMPFGKTPVLEIDGK, VAISRYLGKQFGLSG, ISDFRAAIANYHYDA, YFVAILDYLNHMAKE, HMAKEDLVANQPNLK, DLVANQPNLKALREK, ALREKVLGLPAIKAW, VLGLPAIKAWVAKRP, EQISVLRKAFDAFDR, LRKAFDAFDREKSGS, EFVTLAAKFIIEEDS, EAMEKELREAFRLYD, or SGTVDFDEFMEMMTG.

25. A method of diagnosing and treating a Cockroach allergy in a subject, the method comprising: i. contacting a cell from the subject with a protein or peptide having an amino acid sequence comprising, consisting of or consisting essentially of an amino acid sequence set forth in Tables 5-8, or a subsequence, portion, homologue, variant or derivative thereof; and ii. determining if of protein, peptide, or a subsequence, portion, homologue, variant or derivative thereof, modulates immune activity from the contacted cell; wherein determination that the protein or peptide modulates immune activity from the contacted cell indicates that the subject has a Cockroach allergy; and optionally iii. treating the subject having the Cockroach allergy for the Cockroach allergy.

26. A method of detecting an allergic response to a Cockroach protein or peptide in a subject, the method comprising: i. contacting a cell from the subject with a protein or peptide having an amino acid sequence comprising, consisting of or consisting essentially of an amino acid sequence set forth in Tables 5-8, or a subsequence, portion, homologue, variant or derivative thereof; and ii. determining if the protein or peptide modulates immune activity from the contacted cell; wherein determination that the protein or peptide modulates immune activity from the contacted cell thereby detects an allergic response to the Cockroach allergen in the subject.

27. The method of any one of claim 25 or 26, wherein the protein or peptide having an amino acid sequence comprising, consisting of or consisting essentially of an amino acid sequence set forth in Table 8.

28. The method of any one of claim 16 to 18, 25 or 26, wherein the subject is a human.

Description

DESCRIPTION OF DRAWINGS

[0049] FIGS. 1A-1C show CD4.sup.+ T Cell Reactivity to Bla g Allergens. A) Overall responses (sum of all peptide and cytokine responses) to BLAGA after 14-day expansion with Bla g extract followed by 24-hour stimulation with BLAGA peptides. B) Individual BLAGA responses (sum of all cytokines) of Bla g sensitized and control subjects. C) Pattern of cytokine responses detected against BLAGA Geometric means and 95% confidence intervals shown. Black circles represent Bla g sensitized subjects, and gray open circles represent controls. *p0.05, **p0.005 by non-parametric Mann-Whitney t-test.

[0050] FIGS. 2A-2B show Identification of Novel Bla g antigens by 2-D Gel Immunoblot. A) Coomassie stain of 2-D gel of Bla g extract. B) Separated Bla g extract stained with pooled serum from 15 Bla g allergic subjects. Green spots indicate IgE binding; red spots indicate IgG binding; and yellow spots indicate dual IgE/IgG binding. Yellow circles indicate sections selected for proteomic analysis.

[0051] FIGS. 3A-3B show CD4.sup.+ T Cell Reactivity to Novel Bla g Antigens. A) Individual NBGA responses (sum of all cytokines) of Bla g sensitized and control subjects after 14-day expansion with Bla g extract followed by 24-hour stimulation with NBGA peptides. B) Pattern of cytokine responses detected against IgE+ and IgE NBGA in allergic and control subjects. Geometric means and 95% confidence intervals shown. ****p<0.0001,***p<0.001,**p<0.01, by non-parametric Mann-Whitney t-test.

[0052] FIGS. 4A-4B show Immunodominance of Bla g Epitopes. A) Comparison of the percentage of the total cytokine response per epitope. BLAGA represented by blue circles. Combined BLAGA and NBGA represented by black circles. B) Comparison of the number of epitopes recognized per subject among the Bla g sensitive subjects.

[0053] FIG. 5 shows Changing Magnitude and Polyfunctionality of Responses Among Asthma Severities. Height of pie chart is proportional to geometric mean of the total sum of responses for subject group. Numerical values inside pie charts are percentage of total response encompassed by the individual cytokine response. Red denotes relative proportion of IFN responses, blue IL-5, green IL-10, purple, IL-17, and gray IL-21. *p<0.05, **p<0.005, calculated by non-parametric Mann-Whitney t-test.

[0054] FIGS. 6A-6C show Differential Immunodominance of Bla g Antigens as a Function of Allergic Clinical Status. Percentage response accounted by individual antigens of total cytokine response to all Bla g Antigens for (A) Control, (B) Allergic Rhinitis, and (C) Asthmatic Allergic subjects. Other category encompasses antigens accounting individually for <1% of total response for all three groups.

[0055] FIGS. 7A-7D show Epitope Sets Correctly Predict Bla g Sensitivity and Asthma. Response to specific epitope set as a percentage of total response for (A) Asthmatic and (B) AR after overnight stimulation with epitope pools following two week culture in the presence of epitope pools with corresponding magnitudes (C-D).

DETAILED DESCRIPTION

[0056] In accordance with the invention, there are provided novel Cockroach proteins and peptides, and subsequences, portions, homologues, variants and derivatives thereof. A Cockroach protein or peptide as described herein may include any Cockroach protein or peptide, or a subsequence, portion, homologue, variant or derivative thereof. In certain embodiments, a Cockroach protein or peptide as described herein may include a novel Cockroach protein or peptide, for example, as set forth in any of Tables 5-8, or a subsequence, portion, homologue, variant or derivative thereof.

[0057] In particular embodiments, a Cockroach protein or peptide described herein includes, consists or consists essentially of a protein or peptide having an amino acid sequence set out in or a protein or peptide set forth in any of Tables 5 or 6 or a subsequence, portion, homologue, variant or derivative thereof, or a protein or peptide set forth in Table 6, or a subsequence, portion, homologue, variant or derivative thereof.

[0058] In particular embodiments, a Cockroach protein described herein includes, consists or consists essentially of an amino acid sequence set out in Table 7 or a subsequence, portion, homologue, variant or derivative thereof.

[0059] In particular embodiments, a Cockroach protein or peptide described herein includes, consists or consists essentially of a protein or peptide having an amino acid sequence set forth as (SEQ ID NOs.: 1-23): TIPYYTKKFDEVVKA, ISDFRAAIANYHYDA, YFVAILDYLNHMAKE, VAISRYLGKQFGLSG, MIVDTISDFRAAIAN, DLVANQPNLKALREK, HDDRLGFLTFCPTNL, KNRTTIRGRTKFEGN, DRKMYWQFKMDKIQI, ALREKVLGLPAIKAW, IRGRTKFEGNKFTID, NDIEKRVPFSHDDRL, HMAKEDLVANQPNLK, VLEKLEAGFAKLAAS, NYAIVEGCPAAANGH, GIRIYVDVVLNQMSG, RWRQIFNMVGFRNAV, NIACLLHNKYDSTKS, NGGYLAAGKLTWADF, LNIFTNNLGRINTHV, KTPVLEIDGKQTHQS, PAYFKMNSPSLWKYN, or PKSMLLNIFTNNLGR, or a subsequence, portion, homologue, variant or derivative thereof.

[0060] In other embodiments of the invention, a Cockroach protein or peptide described herein includes, consists or consists essentially of an amino acid sequence set forth as (SEQ ID NOs.: 1-23): TIPYYTKKFDEVVKA, ISDFRAAIANYHYDA, YFVAILDYLNHMAKE, VAISRYLGKQFGLSG, MIVDTISDFRAAIAN, DLVANQPNLKALREK, HDDRLGFLTFCPTNL, KNRTTIRGRTKFEGN, DRKMYWQFKMDKIQI, ALREKVLGLPAIKAW, IRGRTKFEGNKFTID, NDIEKRVPFSHDDRL, HMAKEDLVANQPNLK, VLEKLEAGFAKLAAS, NYAIVEGCPAAANGH, GIRIYVDVVLNQMSG, RWRQIFNMVGFRNAV, NIACLLHNKYDSTKS, NGGYLAAGKLTWADF, LNIFTNNLGRINTHV, KTPVLEIDGKQTHQS, PAYFKMNSPSLWKYN, or PKSMLLNIFTNNLGR.

[0061] In other embodiments, a Cockroach protein or peptide described herein includes, consists or consists essentially of a subsequence, portion, homologue, variant or derivative of an amino acid sequence set forth as (SEQ ID NOs.: 1-23): TIPYYTKKFDEVVKA, ISDFRAAIANYHYDA, YFVAILDYLNHMAKE, VAISRYLGKQFGLSG, MIVDTISDFRAAIAN, DLVANQPNLKALREK, HDDRLGFLTFCPTNL, KNRTTIRGRTKFEGN, DRKMYWQFKMDKIQI, ALREKVLGLPAIKAW, IRGRTKFEGNKFTID, NDIEKRVPFSHDDRL, HMAKEDLVANQPNLK, VLEKLEAGFAKLAAS, NYAIVEGCPAAANGH, GIRIYVDVVLNQMSG, RWRQIFNMVGFRNAV, NIACLLHNKYDSTKS, NGGYLAAGKLTWADF, LNIFTNNLGRINTHV, KTPVLEIDGKQTHQS, PAYFKMNSPSLWKYN, or PKSMLLNIFTNNLGR.

[0062] In further embodiments, a Cockroach protein or peptide described herein includes, consists or consists essentially of a Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin or aNBGA protein (such as NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16), e.g. a Cockroach allergen/antigen set forth in Table 5.

[0063] In certain embodiments, a Cockroach protein, peptide, subsequence, portion, homologue, variant or derivative thereof, includes, consists of or consists essentially of an amino acid sequence of a portion of a Cockroach allergen protein or peptide enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11.

[0064] The foregoing and other Cockroach proteins and peptides set forth herein may be used in the methods and uses and medicaments, including but not limited to methods and uses and medicaments disclosed herein.

[0065] In particular embodiments, a protein or peptide includes, consists of or consists essentially of a Cockroach protein or peptide set forth in any of Tables 5-8, or a subsequence, portion, homologue, variant or derivative thereof, or a protein or peptide set forth in Tables 5 or 6, or a subsequence, portion, homologue, variant or derivative thereof. Said homologues may have at least 65%, 70, 75, 80, 85, 90 or 95% homology or identity to the corresponding Cockroach protein or peptide. Such subsequences may be 7 to 30 amino acids in length, and optionally further where at least 7 amino acids has at least 75%, or at least 80%, 85%, 90% identity or homology to at least 7 contiguous amino acids of the corresponding Cockroach protein or peptide. Moreover, a subsequence may be 7 to 25 amino acids in length, such as 7 to 20; 8 to 30; 8 to 25; 8 to 20; 9 to 30; 9 to 25; 9 to 20; 10 to 30; 10 to 25; 10 to 30 amino acids in length and wherein at least 8, such as at least 9, 10, 11, 12, 13, 14 or 15 amino acids of the subsequence has at least 75%, such as at least 80%, 85%, 90% identity or homology to at least 8, such as at least 9, 10, 11, 12, 13, 14 or 15 amino acids, respectively, contiguous amino acids of said corresponding Cockroach protein or peptide.

[0066] A variant of a Cockroach protein or peptide, such as a protein or peptide set forth in any of Tables 5-8 may be a longer peptide, for example, of up to 30 amino acids in length and which includes a corresponding protein or peptide as set forth in any of Tables 5-8. A variant may also include a peptide of 7 to 30 amino acids in length and which includes a subsequence of at least 7 amino acids having at least 75% identity or homology, such as at least 80 or 85% identity or homology, to at least 7 contiguous amino acids of the corresponding amino acid sequence of a protein or peptides set forth in any of Tables 5-8. A longer variant peptide may be up to 25 amino acids in length, such as up to 24, 23, 22, 21, 20, 19 or 18 amino acids in length. The variant may be a peptide of 7 to 25 amino acids in length, such as 7 to 20; 8 to 30; 8 to 25; 8 to 20; 9 to 30; 9 to 25; 9 to 20; 10 to 30; 10 to 25; 10 to 30 amino acids in length and wherein said subsequence is of at least 8, 9 or 10 amino acids having at least 75% (such as at least 80% or 85%) identity or homology to at least 8, 9 or 10 contiguous amino acids, respectively, of said corresponding protein or peptide set forth in any of Tables 5-8.

[0067] As used herein, an antigen refers to a substance, including but not limited to a protein or peptide that elicits, induces, stimulates, promotes or enhances an immune response when administered to a subject. An immune response elicited by an antigen may include, but is not limited to, a B cell or a T cell response. An immune response can include a cellular response with a particular pattern of lymphokine/cytokine production (e.g., Th1, Th2), a humoral response (e.g., antibody production), or a combination thereof, to a particular antigen. For example, if a subject previously exposed to an allergen (i.e., is sensitized or is hypersensitive) comes into contact with the allergen again, allergic asthma may develop due to a Th2 response characterized by an increased production of type 2 cytokines (e.g., IL-4, IL-5, IL-9, and/or IL-13) secreted by CD4+ T lymphocytes.

[0068] As used herein an epitope refers to a region or part of an antigen that elicits an immune response when administered to a subject. In particular embodiments, an epitope may be comprised of a region or part of a Cockroach protein or peptide (e.g, of all or a part of an amino acid sequence of a Cockroach protein or peptide set forth in any of Tables 5-8. In more particular embodiments, an epitope may be comprised of a region or part of a Cockroach protein or peptide set forth in any of Table 5 or 6, or a protein or peptide set forth in Table 5. In particular aspects, an epitope is a T cell epitope, i.e., an epitope that elicits, stimulates, induces, promotes, increases or enhances a T cell activity, function or response.

[0069] An antigen, epitope, allergen, or composition thereof can modulate an undesired or abnormal inflammatory response. An antigen, epitope, allergen, or composition thereof as described herein may alter the Th2 response by, for example, shifting the immune response toward a Th1 phenotype that is less damaging. That is, an altered (or modulated) immune response can decrease, inhibit, suppress, or reduce sensitivity (desensitize) to an antigen, epitope, or allergen, or against inflammatory responses (e.g., allergy, asthma, rash, wheezing, coughing, eye irritation, etc.) caused by an antigen, epitope, or allergen (e.g., a Cockroach protein or peptide set forth in any of Tables 5-8), or a protein or peptide set forth in Tables 5 or 6 or Table 5).

[0070] Accordingly, non-limiting examples of antigens and allergens are peptides and proteins having defined amino acid sequences and which comprise T cell epitopes, i.e., elicit, stimulate, induce, promote, increase or enhance a T cell response or activity. Antigens and allergens can be analyzed to determine whether they include at least one T cell epitope using any number of assays (e.g. T cell proliferation assays, lymphokine secretion assays, T cell non-responsiveness studies, etc.).

[0071] The term allergen refers to an antigen which elicits, induces, stimulates, or enhances an immune response by a cell or the immune system of an exposed animal (e.g., human). An antigen is an allergen when the specific immune response is the development of enhanced sensitivity or a hypersensitivity to the antigen, but the antigen itself is not typically innately harmful. An allergen is therefore a particular type of antigen that can cause development of enhanced or increased sensitivity or hypersensitivity in a subject. For example, an allergen can elicit production of IgE antibodies in predisposed subjects. However, as disclosed herein an allergen need not elicit production of IgE antibodies. Other examples of responses elicited by allergens include T cell responses or activity, such as production of a lymphokine, cytokine, or effector function on other cells. Responses caused by allergens are also described, for example, in Mol. Biol. of Allergy and Immunology, ed. R. Bush, Immunology and Allergy Clinics of North American Series (August 1996). Although the terms allergen and antigen have a different meaning, reference to allergen herein includes reference to antigen and reference to antigen herein includes reference to allergen.

[0072] Typically, allergens are organic substances, such as proteins, peptides, nucleotides, carbohydrates, lipids, fats, nucleic acid, and combinations or mixtures thereof. Allergen(s) as used herein include, but are not limited to a specific allergen protein, mixture of allergen proteins, an extract of an allergen, chemically or genetically manufactured allergen, or any combination thereof (e.g., a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16) or a protein or peptide set forth in Tables 5-8, Tables 5 or 6, or Table 5. Particular examples include a Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, or a NBGA (such as NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16).

[0073] In certain embodiments, proteins, peptides, subsequences, portions, homologues, variants and derivatives thereof, described herein (e.g., a Cockroach protein or peptide set forth in any of Tables 5-8, or a protein or peptide set forth in Tables 5 or 6 stimulate, induce, promote, increase or enhance an immune response. In particular embodiments, a protein or peptide is a T cell antigen, allergen or epitope. In additional particular embodiments, a protein or peptide, a subsequence, portion, homologue, variant or derivative thereof, elicit, stimulate, promote, induce or enhance a T cell response, which may include but is not limited to a Th2 cell response. In further particular embodiments, a Cockroach protein or peptide, a subsequence, portion, homologue, variant or derivative thereof, modulates, inhibits, or reduces T cell response, which may include but is not limited to a Th2 cell response. In certain embodiments, a T cell response is an anti-allergen immune response, including but not limited to an anti-Cockroach allergen immune response.

[0074] As used herein, the term immune response includes T cell (cellular) mediated and/or B cell (humoral) mediated immune responses, or both cellular and humoral responses. Exemplary immune responses include T cell responses, e.g., lymphokine production, cytokine production and cellular cytotoxicity. T-cell responses include Th1 and/or Th2 responses. In addition, the term immune response includes responses that are indirectly effected by T cell activation, e.g., antibody production (humoral responses) and activation of cytokine responsive cells, e.g., eosinophils, macrophages. Immune cells involved in the immune response include lymphocytes, such as T cells (CD4+, CD8+, Th1 and Th2 cells, memory T cells) and B cells; antigen presenting cells (e.g., professional antigen presenting cells such as dendritic cells, macrophages, B lymphocytes, Langerhans cells, and non-professional antigen presenting cells such as keratinocytes, endothelial cells, astrocytes, fibroblasts, oligodendrocytes); natural killer (NK) cells; myeloid cells, such as macrophages, eosinophils, mast cells, basophils, and granulocytes.

[0075] As set forth herein, a particular immunoglobulin (Ig) isotype may be produced in response to an antigen (allergen). For example, an IgG antigen refers to an antigen that induces an IgG antibody response. Likewise, an IgE antigen refers to an antigen that induces an IgE antibody response; an IgA antigen refers to an antigen that induces an IgA antibody response, and so forth. In certain embodiments, such an immunoglobulin (Ig) isotype produced in response to an antigen may also elicit production of other isotypes. For example, an IgG antigen may induce an IgG antibody response in combination with one more of an IgE, IgA, IgM or IgD antibody response. Accordingly, in certain embodiments, an IgG antigen may induce an IgG antibody response without inducing an IgE, IgA, IgM or IgD antibody response.

[0076] The invention encompasses methods and uses and medicaments for reducing, decreasing, preventing the development of sensitization or hypersensitization to an antigen(s) or allergen(s), such as a Cockroach antigen or allergen. Accordingly, in other embodiments, a protein or peptide, subsequence, portion, homologue, variant or derivative thereof (e.g., a Cockroach protein or peptide set forth in any of Tables 5-8, or a protein or peptide set forth in Tables 5 or 6 or Table 5, decreases, inhibits, suppresses or reduces a T cell response, which may include but is not limited to a Th2 cell response. In certain embodiments, the T cell response is an anti-Cockroach allergen immune response, such as a memory T cell response.

[0077] In accordance with another aspect of the invention there are provided a Cockroach protein or peptide, a subsequence, portion, homologue, variant or derivative thereof, wherein the protein or peptide elicits, stimulates, induces, promotes, increases or enhances an anti-allergen immune response. In another aspect, there are provided a Cockroach protein or peptide, subsequence, portion, homologue, variant or derivative thereof, wherein the protein or peptide decreases, reduces, inhibits, suppresses or disrupts an anti-allergen immune response.

[0078] As will be understood by a person of skill in the art, a protein or a subsequence, portion, homologue, variant or derivative thereof as described herein (e.g., Cockroach protein or peptide set forth in any of Tables 5-8) may elicit, stimulate, induce, promote, increase or enhance certain elements of an anti-allergen immune response while decreasing, reducing, inhibiting, suppressing or reducing other elements of the anti-allergen response, either contemporaneously or sequentially. In one non-limiting example, a protein or a subsequence, portion, homologue, variant or derivative thereof (e.g., Cockroach protein or peptide set forth in any of Tables 5-8) may elicit, stimulate, induce, promote, increase or enhance proliferation of regulatory T cells while decreasing, reducing, inhibiting, suppressing or reducing production of proinflammatory lymphokines/cytokines.

[0079] An anti-allergen, anti-protein, or anti-peptide immune response refers to an immune response that is particular or specific for the protein or peptide, e.g., allergen. In such instances, the response is specifically triggered (elicited, stimulated, increased, induced, or promoted) by the protein or peptide, e.g., allergen (e.g., a Cockroach protein or peptide set forth in any of Tables 5-8). Although an anti-allergen immune response is specifically triggered by a given allergen, the immune response itself can be characterized by general features of immune responses, such as T cell (cellular) and/or B cell (humoral) immune responses, as set forth herein.

[0080] As disclosed herein, a Cockroach protein, peptide, subsequence, portion, homologue, variant or derivative thereof, may elicit, stimulate, induce, promote, increase or enhance immunological tolerance to an antigen, including an allergen (e.g., Cockroach protein or peptide set forth in any of Tables 5-8). In certain embodiments, a Cockroach protein, peptide, subsequence, portion, homologue, variant or derivative thereof, described herein may elicit, stimulate, induce, promote, increase or enhance immunological tolerance to an allergen. Thus in certain embodiments a protein, peptide, subsequence, portion, homologue, variant or derivative thereof, described herein may be effective in use or treatment (e.g., therapeutic) of an allergic reaction or allergic immune response, including but not limited to an allergic response following a secondary or subsequent exposure of a subject to an antigen or allergen. In particular embodiments, immunological tolerance elicited, stimulated, induced, promoted, increased or enhanced from use or administration of a Cockroach protein, peptide, subsequence, portion, homologue, variant or derivative thereof, may involve modulation of T cell activity, including but not limited to CD4+ T cells, CD8+ T cells, Th1 cells, Th2 cells and regulatory T cells (Tregs), and memory T cells. For example, immunological tolerance elicited, stimulated, induced, promoted, increased or enhanced from use or administration of a Cockroach protein, peptide, subsequence, portion, homologue, variant or derivative thereof (e.g., Cockroach protein or peptide set forth in any of Tables 5-8)-inflammatory lymphokines/cytokines produced by T cells. Thus, in accordance with certain aspects of the invention, there are provided Cockroach proteins, peptides, subsequences, portions, homologues, variants and derivatives thereof, that elicit, stimulate, induce, promote, increase or enhance immunological tolerance to an antigen or allergen (e.g., a Cockroach protein or peptide).

[0081] Accordingly, methods and uses and medicaments of inducing immunological tolerance in a subject to an allergen are provided. In one embodiment, a method or use reduces occurrence, frequency, severity, progression, or duration of physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated an allergic response to the allergen in the subject. Thus, in various embodiments, inducing immunological tolerance can protect a subject against or treat a subject for an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen.

[0082] As disclosed herein, surprisingly Cockroach proteins and antigens that elicit Th2 immune responses are not a priori IgE reactive. Thus, there are provided methods and uses of providing specific immunotherapy to a subject, in which a subject is administered an amount of a Cockroach protein or peptide that is (or is not) an IgE, IgG, IgA, IgM or IgD reactive antigen. In a particular embodiment, a method or use includes administering to the subject an amount of a Cockroach protein or peptide that is not an IgE reactive antigen.

[0083] Also provided are methods and uses and medicaments of providing specific immunotherapy (SIT) to a subject. In one embodiment, a subject is administered an amount of a Cockroach protein or peptide (e.g., Cockroach protein or peptide set forth in any of Tables 5-8).

[0084] In certain embodiments of the invention methods and uses and medicaments, the allergen is a Cockroach protein or peptide (e.g., a Cockroach allergen such as Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16). In more particular embodiments, the allergen is an amino acid sequence of Cockroach protein or peptide set forth in any of Tables 5-8, or a subsequence, portion, homologue, variant or derivative thereof. In other non-limiting embodiments, the allergen includes, consists of or consists essentially of a Cockroach protein or peptide set forth in any of Tables 5-8.

[0085] An allergic reaction refers to a local or general reaction in a subject following contact with a specific antigen (e.g., allergen) to which the subject had been previously exposed and had become sensitized. The immunologic interaction of antigen (e.g., allergen) with sensitized lymphocytes (T cells) and/or antibody can give rise to inflammation and tissue damage. An allergy is an undesirable immune response or reaction that can therefore produce damage to self-tissues and cells, usually through inflammatory reactions.

[0086] One non-limiting example of an allergy is asthma. Asthma, which can be extrinsic or allergic asthma (also referred to as reactive airway disease), is an inflammatory disease of the lungs characterized by a generally reversible airway obstruction. Non-limiting features of allergic asthma include elevated concentrations of serum IgE, pulmonary eosinophilia, airway hyper-responsiveness, excessive airway mucus production, and airway remodeling marked by peribronchiolar collagen deposition and increases in airway smooth muscle mass. Other exemplary allergic reactions or inflammatory conditions include allergic alveolitis, allergic bronchopulmonary aspergillosis, allergic dermatitis, eczema, allergic conjunctivitis, allergic coryza, allergic vasculitis, rhinosinusitis, and allergic rhinitis.

[0087] Hypersensitivity or hyper-responsiveness used in reference to an immune response means an abnormal response or condition in which an antigen or allergen elicits an exaggerated immune response. For example, allergic asthma can result from repeated exposure to airborne allergens that trigger detrimental immunological responses, such as persistent inflammation in the bronchial wall, which can in turn cause structural and functional changes in the respiratory system. After allergen contact by sensitized subjects (i.e., those subjects that have already been exposed to the allergen), the immune response is dependent on CD4+ T lymphocytes that are skewed to a T helper (Th) 2 phenotype. Th2 cytokines, for example, IL-4, IL-5, IL-9, and IL-13 are produced and are believed to contribute to asthma pathogenesis. For example, IL-4 drives the T helper response in favor of Th2, resulting in enhanced production of IgE; IL-5, which with granulocyte macrophage colony stimulating factor (GM-CSF) and IL-3, is important for the production of eosinophils; and IL-13, which is required for airway hyper-responsiveness and mucous metaplasia, which are downstream pathophysiological features that are closely linked with clinical asthma. All of these cytokines have been implicated in airway remodeling. Increased numbers of airway eosinophils is also associated with disease severity, although the role of eosinophils in the pathology of asthma is not entirely understood, (see, e.g., Lee et al., Science 305:1773 (2004); Humbles et al., Science 305:1776 (2004)). The resulting structural and morphometric changes (remodeling) include subepithelial fibrosis, goblet cell hyperplasia and metaplasia, which result in functional consequences such as loss of distensibility of asthmatic airways, bronchial hyper-reactivity (even in the absence of the allergen), and an accelerated progressive decrease in forced expiratory volume at 1 second time intervals. Th2 cytokines may also prime and activate eosinophils to release proinflammatory agents, lipid mediators, and other cytokines thought to contribute to the observed tissue damage, remodeling, and hyper-responsiveness.

[0088] As used herein, the term tolerance, anergy, or antigen (allergen)-specific tolerance refers to a reduction, loss, inhibition, suppression or decrease, of T cells to T cell receptor-mediated stimulation by an allergen or antigen (e.g., a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8). The reduction can lead to reduced or non-responsiveness (insensitivity) of T cells to an allergen or antigen. Such insensitivity is generally antigen-specific and persists after exposure to the antigenic peptide has ceased. For example, tolerance in T cells is characterized by lack of lymphokine/cytokine production, e.g., IL-2, IFN-, or TNF-. T-cell anergy occurs when T cells are exposed to antigen or allergen and receive a first signal (a T cell receptor or CD-3 mediated signal) in the absence of a second signal (a costimulatory signal). Under these conditions, re-exposure of the cells to the same antigen or allergen (even if re-exposure occurs in the presence of a costimulatory molecule) results in failure to produce cytokines and subsequently failure of T cells to proliferate. Thus, a failure to produce lymphokines/cytokines prevents proliferation. Tolerized T cells can, however, proliferate if cultured with cytokines (e.g., IL-2). For example, T cell anergy can also be observed by the lack of IL-2 production by T lymphocytes as measured by ELISA or by a proliferation assay using an indicator cell line.

[0089] As used herein, the term immunological tolerance refers to a) a decreased or reduced level of a specific immunological response (thought to be mediated at least in part by antigen-specific effector T lymphocytes, B lymphocytes, antibody or a combination); b) a delay in the onset or progression of a specific immunological response; or c) a reduced risk of the onset or progression of a specific immunological response to an antigen or allergen (e.g., a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16 or a Cockroach protein or peptide set forth in any of Tables 5-8). Specific immunological tolerance occurs when tolerance is preferentially invoked against certain antigens (allergens) in comparison with other antigens (allergens). Tolerance is an active antigen dependent process and differs from non-specific immunosuppression and immunodeficiency.

[0090] An increase, improvement, enhancement or induction of tolerance refers to a decrease, reduction, inhibition, suppression, or limiting or controlling or clearing of specific immunological reactivity to an antigen (allergen) as compared to reactivity to the antigen in a previous exposure to the same antigen. Thus in certain embodiments, a method or use of inducing immunological tolerance in a subject to an allergen includes elimination of an allergic response of the subject to the allergen (e.g., a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8). Immunological tolerance in a subject to an allergen can also be reflected by reducing the occurrence, frequency, severity, progression, or duration of an allergic response of the subject to the antigen or allergen (e.g., a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8).

[0091] While desirably tolerance can refer to non-reactivity to an antigen or allergen, tolerance need not be complete non-reactivity and can only be partial, and in any event is reflected by a decrease, inhibition, suppression or reduction in specific immunological reactivity to an antigen or allergen as compared to reactivity to the antigen or allergen in a previous exposure to the same antigen or allergen (or epitope thereof). Thus, in another embodiment, a method or use of inducing immunological tolerance in a subject to an allergen includes stabilizing or maintaining the level of an allergic response in the subject to the allergen (e.g., a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8).

[0092] Induction of immune tolerance (also referred to as desensitization), and the relative amount of immune tolerance, can be measured by methods disclosed herein or known to the skilled artisan. For example, induction of immune tolerance can be measured by modulation of lymphokine and/or cytokine level in said animal. As such, modulation can be an increase of a cytokine level, for instance an increase of a cytokine level at least 1.5, 2, 3 times or more relative to before said induction. Alternatively, modulation can be a decrease of the level of a particular cytokine level, for instance a decrease of the cytokine level is at least 1.5, 2, 3 times or more relative to before said induction. The lymphokines/cytokines chosen to measure can be from any relevant lymphokines/cytokines, such as IL-2, IL-5, IL-4, IL-6, IL-10, IL-12, IL-13, TNF-, IFN-, IFN-, TGF-, MCP-1, RANK-L and Flt3L.

[0093] As disclosed herein, peptides and proteins of the invention are useful in methods and uses and medicaments, for example, of specific immunotherapy (SIT). The term specific immunotherapy refers to a therapy particular or specific for the protein or peptide, e.g., allergen (e.g., a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8). To achieve specific immunotherapy an antigen is administered to a subject in order to achieve immunological tolerance of the subject to an antigen, including for example, an allergen (e.g., a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8).

[0094] More particularly, specific immunotherapy may be conducted by administering an antigen derived from the antigen (e.g. allergen) against which immunological tolerance is sought. Alternatively, immunotherapy can be conducted by non-specific immunotherapy using a different antigen or protein than the antigen (allergen) against which immunological tolerance is sought. For example as described in US patent application publication US2012/0100164A1, which relates to the treatment of a hypersensitivity immune response, such as allergic rhinitis or asthma, via bystander suppression by use of an antigen unrelated to the allergen triggering the hypersensitivity immune response in an individual to be treated provided that the antigen is obtainable from the source material, e.g. a Cockroach antigen for treatment of an immune response to another Cockroach allergen (e.g. a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16).

[0095] Thus, in different embodiments, the Cockroach antigen administered and antigen (e.g. allergen) against which immunological tolerance is sought may be the same or a different Cockroach protein. In one embodiment, a method or use includes administering to a subject an amount of a Cockroach protein or peptide, or subsequence, portion, homologue, variant or derivative thereof sufficient to elicit, stimulate, induce, promote, increase, enhance or augment immunological tolerance to an allergen (e.g., a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8) in the subject. In one aspect, a Cockroach antigen is administered to a subject during specific immunotherapy to treat the subject for an allergic reaction to the same Cockroach antigen. In a different aspect, a Cockroach antigen is administered to a subject during specific immunotherapy to treat the subject for an allergic reaction to a different Cockroach antigen. In another embodiment, a method includes administering to a subject an amount of a nucleic acid encoding all or a portion (e.g., a T cell epitope) of a Cockroach protein or peptide, or subsequence, portion, homologue, variant or derivative thereof sufficient to elicit, stimulate, induce, promote, increase, enhance or augment immunological tolerance to an allergen (e.g., a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16)) in the subject. In various embodiments, a method or use of specific immunotherapy reduces, inhibits, suppresses or decreases sensitivity or (hyper)sensitivity to the protein or peptide, e.g., allergen, or elicits, stimulates, increases, induces, promotes or improves tolerance of the protein or peptide, e.g., allergen. Typically a subject is administered a protein or peptide, e.g., allergen, for example, via a subcutaneous injection.

[0096] Methods and uses include multi-dose regimens. For example, a method or use can begin with small doses of allergen or protein or peptide (e.g., a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8) and the doses are increased for repeated contact or administration.

[0097] A variant or derivative of an antigen (e.g., a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8), including an allergen as described herein, or a subsequence or portion of an antigen or allergen, include molecules that are structurally similar and functionally similar (e.g, of all or a part of an amino acid sequence in any of Tables 5-8). A variant, derivative or subsequence of antigen or allergen is functionally similar to the antigen or allergen sequence if the variant, derivative or subsequence is capable of eliciting a detectable or measurable immune response, even if it is a reduced immune response compared to the nonvariant/non-derived or native sequence, which may be determined using methods, including animal models and in vitro assays, described herein and know to one of skill in the art. For example, an immune response may be determined by quantitative and/or qualitative determination of lymphokine/cytokine production (e.g., by T cells), antibody production (including class and/or isotype), cellular mobilization, migration or motility, and optionally in vivo, such as an animal model of antigen/allergen immune responsiveness. An immune response of variant, derivative or subsequence of antigen or allergen compared to the non-variant/non-derivatized/native full length antigen or allergen may be ascertained by analysis of a particular measure (such as lymphokine/cytokine production, immunoglobulin production, cell mobilization, migration, motility, etc.) and may be greater, less than or comparable, e.g., within 5%, 10%, 15%, or 20% or 25% of the immune response of non-variant/non-derivatized/native full length antigen or allergen. For example, levels of Th1 lymphokines/cytokines, such as IFN- IL-2, and TNF- and Th2 cytokines, such as IL-4, IL-5, IL-9, IL-10, and IL-13, may be determined according to methods described herein or known to one of skill in the art.

[0098] As disclosed herein, proteins and peptides, or a subsequence, portion, homologue, variant or derivative thereof include those having all or at least partial sequence identity to one or more exemplary proteins and peptides, or a subsequence, portion, homologue, variant or derivative thereof (e.g., a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8). The term identity and identical and grammatical variations thereof, mean that two or more referenced entities are the same (e.g., peptides or polynucleotide molecules). Thus, where two proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof are identical, they have the same amino acid sequence. The identity can be over a defined area (region or domain) of the sequence. Areas, regions or domains of homology or identity mean that a portion of two or more referenced entities share homology or are the same.

[0099] Identity can be determined by comparing each position in aligned sequences. A degree of identity between amino acid sequences is a function of the number of identical or matching amino acids at positions shared by the sequences, i.e. over a specified region. Optimal alignment of sequences for comparisons of identity may be conducted using a variety of algorithms, as are known in the art, including the ClustalW program, available at http://clustalw.genome.ad.jp, the local homology algorithm of Smith and Waterman, 1981, Adv. Appl. Math 2: 482, the homology alignment algorithm of Needleman and Wunsch, 1970, J. Mol. Biol. 48:443, the search for similarity method of Pearson and Lipman, 1988, Proc. Natl. Acad. Sci. USA 85: 2444, and the computerized implementations of these algorithms (such as GAP, BESTFIT, FASTA and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, Madison, Wis., U.S.A.). Sequence identity may also be determined using the BLAST algorithm, described in Altschul et al., 1990, J. Mol. Biol. 215:403-10 (using the published default settings). Software for performing BLAST analysis may be available through the National Center for Biotechnology Information (through the internet at http://www.ncbi.nlm.nih.gov/). Such algorithms that calculate percent sequence identity (homology) generally account for sequence gaps and mismatches over the comparison region or area. For example, a BLAST (e.g., BLAST 2.0) search algorithm (see, e.g., Altschul et al., J. Mol. Biol. 215:403 (1990), publicly available through NCBI) has exemplary search parameters as follows: Mismatch 2; gap open 5; gap extension 2. For polypeptide sequence comparisons, a BLASTP algorithm is typically used in combination with a scoring matrix, such as PAM100, PAM 250, BLOSUM 62 or BLOSUM 50. FASTA (e.g., FASTA2 and FASTA3) and SSEARCH sequence comparison programs are also used to quantitate the extent of identity (Pearson et al., Proc. Natl. Acad. Sci. USA 85:2444 (1988); Pearson, Methods Mol Biol. 132:185 (2000); and Smith et al., J. Mol. Biol. 147:195 (1981)). Programs for quantitating protein structural similarity using Delaunay-based topological mapping have also been developed (Bostick et al., Biochem Biophys Res Commun. 304:320 (2003)).

[0100] As described herein, Cockroach proteins and peptides include homologues of Cockroach proteins and peptides (e.g., of all or a part of any amino acid sequence of any protein or peptide in any of Tables 5-8). A polypeptide sequence or polynucleotide sequence is a homologue of, or is homologous to, another sequence if the two sequences have substantial identity over a specified region and a functional activity of the sequences is preserved or conserved, at least in part (as used herein, the term homologous does not infer nor exclude evolutionary relatedness).

[0101] Accordingly, in particular embodiments, methods and uses and medicaments of the invention include homologues of peptides and proteins from non-Cockroach allergens, including for example other antigens and allergens, such as non-Cockroach proteins and peptides considered to be homologues as set forth herein (e.g., a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8). Thus, as a non-limiting example, peptide and protein homologues from non-Cockroach antigens or allergens may be administered or used to modulate immune activity or immune response against a Cockroach allergen or antigen or to treat an allergic reaction, allergic response, allergic disorder or allergic disease associated with a Cockroach allergen or antigen. As another non-limiting example, peptide and protein homologues from non-Cockroach antigens or allergens may be administered or used to modulate immune activity or immune response against a non-Cockroach allergen or antigen or to treat an allergic reaction, allergic response, allergic disorder or allergic disease associated with a non-Cockroach allergen or antigen.

[0102] Two polypeptide sequences or polynucleotide sequences are considered to be substantially identical if, when optimally aligned (with gaps permitted), they share at least about 40% sequence identity or greater (e.g. 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, etc. identify over a specific region), for example, over all or a part of any Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8, or if the sequences share defined functional motifs (e.g., epitopes). The percent identity can extend over the entire sequence length or a portion of the sequence (e.g., over all or a part of any amino acid sequence in any protein or peptide set forth in any of Tables 5-8. In particular aspects, the length of the sequence sharing the percent identity is 2, 3, 4, 5 or more contiguous amino acids, e.g., 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, etc. contiguous amino acids (e.g., over all or a part of any amino acid sequence in any protein or peptide set forth in any of Tables 5-8). In additional particular aspects, the length of the sequence sharing the percent identity is 20 or more contiguous amino acids, e.g., 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, etc. contiguous amino acids (e.g., over all or a part of any amino acid sequence in any Cockroach protein or peptide set forth in any of Tables 5-8). In further particular aspects, the length of the sequence sharing the percent identity is 35 or more contiguous amino acids, e.g., 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 45, 47, 48, 49, 50, etc., contiguous amino acids (e.g., over all or a part of any amino acid sequence in any Cockroach protein or peptide set forth in any of Tables 5-8). In yet further particular aspects, the length of the sequence sharing the percent identity is 50 or more contiguous amino acids, e.g., 50-55, 55-60, 60-65, 65-70, 70-75, 75-80, 80-85, 85-90, 90-95, 95-100, etc. contiguous amino acids (e.g., over all or a part of any amino acid sequence in any Cockroach protein or peptide set forth in any of Tables 5-8).

[0103] An unrelated or non-homologous sequence shares less than 30% identity. More particularly, shares less than about 25% identity, with a protein, peptide or polynucleotide of the invention over a specified region of homology.

[0104] A variant or derivative of a protein or peptide refers to a modified or variant form of the protein or peptide, or subsequence, portion or homologue thereof (e.g., over all or a part of any Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8). Such modified forms, such as amino acid deletions, additions and substitutions, of the proteins and peptides can also be used in the invention uses, methods and compositions, including methods for modulating an immune response, eliciting, stimulating, inducing, promoting, increasing, or enhancing immunological tolerance and protecting and treating subjects against an allergic reaction or response, as set forth herein.

[0105] Thus, in accordance with the invention, modified, variant and derivative forms of proteins and peptides, subsequences, portions, and homologues thereof (e.g., of a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8) are provided that have one or more functions or activities of unmodified, non-variant and non-derivatized forms of proteins and peptides. Such forms, referred to as modifications, variants or derivatives and grammatical variations thereof deviate from a reference sequence. For example, as described herein, a protein, peptide, subsequence, portion, or homologue thereof may comprise, consist or consist essentially of an amino acid sequence that is a modification, variant, or derivative of a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8. Such modifications, variants, or derivatives may have greater or less activity or function than a reference protein or peptide, such as ability to elicit, stimulate, induce, promote, increase, enhance, activate, modulate, inhibit, decreases, suppress, or reduce an immune response (e.g. a T cell response) or elicit, stimulate, induce, promote, increase or enhance immunological tolerance (desensitize) to an antigen or allergen. Thus, proteins, peptides, or subsequences, portions or homologues thereof include sequences having substantially the same, greater or less relative activity or function as a reference antigen or allergen (e.g., any Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8) for example, an ability to elicit, stimulate, induce, promote, increase, enhance, activate, modulate, inhibit, suppress, decrease or reduce an immune response (e.g. a T cell response) or elicit, stimulate, induce, promote, increase or enhance immunological tolerance to an antigen or allergen in vitro or in vivo.

[0106] A variant or derivative therefore includes deletions, including truncations and fragments; insertions and additions, including tagged polypeptides and fusion proteins; substitutions, for example conservative substitutions, site-directed mutants and allelic variants; and modifications, including peptoids having one or more non-amino acyl groups (q.v., sugar, lipid, etc.) covalently linked to the peptide and post-translational modifications.

[0107] Non-limiting examples of modifications include one or more amino acid substitutions (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 20-25, 25-30, 30-50, 50-100, or more residues), additions and insertions (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 20-25, 25-30, 30-50, 50-100, or more residues) and deletions (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 20-25, 25-30, 30-50, 50-100) of a reference protein, peptide, or subsequence or portion thereof (e.g., over all or a part of any amino acid sequence in any protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8). In particular embodiments, a modified or variant sequence retains at least part of a function or an activity of unmodified sequence, and can have less than, comparable, or greater, but at least a part of, a function or activity of a reference sequence, for example, the ability elicit, stimulate, induce, promote, increase, enhance, activate, modulate, inhibit, suppress, decrease, or reduce an immune response (e.g. a T cell response) or elicit, stimulate, induce, promote, increase or enhance immunological tolerance to an allergen. Such immune responses include, for example, among others, induced, increased, enhanced, stimulated, activated, modulated, inhibited, suppressed, decreased or reduced expression, production or activity of a cytokine (e.g., IL-5, etc.), an antibody (e.g. increase production of IgG antibodies, decrease production of IgE) or an immune cell (e.g. CD4+ T cell, CD8+ T cell, Th1 cell, Th2 cell or regulatory T cell).

[0108] Variants and derivatives of proteins and peptides include naturally-occurring polymorphisms or allelic variants, strain variants, as well as synthetic proteins and peptides that contain a limited number of conservative amino acid substitutions of the amino acid sequence. A variety of criteria can be used to indicate whether amino acids at a particular position in a protein or peptide are similar. In making such changes, substitutions of like amino acid residues can be made on the basis of relative similarity of side-chain substituents, for example, their size, charge, hydrophobicity, hydrophilicity, and the like, and such substitutions may be assayed for their effect on the function of the peptide by routine testing.

[0109] Specific non-limiting examples of substitutions include conservative and non-conservative amino acid substitutions. A conservative substitution is the replacement of one amino acid by a biologically, chemically or structurally similar residue. Biologically similar means that the substitution does not destroy a biological activity. Structurally similar means that the amino acids have side chains with similar length, such as alanine, glycine and serine, or a similar size. Chemical similarity means that the residues have the same charge, or are both hydrophilic or hydrophobic. For example, a conservative amino acid substitution is one in which an amino acid residue is replaced with an amino acid residue having a similar side chain, which include amino acids with basic side chains (e.g., lysine, arginine, histidine); acidic side chains (e.g., aspartic acid, glutamic acid); uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, histidine); nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan); beta-branched side chains (e.g., threonine, valine, isoleucine), and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan). Particular examples include the substitution of one hydrophobic residue, such as isoleucine, valine, leucine or methionine for another, or the substitution of one polar residue for another, such as the substitution of arginine for lysine, glutamic for aspartic acids, or glutamine for asparagine, serine for threonine, and the like. Proline, which is considered more difficult to classify, shares properties with amino acids that have aliphatic side chains (e.g., Leu, Val, Ile, and Ala). In certain circumstances, substitution of glutamine for glutamic acid or asparagine for aspartic acid may be considered a similar substitution in that glutamine and asparagine are amide derivatives of glutamic acid and aspartic acid, respectively. Conservative changes can also include the substitution of a chemically derivatized moiety for a non-derivatized residue, for example, by reaction of a functional side group of an amino acid. Variants and derivatives of proteins and peptides include forms having a limited number of one or more substituted residues.

[0110] An addition can be a covalent or non-covalent attachment of any type of molecule. Specific examples of additions include glycosylation, acetylation, phosphorylation, amidation, formylation, ubiquitination, and derivatization by protecting/blocking groups and any of numerous chemical modifications. Additional specific non-limiting examples of an addition are one or more additional amino acid residues. Accordingly, proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, can be a part of or contained within a larger molecule, such as another protein or peptide sequence, such as a fusion or chimera with a different (distinct) sequence.

[0111] In particular embodiments, an addition is a fusion (chimeric) sequence, an amino acid sequence having one or more molecules not normally present in a reference native (wild type) sequence covalently attached to the sequence. The term chimeric and grammatical variations thereof, when used in reference to a sequence, means that the sequence contains one or more portions that are derived from, obtained or isolated from, or based upon other physical or chemical entities. For example, a chimera of two or more different proteins may have one part a protein, peptide, subsequence, portion, homologue or variant thereof, and a second part of the chimera may be from a different sequence, or unrelated protein sequence.

[0112] Another particular example of a sequence having an amino acid addition is one in which a second heterologous sequence, i.e., heterologous functional domain is attached (covalent or non-covalent binding) that confers a distinct or complementary function. Heterologous functional domains are not restricted to amino acid residues. Thus, a heterologous functional domain can consist of any of a variety of different types of small or large functional moieties. Such moieties include nucleic acid, peptide, carbohydrate, lipid or small organic compounds, such as a drug (e.g., an antiviral), a metal (gold, silver), and radioisotope. For example, a tag such as T7 or polyhistidine can be attached in order to facilitate purification or detection of a protein, peptide, etc. Accordingly, there are provided proteins, peptides, subsequences, portions and homologues thereof (e.g., a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or set forth in any of Tables 5-8), and a heterologous domain, wherein the heterologous functional domain confers a distinct function on the protein, peptide, subsequence, portion or homologue thereof.

[0113] Linkers, such as amino acid or peptidomimetic sequences may be inserted between the sequence and the addition (e.g., heterologous functional domain) so that the two entities maintain, at least in part, a distinct function or activity. Linkers may have one or more properties that include a flexible conformation, an inability to form an ordered secondary structure or a hydrophobic or charged character, which could promote or interact with either domain. Amino acids typically found in flexible protein regions include Gly, Asn and Ser. Other near neutral amino acids, such as Thr and Ala, may also be used in the linker sequence. The length of the linker sequence may vary without significantly affecting a function or activity of the fusion protein (see, e.g., U.S. Pat. No. 6,087,329). Linkers further include chemical moieties and conjugating agents, such as sulfo-succinimidyl derivatives (sulfo-SMCC, sulfo-SMPB), disuccinimidyl suberate (DSS), disuccinimidyl glutarate (DSG) and disuccinimidyl tartrate (DST).

[0114] Further non-limiting examples of additions are detectable labels. Thus, in another embodiment, the invention provides proteins, peptides, subsequences, portions and homologues thereof, that are detectably labeled. Specific examples of detectable labels include fluorophores, chromophores, radioactive isotopes (e.g., S.sup.35, P.sup.32, I.sup.125), electron-dense reagents, enzymes, ligands and receptors. Enzymes are typically detected by their activity. For example, horseradish peroxidase is usually detected by its ability to convert a substrate such as 3,3-,5,5--tetramethylbenzidine (TMB) to a blue pigment, which can be quantified.

[0115] Another non-limiting example of an addition is an insertion of an amino acid within any protein, peptide, subsequence, portion or homologue thereof (e.g., any protein or sequence set forth herein, such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8). In particular embodiments, an insertion is of one or more amino acid residues inserted into the amino acid sequence of a protein or peptide, or subsequence, portion or homologue thereof, such as any Cockroach protein or peptide, such as Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8.

[0116] Modified and variant proteins, peptides, subsequences, portions or homologues thereof also include one or more D-amino acids substituted for L-amino acids (and mixtures thereof), structural and functional analogues, for example, peptidomimetics having synthetic or non-natural amino acids or amino acid analogues and derivatized forms. Modifications include cyclic structures such as an end-to-end amide bond between the amino and carboxy-terminus of the molecule or intra- or inter-molecular disulfide bond. Proteins, peptides, subsequences, portions and homologues thereof may be modified in vitro or in vivo, e.g., post-translationally modified to include, for example, sugar residues, phosphate groups, ubiquitin, fatty acids, lipids, etc.

[0117] Specific non-limiting examples of modified and variant proteins, peptides, subsequences, portions and homologues thereof include proteins or peptides comprising, consisting or consisting essentially of an amino acid sequence comprising at least one amino acid deletion from a full length Cockroach protein or amino acid sequence such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8. In particular embodiments, a protein, peptide, or subsequence, portion or homologue thereof is from about 2 to up to one amino acid less than the full length protein sequence. In additional particular embodiments, a protein subsequence or portion is from about 2 to 5, 5 to 10, 10 to 15, 15 to 20, 20 to 25, 25 to 50, 50 to 100 amino acids in length, provided that said subsequence or portion is at least one amino acid less in length than the full-length protein sequence.

[0118] The term subsequence or portion means a fragment or part of the full length molecule. A subsequence or portion therefore consists of one or more amino acids less than the full length protein or peptide. A subsequence or portion can have one or more amino acids less than the full length protein or peptide internally or terminal amino acid deletions from either amino or carboxy-termini. Subsequences and portions can vary in size. For example, a subsequence or portion of a protein or peptide can be as small as an epitope capable of binding an antibody (i.e., about five amino acids) up to a polypeptide that is one amino acid less than the entire length of a reference protein or peptide.

[0119] As used herein, subsequences and portions may also include or consist of one or more amino acid additions or deletions, wherein the subsequence or portion does not comprise the full length native/wild type protein or peptide sequence. Accordingly, total subsequence or portion lengths can be greater than the length of the full length native/wild type protein or peptide, for example, where a protein or peptide subsequence is fused or forms a chimera with another polypeptide.

[0120] The invention provides isolated and/or purified proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof. In particular embodiments, isolated and/or purified proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, comprise, consist of or consist essentially of an amino acid sequence of a Cockroach protein or sequence set forth herein. In particular embodiments, the isolated and/or purified proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof include a T cell epitope (e.g., Th2 cell epitope).

[0121] The term isolated, when used as a modifier of a composition, means that the compositions are made by the hand of man or are separated, completely or at least in part, from their naturally occurring in vivo environment. Generally, isolated compositions are substantially free of one or more materials with which they normally associate with in nature, for example, one or more protein, nucleic acid, lipid, carbohydrate, cell membrane. The term isolated does not exclude alternative physical forms of the composition, such as fusions/chimeras, multimers/oligomers, modifications (e.g., phosphorylation, glycosylation, lipidation) or derivatized forms, or forms expressed in host cells produced by the hand of man.

[0122] An isolated composition (e.g., proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, for example, of any Cockroach protein or sequence set forth herein, or a Cockroach protein or peptide set forth in any of Tables 5-8 can also be substantially pure or purified when free of most or all of the materials with which it typically associates with in nature. Thus, an isolated protein, peptide, subsequence, portion, homologue, variant or derivative thereof, that also is substantially pure or purified does not include polypeptides or polynucleotides present among millions of other sequences, such as peptides of an peptide library or nucleic acids in a genomic or cDNA library, for example.

[0123] A substantially pure or purified composition can be combined with one or more other molecules. Thus, substantially pure or purified does not exclude combinations of compositions, such as combinations of proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof (e.g., multiple proteins, peptides, subsequences, etc.), and other antigens, agents, drugs or therapies.

[0124] Proteins and peptide (e.g., antigens and allergens) can be prepared recombinantly, chemically synthesized, isolated from a biological material or source, and optionally modified, or any combination thereof. A biological material or source would include an organism that produced or possessed any proteins or peptide (e.g., antigen or allergen) set forth herein (e.g., a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA5, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8). A biological material or source may further refer to a preparation in which the morphological integrity or physical state has been altered, modified or disrupted, for example, by dissection, dissociation, solubilization, fractionation, homogenization, biochemical or chemical extraction, pulverization, lyophilization, sonication or any other means of manipulating or processing a biological source or material. Subsequences, variants, homologues and derivatives can be prepared, for example, by substituting, deleting or adding one or more amino acid residues in the amino acid sequence of a protein, peptide, subsequence, portion or homologue thereof, and screening for biological activity, for example eliciting an immune response. A skilled person will understand how to make such derivatives or variants, using standard molecular biology techniques and methods, described for example in Sambrook et al. (2001) Molecular Cloning: a Laboratory Manual, 3.sup.rd ed., Cold Spring Harbour Laboratory Press).

[0125] The invention also provides protein or peptide (e.g., proteins, peptides, a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8), immobilized on or attached to a substrate. The protein or peptide may comprise proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, for example, of any Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or any Cockroach protein or peptide set forth in any of Tables 5-8 can optionally have a unique or distinct position or address on the substrate.

[0126] Substrates to which protein or peptide (e.g., proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, for example, of any Cockroach allergen such as a protein or peptide of Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, or a Cockroach protein or peptide set forth in any of Tables 5-8 or subsequences, portions, homologues, variants or derivatives thereof, can be immobilized or attached include essentially any physical entity such as a two dimensional surface that is permeable, semi-permeable or impermeable, either rigid or pliable and capable of either storing, binding to or having attached thereto or impregnated.

[0127] Substrates include dry solid medium (e.g., cellulose, polyester, nylon, or mixtures thereof etc.), such as glass, silica, plastic, polyethylene, polystyrene, polypropylene, polyacetate, polycarbonate, polyimide, polyester, polyurethane, or polyvinylchloride. Substrates include structures having sections, compartments, wells, containers, vessels or tubes, separated from each other to avoid or prevent cross-contamination or mixing with each other or with other reagents. Multi-well plates, which typically contain 6, 12, 26, 48, 96, to 1000 wells, are one particular non-limiting example of such a structure.

[0128] Substrates also include supports used for two- or three-dimensional arrays of sequences. The sequences are typically attached to the surface of the substrate (e.g., via a covalent bond) at defined positions (locations or addresses). Substrates can include a number of sequences, for example, 1, 2, 3, 4, 5, 5 to 10, 10 to 15, 15 to 20, 20 to 25, 25 to 30, 30 to 35, 35 to 40, 40 to 45, 45 to 50, 50 to 75, 75 to 100, 100 to 150, 150 to 200, 200 to 250, 250 to 300, up to all proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, such as a Cockroach protein or peptide set forth in any of Tables 5-8. Such substrates, also referred to as arrays, can have any protein density; the greater the density the greater the number of sequences that can be screened on a given chip. Substrates that include a two- or three-dimensional array of sequences, and individual protein sequences therein, may be coded in accordance with the invention.

[0129] The invention also provides nucleic acids encoding proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, for example, of a Cockroach allergen, such as a protein or peptide of Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, or a Cockroach protein or peptide set forth in any of Tables 5-8. Such nucleic acid sequences encode a sequence at least 40% or more (e.g., 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%) identical to an exemplary protein, peptide, subsequence, portion, homologue, variant or derivative thereof. In an additional embodiment, a nucleic acid encodes a sequence having a modification, such as one or more amino acid additions (insertions), deletions or substitutions of protein, peptide, subsequence, portion, homologue, variant or derivative thereof, or a Cockroach protein or peptide set forth in any of Tables 5-8.

[0130] The terms nucleic acid, polynucleotide and polynucleotide and the like refer to at least two or more ribo- or deoxy-ribonucleic acid base pairs (nucleotides/nucleosides) that are linked through a phosphoester bond or equivalent. Nucleic acids include polynucleotides and polynucleotides. Nucleic acids include single, double or triplex, circular or linear, molecules. Exemplary nucleic acids include but are not limited to: RNA, DNA, cDNA, genomic nucleic acid, naturally occurring and non-naturally occurring nucleic acid, e.g., synthetic nucleic acid.

[0131] Nucleic acids can be of various lengths. Nucleic acid lengths typically range from about 20 bases to 20 Kilobases (Kb), or any numerical value or range within or encompassing such lengths, 10 bases to 10 Kb, 1 to 5 Kb or less, 1000 to about 500 bases or less in length. Nucleic acids can also be shorter, for example, 100 to about 500 bases, or from about 12 to 24, 24 to 45, 45 to 90, 90 to 250, or about 250 to 500 bases in length, or any numerical value or range or value within or encompassing such lengths. In particular aspects, a nucleic acid sequence has a length from about 10-20, 20-30, 30-50, 50-100, 100-150, 150-200, 200-250, 250-300, 300-400, 400-500, 500-1000, 1000-2000 bases, or any numerical value or range within or encompassing such lengths. Shorter nucleic acids are commonly referred to as oligonucleotides or probes of single- or double-stranded DNA. However, there is no upper limit to the length of such oligonucleotides.

[0132] Nucleic acid sequences further include nucleotide and nucleoside substitutions, additions and deletions, as well as derivatized forms and fusion/chimeric sequences (e.g., encoding recombinant polypeptide). For example, due to the degeneracy of the genetic code, nucleic acids include sequences and subsequences degenerate with respect to nucleic acids that encode proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, (e.g., substitutions, additions, insertions and deletions), for example, of a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8.

[0133] Nucleic acids can be produced using various standard cloning and chemical synthesis techniques. Techniques include, but are not limited to nucleic acid amplification, e.g., polymerase chain reaction (PCR), with genomic DNA or cDNA targets using primers (e.g., a degenerate primer mixture) capable of annealing to the encoding sequence. Nucleic acids can also be produced by chemical synthesis (e.g., solid phase phosphoramidite synthesis) or transcription from a gene. The sequences produced can then be translated in vitro, or cloned into a plasmid and propagated and then expressed in a cell (e.g., a host cell such as eukaryote or mammalian cell, yeast or bacteria, in an animal or in a plant).

[0134] Nucleic acid may be inserted into a nucleic acid construct in which expression of the nucleic acid is influenced or regulated by an expression control element. An expression control element refers to a nucleic acid sequence element that regulates or influences expression of a nucleic acid sequence to which it is operatively linked. Expression control elements include, as appropriate, promoters, enhancers, transcription terminators, gene silencers, a start codon (e.g., ATG) in front of a protein-encoding gene, etc.

[0135] An expression control element operatively linked to a nucleic acid sequence controls transcription and, as appropriate, translation of the nucleic acid sequence. Expression control elements include elements that activate transcription constitutively, that are inducible (i.e., require an external signal for activation), or derepressible (i.e., require a signal to turn transcription off; when the signal is no longer present, transcription is activated or derepressed), or specific for cell-types or tissues (i.e., tissue-specific control elements).

[0136] Nucleic acid can also be inserted into a plasmid for propagation into a host cell and for subsequent genetic manipulation. A plasmid is a nucleic acid that can be propagated in a host cell, plasmids may optionally contain expression control elements in order to drive expression of the nucleic acid encoding proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof in the host cell. A vector is used herein synonymously with a plasmid and may also include an expression control element for expression in a host cell (e.g., expression vector). Plasmids and vectors generally contain at least an origin of replication for propagation in a cell and a promoter. Plasmids and vectors are therefore useful for genetic manipulation and expression of proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, for example, a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8. Accordingly, vectors that include nucleic acids encoding or complementary to proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, for example, of a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8, are provided.

[0137] In accordance with the invention, there are provided particles (e.g., viral particles) and transformed host cells that express and/or are transformed with a nucleic acid that encodes and/or express proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, for example, of a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8. Particles and transformed host cells include but are not limited to virions, and prokaryotic and eukaryotic cells such as bacteria, fungi (yeast), plant, insect, and animal (e.g., mammalian, including primate and human, CHO cells and hybridomas) cells. For example, bacteria transformed with recombinant bacteriophage nucleic acid, plasmid nucleic acid or cosmid nucleic acid expression vectors; yeast transformed with recombinant yeast expression vectors; plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid); insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus); and animal cell systems infected with recombinant virus expression vectors (e.g., retroviruses, adenovirus, vaccinia virus), or transformed animal cell systems engineered for stable expression. The cells may be a primary cell isolate, cell culture (e.g., passaged, established or immortalized cell line), or part of a plurality of cells, or a tissue or organ ex vivo or in a subject (in vivo).

[0138] The term transformed or transfected when used in reference to a cell (e.g., a host cell) or organism, means a genetic change in a cell following incorporation of an exogenous molecule, for example, a protein or nucleic acid (e.g., a transgene) into the cell. Thus, a transfected or transformed cell is a cell into which, or a progeny thereof in which an exogenous molecule has been introduced by the hand of man, for example, by recombinant DNA techniques.

[0139] The nucleic acid or protein can be stably or transiently transfected or transformed (expressed) in the host cell and progeny thereof. The cell(s) can be propagated and the introduced protein expressed, or nucleic acid transcribed. A progeny of a transfected or transformed cell may not be identical to the parent cell, since there may be mutations that occur during replication.

[0140] Expression of proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof and nucleic acid in particles or introduction into target cells (e.g., host cells) can also be carried out by methods known in the art. Non-limiting examples include osmotic shock (e.g., calcium phosphate), electroporation, microinjection, cell fusion, etc. Introduction of nucleic acid and polypeptide in vitro, ex vivo and in vivo can also be accomplished using other techniques. For example, a polymeric substance, such as polyesters, polyamine acids, hydrogel, polyvinyl pyrrolidone, ethylene-vinylacetate, methylcellulose, carboxymethylcellulose, protamine sulfate, or lactide/glycolide copolymers, polylactide/glycolide copolymers, or ethylenevinylacetate copolymers. A nucleic acid can be entrapped in microcapsules prepared by coacervation techniques or by interfacial polymerization, for example, by the use of hydroxymethylcellulose or gelatin-microcapsules, or poly (methylmethacrolate) microcapsules, respectively, or in a colloid system. Colloidal dispersion systems include macromolecule complexes, nano-capsules, microspheres, beads, and lipid-based systems, including oil-in-water emulsions, micelles, mixed micelles, and liposomes.

[0141] Liposomes for introducing various compositions into cells are known in the art and include, for example, phosphatidylcholine, phosphatidylserine, lipofectin and DOTAP (e.g., U.S. Pat. Nos. 4,844,904, 5,000,959, 4,863,740, and 4,975,282; and GIBCO-BRL, Gaithersburg, Md.). Piperazine based amphilic cationic lipids useful for gene therapy also are known (see, e.g., U.S. Pat. No. 5,861,397). Cationic lipid systems also are known (see, e.g., U.S. Pat. No. 5,459,127). Polymeric substances, microcapsules and colloidal dispersion systems such as liposomes are collectively referred to herein as vesicles. Accordingly, viral and non-viral vector means delivery into cells are included.

[0142] Cockroach proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, for example, a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8, are provided, can be employed in various methods and uses and medicaments. Such methods and uses and medicaments include, for example, administration in vitro and in vivo of one or more proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, such as protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8, or subsequences, portions, homologues, variants or derivatives thereof.

[0143] The methods and uses and medicaments provided include methods and uses and medicaments for modulating an immune response, including, among others, methods and uses and medicaments for protecting and treating subjects against a disorder, disease; and methods and uses of and medicaments for providing specific immunotherapy; and methods and uses of detection and diagnosis.

[0144] In particular embodiments, methods and uses include administration or delivery of a protein, peptide, subsequence, portion, homologue, variants or derivative thereof described herein (e.g., of any Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8) to modulate an immune response in a subject, including, for example, modulating an immune response to an allergen or antigen.

[0145] As used herein, the term modulate, means an alteration or effect on the term modified. For example, the term modulate can be used in various contexts to refer to an alteration or effect of an activity, a function, or expression of a polypeptide, gene or signaling pathway, or a physiological condition or response of an organism. In certain embodiments, modulating involves decreasing, reducing, inhibiting, suppressing or disrupting an immune response of a subject to an antigen or allergen. In other embodiments, modulating involves eliciting, stimulating, inducing, promoting, increasing or enhancing an immune response of a subject to an antigen or allergen. Thus, where the term modulate is used to modify the term immune response against an allergen in a subject this means that the immune response in the subject to the allergen is altered or affected (e.g., decreased, reduced, inhibited, suppressed, limited, controlled, prevented, elicited, promoted, stimulated, increased, induced, enhanced, etc.).

[0146] Methods and uses and medicaments for modulating an immune response against an antigen or allergen as described herein may be used to provide a subject with protection against an allergic response or reaction to the allergen, or allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with the allergen. Accordingly, in other embodiments, methods and uses include administering a protein, peptide, subsequence, portion, homologue, variant or derivative thereof described herein (e.g., of any Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8) to protect or treat a subject against an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen. In still other embodiments, methods and uses include administering or delivering a protein, peptide, subsequence, portion, homologue, variant or derivative thereof described herein (e.g., of any Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8) to elicit, stimulate, induce, promote, increase or enhance immunological tolerance of a subject to an antigen or allergen.

[0147] In various embodiments, there are provided methods and uses of and medicaments for providing a subject with protection against an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen. In various aspects, a method or use includes administering to the subject an amount of a protein, peptide, subsequence, portion, homologue, variant or derivative thereof described herein (e.g., any Cockroach allergen such as a protein or peptide Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8) sufficient to provide the subject with protection against the allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with the allergen.

[0148] Methods and uses and medicaments of the invention include providing a subject with protection against an antigen or allergen, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with the exposure to the antigen or allergen, for example, vaccinating the subject to protect against an allergic response to the allergen, for example with any Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8. In certain embodiments, methods and uses include protecting the subject against an allergic response or reaction by inducing tolerance of the subject (desensitizing) to the allergen.

[0149] As used herein, the terms protection, protect and grammatical variations thereof, when used in reference to an allergic response or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with the exposure to allergen, means preventing an allergic response, reaction, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with the exposure to the allergen, or reducing or decreasing susceptibility to an allergic response, reaction, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with the exposure to the allergen.

[0150] An allergic response includes but is not limited to an allergic reaction, hypersensitivity, an inflammatory response or inflammation. In certain embodiments allergic response may involve one or more of cell infiltration, production of antibodies, production of cytokines, lymphokines, chemokines, interferons and interleukins, cell growth and maturation factors (e.g., differentiation factors), cell proliferation, cell differentiation, cell accumulation or migration (chemotaxis) and cell, tissue or organ damage or remodeling. In particular aspects, an allergic response may include Allergic rhinitis; Onchocercal dermatitis; Atopic dermatitis; allergic conjunctivitis; Drug reactions; Nodules, eosinophilia, rheumatism, dermatitis, rashes, hives, and swelling (NERDS); esophageal and a gastrointestinal allergy.

[0151] Allergic responses can occur systemically, or locally in any region, organ, tissue, or cell. In particular aspects, an allergic response occurs in the skin, the upper respiratory tract, the lower respiratory tract, pancreas, thymus, kidney, liver, spleen, muscle, nervous system, skeletal joints, eye, mucosal tissue, gut or bowel.

[0152] Methods and uses and medicaments herein include treating a subject for an allergic response, allergic disorder or allergic disease, as well as one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen. Such methods and uses include administering to a subject an amount of a protein, peptide, subsequence, portion, homologue, variant or derivative thereof described herein (e.g., any Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8) sufficient to treat the subject for the allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with the allergen.

[0153] As will be understood by a person skilled in the art, treating an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen may include decreasing, reducing, inhibiting, suppressing, limiting, controlling or clearing an allergic response, an allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with the allergen. Thus in certain embodiments, a method or use of treating a subject for a an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen comprises elimination of the allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with the allergen from a subject. In other embodiments, a method or use of treating a subject for an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen includes reducing occurrence, frequency, severity, progression, or duration of the allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with the allergen in the subject. In yet another embodiment, a method or use of treating a subject for an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen, includes stabilizing the allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with the allergen in a subject by preventing an increase in the occurrence, frequency, severity, progression, or duration of the allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with contact of the subject with an allergen.

[0154] Methods and uses and medicaments of the invention include treating or administering a subject previously exposed to an antigen or allergen. Thus, in certain embodiments, methods and uses and medicaments are for treating or protecting a subject from an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with secondary or subsequent exposure to an antigen or allergen.

[0155] Physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an antigen/allergen treatable in accordance with the invention methods and uses and medicaments include but are not limited to asthma, allergic asthma, bronchiolitis and pleuritis, Allergic rhinitis; Onchocercal dermatitis; Atopic dermatitis; allergic conjunctivitis; Drug reactions; Nodules, eosinophilia, rheumatism, dermatitis, rashes, hives, and swelling (NERDS); esophageal and a gastrointestinal allergy, Airway Obstruction, Apnea, Asbestosis, Atelectasis, Berylliosis, Bronchiectasis, Bronchiolitis, Bronchiolitis Obliterans Organizing Pneumonia, Bronchitis, Bronchopulmonary Dysplasia, Empyema, Pleural Empyema, Pleural Epiglottitis, Hemoptysis, Hypertension, Kartagener Syndrome, Meconium Aspiration, Pleural Effusion, Pleurisy, Pneumonia, Pneumothorax, Respiratory Distress Syndrome, Respiratory Hypersensitivity, Rhinoscleroma, Scimitar Syndrome, Severe Acute Respiratory Syndrome, Silicosis, Tracheal Stenosis, eosinophilic pleural effusions, Histiocytosis; chronic eosinophilic pneumonia; hypersensitivity pneumonitis; Allergic bronchopulmonary aspergillosis; Sarcoidosis; Idiopathic pulmonary fibrosis; pulmonary edema; pulmonary embolism; pulmonary emphysema; Pulmonary Hyperventilation; Pulmonary Alveolar Proteinosis; Chronic Obstructive Pulmonary Disease (COPD); Interstitial Lung Disease; and Topical eosinophilia.

[0156] Cockroach proteins, peptides, subsequences, portions, homologues, variants and derivatives thereof, described herein may elicit, stimulate, induce, promote, increase or enhance immunological tolerance to an antigen, including an allergen. Methods and uses and medicaments of the invention therefore further include inducing immunological tolerance of a subject to an antigen or allergen. Thus, for example, Cockroach proteins, peptides, subsequences, portions, homologues, variants and derivatives thereof, described herein can be effective in treatment (e.g., therapeutic) of an allergic immune response, including but not limited to an allergic immune response following a secondary or subsequent exposure of a subject to an antigen (allergen). In one embodiment, a method or use includes administering to the subject an amount of a protein, peptide, subsequence, portion, homologue, variant or derivative thereof described herein (e.g., any Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8) sufficient to induce tolerance in the subject to the antigen or allergen. In particular aspects, the immunological tolerance elicited, stimulated, induced, promoted, increased or enhanced may involve modulation of T cell activity, including but not limited to CD4+ T cells, CD8+ T cells, Th1 cells, Th2 cells and regulatory T cells. For example, immunological tolerance elicited, stimulated, induced, promoted, increased or enhanced from administration of the Cockroach proteins or peptides, or subsequence, portion, homologue, variant or derivative thereof, may involve modulation of the production or activity of pro-inflammatory or anti-inflammatory cytokines produced by T cells.

[0157] In additional embodiments, a method or use of inducing immunological tolerance in a subject to an allergen includes a reduction in occurrence, frequency, severity, progression, or duration of physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated an allergic response to the allergen in the subject. Thus, in certain embodiments, inducing immunological tolerance can protect a subject against or treat a subject for an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an antigen or allergen.

[0158] Methods and uses and medicaments for inducing immunological tolerance (desensitizing) described herein may include eliciting, stimulating, inducing, promoting, increasing or enhancing an immune response. In certain embodiments, inducing immunological tolerance may include eliciting, stimulating, inducing, promoting, increasing or enhancing an immune response that decreases, reduces, inhibits, suppresses, limits, controls or clears an allergic response. For example, in certain embodiments inducing immunological tolerance may include eliciting, stimulating, inducing, promoting, increasing or enhancing proliferation or activity of regulatory T cells. In other embodiments, inducing immunological tolerance may include eliciting, stimulating, inducing, promoting, increasing or enhancing an immune response that promotes an allergic response. As will be understood by a person of skill in the art, a method or use that elicits, stimulates, induces, promotes, increases or enhances an immune response that promotes an allergic response may still induce immunological tolerance by also eliciting, stimulating, inducing, promoting, increasing or enhancing an immune response that decreases, reduces, inhibits, suppresses, limits, controls or clears an allergic response. In particular embodiments, inducing immunological tolerance includes eliciting, stimulating, inducing, promoting, increasing or enhancing an immune responses that decreases, reduces, inhibits, suppresses, limits, controls or clears an allergic response that is stronger than the immune response that promotes an allergic response. In other embodiments, inducing immunological tolerance includes eliciting, stimulating, inducing, promoting, increasing or enhancing more immune responses that decrease, reduce, inhibit, suppress, limit, controls or clear an allergic response than immune responses that promote an allergic response.

[0159] Methods and uses and medicaments of the invention include treating a subject via specific immunotherapy. In one embodiment, a method or use includes administering to the subject an amount of a protein, peptide, subsequence, portion, homologue, variant or derivative thereof described herein (e.g., any Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8). In one aspect, an antigen (allergen) administered to a subject during specific immunotherapy to treat the subject is the same antigen (allergen) to which the subject has been sensitized or is hypersensitive (e.g., allergic). In another non-limiting aspect, an antigen (allergen) administered to a subject to treat the subject is a different antigen (allergen) to which the subject has been sensitized or is hypersensitive (e.g., allergic). Thus, in different embodiments, the antigen administered and antigen (e.g., allergen) against which immunological tolerance is sought may be the same protein (antigen, allergen), may be proteins (antigens, allergens) of the same organism or may be proteins (antigens, allergens) of different organisms.

[0160] In accordance with the invention, methods and uses and medicaments include therapeutic (following antigen/allergen exposure) and prophylactic (prior to antigen/allergen exposure) uses and methods. For example, therapeutic and prophylactic methods and uses of treating a subject for an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen, include but are not limited to treatment of a subject having or at risk of having an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen; treating a subject with an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen; and methods and uses and medicaments of protecting a subject from an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an antigen/allergen (e.g., provide the subject with protection against an allergic reaction to an allergen), to decrease or reduce the probability of an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen, in a subject and to decrease or reduce susceptibility of a subject to an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen, to inhibit or prevent an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen, in a subject. Accordingly, methods and uses and medicaments can treat an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen, or provide a subject with protection from an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen (e.g., prophylactic protection).

[0161] As described herein, proteins, peptides, subsequences, portions, homologues, variants and derivatives thereof include T cell epitopes, such as Th2 cell epitopes. Accordingly, methods and uses of the invention include administering an amount of a protein, peptide, subsequence, portion, homologue, variant or derivative thereof (e.g., a T cell epitope) to a subject sufficient to provide the subject with protection against an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen. In another embodiment, a method includes administering an amount of a protein, peptide, subsequence, portion, homologue, variant or derivative thereof (e.g., a T cell epitope, such as a Th2 cell epitope) to a subject sufficient to treat, vaccinate or immunize the subject against an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen.

[0162] In accordance with the invention, methods and uses of modulating anti-allergen activity of T cells, including but not limited to CD8.sup.+ T cells, CD4.sup.+ T cells, Th1 cells or Th2 cells, in a subject are provided. In one embodiment, a method or use includes administering to a subject an amount of a protein, peptide, subsequence, portion, homologue, variant or derivative thereof (e.g., a Cockroach protein or peptide set forth in any of Tables 5-8), such as a T cell epitope, sufficient to modulate Th2 cell activity in the subject.

[0163] In all methods and uses and medicaments of the invention, any appropriate protein, peptide, subsequence, portion, homologue, variant or derivative thereof can be used or administered. In particular non-limiting examples, the protein, peptide, subsequence, portion, homologue, variant or derivative thereof comprises, consists of or consists essentially of a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8, or a subsequence, portion, homologue, variant or derivative thereof.

[0164] In certain embodiments, two or more proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, may be administered to a subject. In particular embodiments, a protein, peptide, subsequence, portion, homologue, variant or derivative thereof consists of or consists essentially of an amino acid sequence of a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8, or subsequence, portion, homologue, variant or derivative thereof, and is administered with one or more other proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof. Two or more proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof may be administered as a combination composition, or administered separately, such as concurrently or in series or sequentially. Different proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, may be administered to a subject in the same amount, volume or concentration, or different amounts, volumes or concentrations. Thus, in certain embodiments, the subject may be administered the same amount of two or more different proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof; and in other embodiments, the subject may be administered one protein, peptide, subsequence, portion, homologue, variant or derivative thereof in an amount, volume or concentration greater than one or more other protein, peptide, subsequence, portion, homologue, variant or derivative thereof administered to the subject.

[0165] Methods and uses of the invention include a favorable response or an improvement in one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an antigen/allergen. In particular embodiments, a favorable response or improvement includes but is not limited to reduce, decrease, suppress, limit, control or inhibit an allergic response including reducing, decreasing, suppressing, limiting, controlling or inhibiting immune cell proliferation, function or activity, or eliciting, stimulating, inducing, promoting, increasing or enhancing immune cell proliferation or activity (e.g. regulatory T cells); or reduce, decrease, suppress, limit, control or inhibit the amount of allergen. In additional particular embodiments, an amount of a protein, peptide, subsequence, portion, homologue, variant or derivative thereof is sufficient to elicit, stimulate, induce, promote, increase or enhance or augment immunological tolerance to an allergen; or decrease, reduce, inhibit, suppress, prevent, control, or limit an allergic reaction or response. In further particular embodiments, an amount of a protein, peptide, subsequence, portion, homologue, variant or derivative thereof is sufficient to protect a subject from an allergic response or reduce, decrease, limit, control or inhibit susceptibility to an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen.

[0166] Methods and uses of the invention therefore include any therapeutic or beneficial effect. In various methods embodiments, an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen is reduced, decreased, inhibited, limited, delayed or prevented. Physiological conditions, disorders, illnesses and diseases associated with an antigen/allergen include but are not limited to asthma, allergic asthma, bronchiolitis and pleuritis, Allergic rhinitis; Onchocercal dermatitis; Atopic dermatitis; allergic conjunctivitis; Drug reactions; Nodules, eosinophilia, rheumatism, dermatitis, rashes, hives, and swelling (NERDS); esophageal and a gastrointestinal allergy, Airway Obstruction, Apnea, Asbestosis, Atelectasis, Berylliosis, Bronchiectasis, Bronchiolitis, Bronchiolitis Obliterans Organizing Pneumonia, Bronchitis, Bronchopulmonary Dysplasia, Empyema, Pleural Empyema, Pleural Epiglottitis, Hemoptysis, Hypertension, Kartagener Syndrome, Meconium Aspiration, Pleural Effusion, Pleurisy, Pneumonia, Pneumothorax, Respiratory Distress Syndrome, Respiratory Hypersensitivity, Rhinoscleroma, Scimitar Syndrome, Severe Acute Respiratory Syndrome, Silicosis, Tracheal Stenosis, eosinophilic pleural effusions, Histiocytosis; chronic eosinophilic pneumonia; hypersensitivity pneumonitis; Allergic bronchopulmonary aspergillosis; Sarcoidosis; Idiopathic pulmonary fibrosis; pulmonary edema; pulmonary embolism; pulmonary emphysema; Pulmonary Hyperventilation; Pulmonary Alveolar Proteinosis; Chronic Obstructive Pulmonary Disease (COPD); Interstitial Lung Disease; and Topical eosinophilia. Symptoms and complications associated with an allergen include but are not limited to cell infiltration, production of antibodies, production of cytokines, lymphokines, chemokines, interferons and interleukins, cell growth and maturation factors (e.g., differentiation factors), cell proliferation, cell differentiation, cell accumulation or migration and cell, tissue or organ damage or remodelling, allergic rhinitis; Onchocercal dermatitis; Atopic dermatitis; allergic conjunctivitis; Drug reactions; Nodules, eosinophilia, rheumatism, dermatitis, rashes, hives, and swelling (NERDS); esophageal and a gastrointestinal allergy. Additional symptoms of antigen/allergen exposure are known to one of skill in the art and treatment thereof in accordance with the invention is provided.

[0167] Methods and uses of the invention moreover include reducing, decreasing, inhibiting, delaying or preventing onset, progression, frequency, duration, severity, probability or susceptibility of one or more adverse symptoms, disorders, illnesses, diseases or complications caused by or associated with an antigen/allergen (e.g., any Cockroach allergen). In further various particular embodiments, methods and uses include improving, accelerating, facilitating, enhancing, augmenting, or hastening recovery of a subject from an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an antigen/allergen. In yet additional various embodiments, methods and uses include stabilizing an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an antigen/allergen (e.g., any Cockroach allergen).

[0168] A therapeutic or beneficial effect is therefore any objective or subjective measurable or detectable improvement or benefit provided to a particular subject. A therapeutic or beneficial effect can but need not be complete ablation of all or any allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen. Thus, a satisfactory clinical endpoint is achieved when there is an incremental improvement or a partial reduction in an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen, or an inhibition, decrease, reduction, suppression, prevention, limit or control of worsening or progression of an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen, over a short or long duration (hours, days, weeks, months, etc.).

[0169] A therapeutic or beneficial effect also includes reducing or eliminating the need, dosage frequency or amount of a second therapeutic protocol or active such as another drug or other agent (e.g., anti-inflammatory) used for treating a subject having or at risk of having an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen. For example, reducing an amount of an adjunct therapy, such as a reduction or decrease of a treatment for an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen, or a specific immunotherapy, vaccination or immunization protocol is considered a beneficial effect. In addition, reducing or decreasing an amount of protein, peptide, subsequence, portion, homologue, variant or derivative thereof, used for specific immunotherapy, vaccination or immunization of a subject to provide protection to the subject is considered a beneficial effect.

[0170] As disclosed herein, invention proteins, peptides, subsequences, etc., can be used in methods of providing specific immunotherapy to a subject, such as a subject with or at risk of an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen. In one embodiment, a method or use includes administering to a subject an amount of a protein, peptide, subsequence, portion, homologue, variant or derivative thereof sufficient to elicit, stimulate, induce, promote, increase, enhance or augment immunological tolerance in the subject to an antigen/allergen. In another embodiment, a method includes administering to a subject an amount of a nucleic acid encoding all or a portion (e.g., a T cell epitope) of a protein, peptide, subsequence, portion, homologue, variant or derivative thereof sufficient to elicit, stimulate, induce, promote, increase, enhance or augment immunological tolerance of the subject to an allergen.

[0171] When an antigen(s) or allergen(s) is administered to induce tolerance (desensitize), an amount or dose of the antigen or allergen to be administered (e.g., a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8), and the period of time required to achieve a desired outcome or result (e.g., to desensitize or develop tolerance to the antigen or allergen) can be determined by one skilled in the art. The antigen or allergen may be administered to the patient through any route known in the art, including, but not limited to oral, inhalation, sublingual, epicutaneous, intranasal, and/or parenteral routes (intravenous, intramuscular, subcutaneously, and intraperitoneal).

[0172] Methods and uses of the invention include administration of a protein, peptide, subsequence, portion, homologue, variant or derivative thereof to a subject prior to contact by or exposure to an allergen; administration prior to, substantially contemporaneously with or after a subject has been contacted by or exposed to an allergen; and administration prior to, substantially contemporaneously with or after an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen. A subject contacted by or exposed to an allergen may have contact or exposure over a period of 1-5, 5-10, 10-20, 20-30, 30-50, 50-100 hours, days, months, or years.

[0173] Invention compositions (e.g., proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, including T cell epitopes, for example, of an amino acid sequence of a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8), methods and uses and medicaments can be combined with any compound, agent, drug, treatment or other therapeutic regimen or protocol having a desired therapeutic, beneficial, additive, synergistic or complementary activity or effect. Exemplary combination compositions and treatments include multiple proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, such as a combination of any of the Cockroach proteins and peptides set forth herein, and/or a combination of any of the subsequences, portions, homologues, variants or derivatives thereof.

[0174] Additional combinations include second actives, such as anti-allergen compounds, agents, drugs, treatments and therapies, including but not limited to anti-histamines, anti-inflammatories, decongestants and corticosteroids as well as agents that assist, promote, stimulate or enhance efficacy. Such anti-allergen drugs, agents, treatments and therapies can be administered or performed prior to, substantially contemporaneously with or following any method or use described herein, for example, a therapeutic use or method of treating a subject for an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen, or a method or use of providing specific immunotherapy to a subject.

[0175] Accordingly, methods and uses and medicaments include combinations of Cockroach proteins, peptides, subsequences, portions, homologues, variants and/or derivatives thereof (second, third, fourth, fifth or more), and/or second actives, and administering as a combination, or administered separately, such as concurrently or in series or sequentially (prior to or following) to administering another (second, third, fourth, fifth or more) Cockroach protein, peptide, subsequence, portios, homolog, variant and/or derivative thereof, and/or second active to a subject. The invention therefore provides combinations of one or more proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, in combination, and/or with a second active, including but not limited to any compound, agent, drug, therapeutic regimen, treatment protocol, process, remedy or composition, such as anti-histamine, anti-inflammatory, decongestant and corticosteroid, or immune tolerance stimulating, enhancing or augmenting protocol, or specific immunotherapy protocol set forth herein or known in the art. The compound, agent, drug, therapeutic regimen, treatment protocol, process, remedy or composition can be administered or performed prior to, substantially contemporaneously with or following administration of one or more proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, or a nucleic acid encoding all or a portion (e.g., a T cell epitope) of a protein, peptide, subsequence, portion, homologue, variant or derivative thereof, to a subject. Specific non-limiting examples of combination embodiments therefore include the foregoing or other compound, agent, drug, therapeutic regimen, treatment protocol, process, remedy or composition.

[0176] An exemplary combination is a Cockroach protein, peptide, subsequence, portion, homologue, variant or derivative thereof, and a different protein, peptide, or subsequence, portion, homologue, variant or derivative thereof, of an amino acid sequence of a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8. Another exemplary combination is a protein, peptide, subsequence, portion, homologue, variant or derivative thereof, and an immunological tolerance inducing molecule.

[0177] In invention methods and uses in which there is a desired outcome or effect, such as a therapeutic or prophylactic method or use that provides a benefit from treatment, protection, inducing immunological tolerance, vaccination or specific immunotherapy, a Cockroach protein, peptide, subsequence, portion, homologue, variant or derivative thereof (e.g., a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8) can be administered in a sufficient or effective amount. As used herein, a sufficient amount or effective amount or an amount sufficient or an amount effective refers to an amount that provides, in single (e.g., primary) or multiple (e.g., booster) doses, alone or in combination with one or more other compounds, treatments, therapeutic regimens or agents (e.g., a drug), a long term or a short term detectable or measurable improvement in a given subject or any objective or subjective benefit to a given subject of any degree or for any time period or duration (e.g., for minutes, hours, days, months, years, or cured).

[0178] An amount sufficient or an amount effective can but need not be provided in a single administration and can but need not be achieved by a particular protein, peptide, subsequence, portion, homologue, variant or derivative thereof, alone, optionally in a combination composition or method or use that includes a second active. In addition, an amount sufficient or an amount effective need not be sufficient or effective if given in single or multiple doses without a second or additional administration or dosage, since additional doses, amounts or duration above and beyond such doses, or additional antigens, compounds, drugs, agents, treatment or therapeutic regimens may be included in order to provide a given subject with a detectable or measurable improvement or benefit to the subject. For example, to increase, enhance, improve or optimize specific immunotherapy, after an initial or primary administration of one or more proteins, peptides, subsequences, portions, homologues, variants or derivative thereof, the subject can be administered one or more additional boosters of one or more proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof. Such subsequent booster administrations can be of the same or a different type, formulation, dose, concentration, route, etc.

[0179] An amount sufficient or an amount effective need not be therapeutically or prophylactically effective in each and every subject treated, nor a majority of subjects treated in a given group or population. An amount sufficient or an amount effective means sufficiency or effectiveness in a particular subject, not a group of subjects or the general population. As is typical for such methods, different subjects will exhibit varied responses to a method of the invention, such as immunization, vaccination, specific immunotherapy and therapeutic treatments.

[0180] The term subject includes but is not limited to a subject at risk of allergen contact or exposure as well as a subject that has been contacted by or exposed to an allergen. A subject also includes those having or at risk of having or developing an immune response to an antigen or an allergen. Such subjects include mammalian animals (mammals), such as a non-human primate (apes, gibbons, gorillas, chimpanzees, orangutans, macaques), a domestic animal (dogs and cats), a farm animal (poultry such as chickens and ducks, horses, cows, goats, sheep, pigs), experimental animal (mouse, rat, rabbit, guinea pig) and humans. Subjects include animal disease models, for example, mouse and other animal models of allergic response known in the art.

[0181] Accordingly, subjects appropriate for treatment include those having or at risk of exposure to an antigen or allergen, also referred to as subjects in need of treatment. Subjects in need of treatment therefore include subjects that have been exposed to or contacted with an antigen or allergen, or that have an ongoing contact or exposure or have developed one or more adverse symptoms caused by or associated with an antigen or allergen, regardless of the type, timing or degree of onset, progression, severity, frequency, duration of the symptoms.

[0182] Target subjects and subjects in need of treatment also include those at risk of allergen exposure or contact or at risk of having exposure or contact to an allergen. Accordingly, subjects include those at increased or elevated (high) risk of an allergic reaction; has, or has previously had or is at risk of developing hypersensitivity to an allergen; and those that have or have previously had or is at risk of developing asthma.

[0183] More particular target subjects include subjects allergic to particular Cockroach antigens and/or allergens. In particular embodiments, a subject is allergic to a Cockroach allergen, such as a Cockroach protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16.

[0184] Invention compositions, methods and uses and medicaments are therefore applicable to treating a subject who is at risk of allergen exposure or contact but has not yet been exposed to or contacted with the allergen. Prophylactic uses and methods are therefore included. Target subjects for prophylaxis may be at increased risk (probability or susceptibility) of allergen exposure or contact as set forth herein. Such subjects are considered in need of treatment due to being at risk.

[0185] Subjects for prophylaxis need not be at increased risk but may be from the general population in which it is desired to protect a subject against an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen or to provide specific immunotherapy, for example. Such a subject that is desired to be protected against an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen or to be provided specific immunotherapy can be administered a protein, peptide, subsequence, portion, homologue, variant or derivative thereof. In another non-limiting example, a subject that is not specifically at risk of exposure to or contact by an allergen, but nevertheless desires protection against an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen, can be administered a protein, peptide, subsequence, portion, homologue, variant or derivative thereof. Such subjects are also considered in need of treatment.

[0186] Prophylaxis and grammatical variations thereof mean a method or use in which contact, administration or in vivo delivery to a subject is prior to contact with or exposure to an allergen. In certain situations it may not be known that a subject has been contacted with or exposed to an allergen, but administration or in vivo delivery to a subject can be performed prior to manifestation of an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen. For example, a subject can be provided protection against an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen or provided specific immunotherapy with a protein, peptide, subsequence, portion, homologue, variant or derivative thereof. In such case, a method or use can eliminate, prevent, inhibit, suppress, limit, decrease or reduce the probability of or susceptibility towards an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an antigen/allergen.

[0187] Prophylaxis can also refer to a method or use in which contact, administration or in vivo delivery to a subject is prior to a secondary or subsequent exposure to an antigen/allergen. In such a situation, a subject may have had a prior contact or exposure to an allergen. In such subjects, an acute allergic reaction may but need not be resolved. Such a subject typically may have developed anti-allergen antibodies due to the prior exposure. Immunization or vaccination, by administration or in vivo delivery to such a subject, can be performed prior to a secondary or subsequent allergen exposure. Such a method or use can eliminate, prevent, inhibit, suppress, limit, decrease or reduce the probability of or susceptibility towards a secondary or subsequent allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen. In certain embodiments, such a method or use includes providing specific immunotherapy to the subject to eliminate, prevent, inhibit, suppress, limit, decrease or reduce the probability of or susceptibility towards a secondary or subsequent allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an antigen/allergen.

[0188] Treatment of an allergic reaction or response can be at any time during the reaction or response. A protein, peptide, subsequence, portion, homologue, variant or derivative thereof, can be administered as a combination (e.g., with a second active), or separately concurrently or in sequence (sequentially) in accordance with the methods and uses described herein as a single or multiple dose e.g., one or more times hourly, daily, weekly, monthly or annually or between about 1 to 10 weeks, or for as long as appropriate, for example, to achieve a reduction in the onset, progression, severity, frequency, duration of one or more symptoms or complications associated with or caused by an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an antigen/allergen.

[0189] Accordingly, methods and uses of the invention can be practiced one or more times (e.g., 1-10, 1-5 or 1-3 times) an hour, day, week, month, or year. The skilled artisan will know when it is appropriate to delay or discontinue administration. A non-limiting dosage schedule is 1-7 times per week, for 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 or more weeks.

[0190] Doses can be based upon current existing protocols, empirically determined, using animal disease models or optionally in human clinical trials. Initial study doses can be based upon animal studies, e.g. a mouse, and the amount of protein, peptide, subsequence, portion, homologue, variant or derivative thereof, administered that is determined to be effective. Exemplary non-limiting amounts (doses) are in a range of about 0.1 mg/kg to about 100 mg/kg, and any numerical value or range or value within such ranges. Greater or lesser amounts (doses) can be administered, for example, 0.01-500 mg/kg, and any numerical value or range or value within such ranges. The dose can be adjusted according to the mass of a subject, and will generally be in a range from about 1-10 ug/kg, 10-25 ug/kg, 25-50 ug/kg, 50-100 ug/kg, 100-500 ug/kg, 500-1,000 ug/kg, 1-5 mg/kg, 5-10 mg/kg, 10-20 mg/kg, 20-50 mg/kg, 50-100 mg/kg, 100-250 mg/kg, 250-500 mg/kg, or more, two, three, four, or more times per hour, day, week, month or annually. A typical range will be from about 0.3 mg/kg to about 50 mg/kg, 0-25 mg/kg, or 1.0-10 mg/kg, or any numerical value or range or value within such ranges.

[0191] Doses can vary and depend upon whether the treatment is prophylactic or therapeutic, whether a subject has been previously exposed to the antigen/allergen, the onset, progression, severity, frequency, duration, probability of or susceptibility of the symptom, condition, pathology or complication, or vaccination or specific immunotherapy to which treatment is directed, the clinical endpoint desired, previous or simultaneous treatments, the general health, age, gender, race or immunological competency of the subject and other factors that will be appreciated by the skilled artisan. The skilled artisan will appreciate the factors that may influence the dosage and timing required to provide an amount sufficient for providing a therapeutic or prophylactic benefit.

[0192] Typically, for treatment, a protein, peptide, subsequence, portion, homologue, variant or derivative thereof, will be administered as soon as practical, typically within 1-2, 2-4, 4-12, 12-24 or 24-72 hours after a subject is exposed to or contacted with an allergen, or within 1-2, 2-4, 4-12, 12-24 or 24-48 hours after onset or development of one or more of an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an antigen/allergen.

[0193] For prophylactic treatment in connection with vaccination or specific immunotherapy, proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, can be administered for a duration of 0-4 weeks, e.g., 2-3 weeks, prior to exposure to or contact by an allergen or at least within 1-2, 2-4, 4-12, 12-24, 24-48 or 48-72 hours prior to exposure to or contact by an allergen. For an acute allergic reaction, proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof may be administered at any appropriate time.

[0194] The dose amount, number, frequency or duration may be proportionally increased or reduced, as indicated by the status of the subject. For example, whether the subject has an allergic response, whether the subject has been exposed to or contacted by an allergen or is merely at risk of allergen contact or exposure, whether the subject is a candidate for or will be vaccinated or provided specific immunotherapy. The dose amount, number, frequency or duration may be proportionally increased or reduced, as indicated by any adverse side effects, complications or other risk factors of the treatment or therapy.

[0195] In methods and uses and medicaments of the invention, the route, dose, number and frequency of administrations, treatments, vaccinations and specific immunotherapy, and timing/intervals between treatment, vaccination and specific immunotherapy, and allergen exposure can be modified. Although rapid induction of immune responses or immunological tolerance is desired for developing protective emergency vaccines against an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen, in certain embodiments, a desirable treatment will elicit robust, long-lasting protection against an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen. Thus, in certain embodiments, invention compositions, methods and uses and medicaments provide long-lasting protection against an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen. Specific immunotherapy strategies can provide long-lived protection against an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen depending on the level of induced immunological tolerance or a T cell response or activity.

[0196] Cockroach proteins or peptides, or subsequences, portions, homologues, variants or derivatives thereof can be provided in compositions, and in turn can be used in accordance with the invention methods and uses and medicaments. Such compositions, methods and uses and medicaments include pharmaceutical compositions and formulations. In certain embodiments, a pharmaceutical composition includes one or more Cockroach proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof described herein (e.g., an amino acid sequence of a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8). In particular, aspects, such compositions and formulations may be a vaccine, including but not limited to a vaccine to protect against an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen (e.g., a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16).

[0197] As used herein the term pharmaceutically acceptable and physiologically acceptable mean a biologically acceptable formulation, gaseous, liquid or solid, or mixture thereof, which is suitable for one or more routes of administration, in vivo delivery or contact. Such formulations include solvents (aqueous or non-aqueous), solutions (aqueous or non-aqueous), emulsions (e.g., oil-in-water or water-in-oil), suspensions, syrups, elixirs, dispersion and suspension media, coatings, isotonic and absorption promoting or delaying agents, compatible with pharmaceutical administration or in vivo contact or delivery. Aqueous and non-aqueous solvents, solutions and suspensions may include suspending agents and thickening agents. Such pharmaceutically acceptable carriers include tablets (coated or uncoated), capsules (hard or soft), microbeads, powder, granules and crystals. Supplementary active compounds (e.g., preservatives, antibacterial, antiviral and antifungal agents) can also be incorporated into the compositions.

[0198] To increase an immune response, immunological tolerance or protection against an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with an allergen, proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof, can be coupled to another protein such as ovalbumin or keyhole limpet hemocyanin (KLH), thyroglobulin or a toxin such as tetanus or cholera toxin. Proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof can also be mixed with adjuvants.

[0199] Adjuvants include, for example: oil (mineral or organic) emulsion adjuvants such as Freund's complete (CFA) and incomplete adjuvant (IFA) (WO 95/17210; WO 98/56414; WO 99/12565; WO 99/11241; and U.S. Pat. No. 5,422,109); metal and metallic salts, such as aluminum and aluminum salts, such as aluminum phosphate or aluminum hydroxide, alum (hydrated potassium aluminum sulfate); bacterially derived compounds, such as Monophosphoryl lipid A and derivatives thereof (e.g., 3 De-O-acylated monophosphoryl lipid A, aka 3D-MPL or d3-MPL, to indicate that position 3 of the reducing end glucosamine is de-O-acylated, 3D-MPL consisting of the tri and tetra acyl congeners), and enterobacterial lipopolysaccharides (LPS); plant derived saponins and derivatives thereof, for example Quil A (isolated from the Quilaja Saponaria Molina tree, see, e.g., Saponin adjuvants, Archiv. fur die gesamte Virusforschung, Vol. 44, Springer Verlag, Berlin, p243-254; U.S. Pat. No. 5,057,540), and fragments of Quil A which retain adjuvant activity without associated toxicity, for example QS7 and QS21 (also known as QA7 and QA21), as described in WO96/33739, for example; surfactants such as, soya lecithin and oleic acid; sorbitan esters such as sorbitan trioleate; and polyvinylpyrrolidone; oligonucleotides such as CpG (WO 96/02555, and WO 98/16247), polyriboA and polyriboU; block copolymers; and immunostimulatory cytokines such as GM-CSF and IL-1, and Muramyl tripeptide (MTP). Additional examples of adjuvants are described, for example, in Vaccine Designthe subunit and adjuvant approach (Edited by Powell, M. F. and Newman, M. J.; 1995, Pharmaceutical Biotechnology (Plenum Press, New York and London, ISBN 0-306-44867-X) entitled Compendium of vaccine adjuvants and excipients by Powell, M. F. and Newman M.

[0200] Cosolvents may be added to a protein, peptide, subsequence, portion, homologue, variant or derivative thereof, composition or formulation. Non-limiting examples of cosolvents contain hydroxyl groups or other polar groups, for example, alcohols, such as isopropyl alcohol; glycols, such as propylene glycol, polyethyleneglycol, polypropylene glycol, glycol ether; glycerol; polyoxyethylene alcohols and polyoxyethylene fatty acid esters. Non-limiting examples of cosolvents contain hydroxyl groups or other polar groups, for example, alcohols, such as isopropyl alcohol; glycols, such as propylene glycol, polyethyleneglycol, polypropylene glycol, glycol ether; glycerol; polyoxyethylene alcohols and polyoxyethylene fatty acid esters.

[0201] Supplementary compounds (e.g., preservatives, antioxidants, antimicrobial agents including biocides and biostats such as antibacterial, antiviral and antifungal agents) can also be incorporated into the compositions. Pharmaceutical compositions may therefore include preservatives, anti-oxidants and antimicrobial agents.

[0202] Preservatives can be used to inhibit microbial growth or increase stability of ingredients thereby prolonging the shelf life of the pharmaceutical formulation. Suitable preservatives are known in the art and include, for example, EDTA, EGTA, benzalkonium chloride or benzoic acid or benzoates, such as sodium benzoate. Antioxidants include, for example, ascorbic acid, vitamin A, vitamin E, tocopherols, and similar vitamins or provitamins.

[0203] An antimicrobial agent or compound directly or indirectly inhibits, reduces, delays, halts, eliminates, arrests, suppresses or prevents contamination by or growth, infectivity, replication, proliferation, reproduction, of a pathogenic or non-pathogenic microbial organism. Classes of antimicrobials include antibacterial, antiviral, antifungal and antiparasitics. Antimicrobials include agents and compounds that kill or destroy (-cidal) or inhibit (-static) contamination by or growth, infectivity, replication, proliferation, reproduction of the microbial organism.

[0204] Exemplary antibacterials (antibiotics) include penicillins (e.g., penicillin G, ampicillin, methicillin, oxacillin, and amoxicillin), cephalosporins (e.g., cefadroxil, ceforanid, cefotaxime, and ceftriaxone), tetracyclines (e.g., doxycycline, chlortetracycline, minocycline, and tetracycline), aminoglycosides (e.g., amikacin, gentamycin, kanamycin, neomycin, streptomycin, netilmicin, paromomycin and tobramycin), macrolides (e.g., azithromycin, clarithromycin, and erythromycin), fluoroquinolones (e.g., ciprofloxacin, lomefloxacin, and norfloxacin), and other antibiotics including chloramphenicol, clindamycin, cycloserine, isoniazid, rifampin, vancomycin, aztreonam, clavulanic acid, imipenem, polymyxin, bacitracin, amphotericin and nystatin.

[0205] Particular non-limiting classes of anti-virals include reverse transcriptase inhibitors; protease inhibitors; thymidine kinase inhibitors; sugar or glycoprotein synthesis inhibitors; structural protein synthesis inhibitors; nucleoside analogues; and viral maturation inhibitors. Specific non-limiting examples of anti-virals include nevirapine, delavirdine, efavirenz, saquinavir, ritonavir, indinavir, nelfinavir, amprenavir, zidovudine (AZT), stavudine (d4T), larnivudine (3TC), didanosine (DDI), zalcitabine (ddC), abacavir, acyclovir, penciclovir, ribavirin, valacyclovir, ganciclovir, 1,-D-ribofuranosyl-1,2,4-triazole-3 carboxamide, 9->2-hydroxy-ethoxy methylguanine, adamantanamine, 5-iodo-2-deoxyuridine, trifluorothymidine, interferon and adenine arabinoside.

[0206] Pharmaceutical formulations and delivery systems appropriate for the compositions, methods and uses and medicaments of the invention are known in the art (see, e.g., Remington: The Science and Practice of Pharmacy (2003) 20.sup.th ed., Mack Publishing Co., Easton, Pa.; Remington's Pharmaceutical Sciences (1990) 18.sup.th ed., Mack Publishing Co., Easton, Pa.; The Merck Index (1996) 12.sup.th ed., Merck Publishing Group, Whitehouse, N.J.; Pharmaceutical Principles of Solid Dosage Forms (1993), Technonic Publishing Co., Inc., Lancaster, Pa.; Ansel ad Soklosa, Pharmaceutical Calculations (2001) 11.sup.th ed., Lippincott Williams & Wilkins, Baltimore, Md.; and Poznansky et al., Drug Delivery Systems (1980), R. L. Juliano, ed., Oxford, N.Y., pp. 253-315).

[0207] Pharmaceutical compositions can be formulated to be compatible with a particular route of administration. Thus, pharmaceutical compositions include carriers, diluents, or excipients suitable for administration by various routes. Exemplary routes of administration for contact or in vivo delivery which a composition can optionally be formulated include inhalation, respiration, intranasal, intubation, intrapulmonary instillation, oral, buccal, intrapulmonary, intradermal, topical, dermal, parenteral, sublingual, subcutaneous, intravascular, intrathecal, intraarticular, intracavity, transdermal, iontophoretic, intraocular, opthalmic, optical, intravenous (i.v.), intramuscular, intraglandular, intraorgan, or intralymphatic.

[0208] Formulations suitable for parenteral administration include aqueous and non-aqueous solutions, suspensions or emulsions of the active compound, which preparations are typically sterile and can be isotonic with the blood of the intended recipient. Non-limiting illustrative examples include water, saline, dextrose, fructose, ethanol, animal, vegetable or synthetic oils.

[0209] Methods and uses of the invention may be practiced by any mode of administration or delivery, or by any route, systemic, regional and local administration or delivery. Exemplary administration and delivery routes include intravenous (i.v.), intraperitoneal (i.p.), intrarterial, intramuscular, parenteral, subcutaneous, intra-pleural, topical, dermal, intradermal, transdermal, transmucosal, intra-cranial, intra-spinal, rectal, oral (alimentary), mucosal, inhalation, respiration, intranasal, intubation, intrapulmonary, intrapulmonary instillation, buccal, sublingual, intravascular, intrathecal, intracavity, iontophoretic, intraocular, ophthalmic, optical, intraglandular, intraorgan, or intralymphatic.

[0210] For oral administration, a composition can take the form of, for example, tablets or capsules prepared by conventional means with pharmaceutically acceptable excipients such as binding agents (for example, pregelatinised maize starch, polyvinylpyrrolidone or hydroxypropyl methylcellulose); fillers (for example, lactose, microcrystalline cellulose or calcium hydrogen phosphate); lubricants (for example, magnesium stearate, talc or silica); disintegrants (for example, potato starch or sodium starch glycolate); or wetting agents (for example, sodium lauryl sulphate). The tablets can be coated by methods known in the art. Liquid preparations for oral administration can take the form of, for example, solutions, syrups or suspensions, or they can be presented as a dry product for constitution with water or other suitable vehicle before use. Such liquid preparations can be prepared by conventional means with pharmaceutically acceptable additives such as suspending agents (for example, sorbitol syrup, cellulose derivatives or hydrogenated edible fats); emulsifying agents (for example, lecithin or acacia); non-aqueous vehicles (for example, almond oil, oily esters, ethyl alcohol or fractionated vegetable oils); and preservatives (for example, methyl or propyl-p-hydroxybenzoates or sorbic acid). The preparations can also contain buffer salts, flavoring, coloring, and sweetening agents as appropriate.

[0211] For administration by inhalation, a composition can be delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with the use of a suitable propellant, for example, dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas. In the case of a pressurized aerosol, the dosage unit can be determined by providing a valve to deliver a metered amount. Capsules and cartridges for use in an inhaler or insufflator can be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch.

[0212] Invention Cockroach proteins and peptides, e.g., a protein or peptide set forth in any of Tables 5-8, subsequences, portions, homologues, variants or derivatives thereof optionally along with any adjunct agent, compound, drug, composition, whether active or inactive, etc., can be packaged in unit dosage form (capsules, tablets, troches, cachets, lozenges) for ease of administration and uniformity of dosage. A unit dosage form as used herein refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active ingredient optionally in association with a pharmaceutical carrier (excipient, diluent, vehicle or filling agent) which, when administered in one or more doses, is calculated to produce a desired effect (e.g., prophylactic or therapeutic effect). Unit dosage forms also include, for example, ampules and vials, which may include a composition in a freeze-dried or lyophilized state; a sterile liquid carrier, for example, can be added prior to administration or delivery in vivo. Unit dosage forms additionally include, for example, ampules and vials with liquid compositions disposed therein. Individual unit dosage forms can be included in multi-dose kits or containers. Pharmaceutical formulations can be packaged in single or multiple unit dosage form for ease of administration and uniformity of dosage.

[0213] The invention also provides methods of diagnosing and detecting an allergic response or allergy in a subject. The methods can be performed in solution, in solid phase, in silica, in vitro, in a cell, and in vivo. In one embodiment, a method includes contacting a cell (e.g., T cell) from the subject with a Cockroach protein, peptide, subsequence, portion, homologue, variant or derivative thereof, as described herein (e.g., of an amino acid sequence of a Cockroach allergen such as a protein or of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8; and determining if the protein or peptide modulates an immune response or activity of the contacted cell (e.g., T cell). A determination that the Cockroach protein or peptide modulates an immune response or immune activity of the contacted cell indicates that the subject has an allergic response or an allergy, in particular, an allergy to the protein, peptide, subsequence, portion, homologue, variant or derivative thereof (e.g., of a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8). In a particular aspect, the immune activity determined is Th2 cell reactivity. In another particular aspect, immune response or activity is determined by assaying for a cutaneous immunological hypersensitive reaction.

[0214] The invention also provides methods of diagnosing and detecting allergic rhinitis or asthma in a subject. The methods can be performed in solution, in solid phase, in silica, in vitro, in a cell, and in vivo.

[0215] In one embodiment, a method of diagnosing asthma in a subject includes contacting a cell (e.g., T cell) from the subject with one or more Cockroach proteins or peptides with an amino acid sequence comprising, consisting of or consisting essentially an amino acid sequence of any of (SEQ ID NOs.: 46-203): NAIEFLNNIHDLLGI, IDDIIAILPVDDLYA, LIPVDQIIAIATDYL, QIIAIATDYLANDAE, ATDYLANDAEVQAAV, EYQNLIQKLKDKGVD, IQKLKDKGVDVDHII, DKGVDVDHIIELIHQ, DTRGLPEDLQDFLAL, LIPTDQVLAIAADYL, QVLAIAADYLANDAE, LKALFNEKLETSPDF, EYLKSDEFETIVVTV, DEFETIVVTVDSLPE, IVVTVDSLPEFKNFL, DDLQDFLALIPVDQI, PVDQIIAIATDYLAN, IAIATDYLANDAEVQ, DYLANDAEVQAAVAY, DAEVQAAVAYLQSDE, AAVAYLQSDEFETIV, VTLDALPELQNFLNF, LPELQNFLNFLEANG, HDLLGIPHIPVSGRK, IPHIPVSGRKYHIRR, VSGRKYHIRRGVGIT, PIDQILAIAADYLAN, DYLANDAEVQAAVEY, VTVDSLPEFKNFLNF, LQTNGLNAIEFINNI, LNAIEFINNIHDLLG, ATGRKHVRRGVGING, HVRRGVGINGLIDDV, VGINGLIDDVIAILP, IAILPVDELYALFQE, KLESSPEFKALYDAI, PEFKALYDAIRSPEF, LYDAIRSPEFQSIVQ, RSPEFQSIVQTLKAM, QSIVQTLKAMPEYQD, TLKAMPEYQDLIQRL, IHENLIVTSPFRPWW, FRPWWERYQLVSYNL, ERYQLVSYNLNSRSG, RCNNVGIRIYVDVVL, GIRIYVDVVLNQMSG, RGNNAIKWLVNFGVG, GASILTYKTSKLYKM, KLYKMAVAFMLAYPY, WVCEHRWRQIFNMVG, RWRQIFNMVGFRNAV, LTVFDSTSCNVVVAS, STSCNVVVASQECVG, GRGIEDSLTISNLTT, SQQDIVLADELSQEV, AVLALCATDTLANED, CATDTLANEDCFRHE, LANEDCFRHESLVPN, PYSVLATDYENYAIV, VNQHKKAIEEDLKHF, KHFNLKYEDLHSTCH, MAPSYKLTYCPVKAL, KLTYCPVKALGEPIR, FLLSYGEKDFEDYRF, GEKDFEDYRFQEGDW, PNLKPSMPFGKTPVL, QTHQSVAISRYLGKQ, VAISRYLGKQFGLSG, YLGKQFGLSGKDDWE, KDDWENLEIDMIVDT, NLEIDMIVDTISDFR, MIVDTISDFRAAIAN, ISDFRAAIANYHYDA, AAIANYHYDADENSK, YHYDADENSKQKKWD, EVVKANGGYLAAGKL, NGGYLAAGKLTWADF, AAGKLTWADFYFVAL HMAKEDLVANQPNLK, DLVANQPNLKALREK, AAKFIIEEDSEAMEK, IEEDSEAMEKELREA, EAMEKELREAFRLYD, ELREAFRLYDKEGNG, FRLYDKEGNGYIPTS, KEGNGYIPTSCLREI, YIPTSCLREILRELD, DELDMMIEEIDADGS, KALQNAESEVAALNR, RSEERLATATAKLAE, VQKLQKEVDRLEDEL, KEVDRLEDELVHEKE, EAGFAKLAASDSKSL, KLAASDSKSLLRKYL, RCGRSMQGYPFNPCL, LIDDHFLFKEGDRFL, FLFKEGDRFLQHANA, WCNEEDHLRIISMQM, QVYRRLVTAVNDIEK, RVPFSHDDRLGFLTF, HDDRLGFLTFCPTNL, CPTNLGTTVRASVRI, SPYFVTNTEKMITEF, KIGEYKNMIAEGIID, RHNSAYKLHFNAFEY, STSLVKAHSMRNSAS, AVRLSKDIAADLQGE, LVRLLKQLKVSQIME, KQLKVSQIMEAARKL, QQFISSEMVEPKEAS, KNMTYVNTSLVLAFS, QKGYMVSSMTDLWEA, NTTFSNASAVIQEFL, PAYFKMNSPSLWKYN, MNITGSINLMFSQMY, SINLMFSQMYHAQLA, FSQMYHAQLAFSTAF, FQINLDFKNHNGFIR, DVLQWQTIPYTTIHN, VPIMNIYSAFEFDPN, LRLSEHLDYVKNLTV, AKRFAKWALPLYNKP, HIVFPSYEIEMFYDG, SYEIEMFYDGSRIMI, RILLRLHRCFQVLGR, IRHAILAAGDLYSRR, QSYETKLLFDLFYYA, KLLFDLFYYANDYDT, HINEGQFLYALS SAL, QFLYALSSALFQRED, LNDYILPAPYEIYPW, EIYPWLFVDSDVIQR, LNTYYSYYYFNYPTF, SYYYFNYPTFFNSTE, DRRGEMFYYTRQQLY, MFYYTRQQLYARYFL, RQQLYARYFLERLSN, ARYFLERLSNDLPDV, QATDAYVRVFLGPKY, KELVEKYGKGKAIFI, EDAFKKAYNAFKSLD, AKGMMHMIKKGANGS, VYEVAIPDRLTLRVE, QTLFLLLLLLAAVSA, SLLLNGGCKVSNYDE, EVKIVATLKALQNAH, ISLEVLKNYQLDSEL, LKNYQLDSELRIKAF, QVGSFIVSYLRNLRA, THQFNVAGSVTVDKT, LNQEAHYQFDSIHKF, HYQFDSIHKFEFASK, KAAVHLLVAVKASKE, WVPSKKCHLTNIACL, KCHLTNIACLLHNKY, DVLDIGGLKVQKQTF, DRKMYWQFKMDKIQI or GHSHFVSDVVLSSDG, or a subsequence, portion, homologue, variant or derivative thereof, as described herein, (e.g. peptides of the Asthmas Epitope Set in Table 8) and determining if the one or more proteins or peptides modulates an immune response or activity of the contacted cell (e.g., T cell). A determination that the one or more Cockroach proteins or peptides modulates an immune response or immune activity of the contacted cell indicates that the subject has asthma.

[0216] In another embodiment, a method of diagnosing allergic rhinitis in a subject includes contacting a cell (e.g., T cell) from the subject with one or more Cockroach proteins or peptides with an amino acid sequence comprising, consisting of or consisting essentially an amino acid sequence of any of (SEQ ID NOs.: 204-256): DCGVAGFRVDAAKHM, LDYERFRGSWIIAAG, KNRTTIRGRTKFEGN, IRGRTKFEGNKFTID, KFEGNKFTIDYNDKG, ATDYENYAIVEGCPA, NYAIVEGCPAAANGH, VIYVQIRFSVRRFHP, IRFSVRRFHPKLGDK, KLGDKEMIQHYTLDQ, KAIEEDLKHFNLKYE, KTPVLEIDGKQTHQS, DENSKQKKWDPLKKE, QKKWDPLKKETIPYY, PLKKETIPYYTKKFD, TIPYYTKKFDEVVKA, TKKFDEVVKANGGYL, YFVAILDYLNHMAKE, QPNLKALREKVLGLP, ALREKVLGLPAIKAW, VLGLPAIKAWVAKRP, VLEKLEAGFAKLAAS, FGSTLLDVIQSGLEN, NDIEKRVPFSHDDRL, ALNSIQQFISSEMVE, VEALFLLMKADPSIH, DPSIHVLKMVAELTH, PKSMLLNIFTNNLGR, LNIFTNNLGRINTHV, KTLVKFVEGNLKYFN, LKYFNMGVQKFWAFD, MGVQKFWAFDNTTFS, NASAVIQEFLKTYKK, HTKLSSSSSITLTLP, SVNATVVRLQSWQSE, VVRLQSWQSEMLRMN, PRHGEQFYYFYQQIY, DYQSYRTLMRKVYDA, GQEYTFYVIVTPYAK, KAIFIKCDVTNIPEF, IVINNAGILNDEKWE, KEFANVVRVVRHTSK, RIKAFLALVECPCNK, FRKFSNNFEFSYLLG, NVIYSQNSFLPRATT, RLFGAEVGWLALHHN, LVYPTSLGFPLKLVL, SHVHFRFVPSAAVEF, KKLQFTYSESLDLDD, AQIQVVIHLDEQYIY, GVTPVFYNMVKQGLV, SEVTALNRQIGGTPI, or GKDYILRVSQLGHTV, or a subsequence, portion, homologue, variant or derivative thereof, as described herein, (e.g. peptides of the AR Epitope Set in Table 8) and determining if the one or more proteins or peptides modulates an immune response or activity of the contacted cell (e.g., T cell). A determination that the one or more Cockroach proteins or peptides modulates an immune response or immune activity of the contacted cell indicates that the subject has allergic rhinitis.

[0217] The terms determining, assaying and measuring and grammatical variations thereof are used interchangeably herein and refer to either qualitative or quantitative determinations, or both qualitative and quantitative determinations, that involve manipulation or processing. When the terms are used in reference to measurement or detection, any means of assessing the relative amount, including the various methods set forth herein and known in the art, performed by the hand of man, is contemplated.

[0218] The invention provides kits including Cockroach protein, peptide, subsequence, portion, homologue, variant or derivative thereof (e.g., of an amino acid sequence of a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8), combination compositions and pharmaceutical formulations thereof, packaged into suitable packaging material. Kits can be used in various in vitro, ex vivo and in vivo methods and uses, for example a treatment method or use as disclosed herein.

[0219] A kit typically includes a label or packaging insert including a description of the components or instructions for use in vitro, in vivo, or ex vivo, of the components therein. A kit can contain a collection of such components, e.g., a Cockroach protein, peptide, subsequence, portion, homologue, variant or derivative thereof (e.g., of an amino acid sequence of a Cockroach protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8, alone, or in combination with another therapeutically useful composition (e.g., an immune modulatory drug).

[0220] The term packaging material refers to a physical structure housing the components of the kit. The packaging material can maintain the components sterilely, and can be made of material commonly used for such purposes (e.g., paper, corrugated fiber, glass, plastic, foil, ampules, vials, tubes, etc.).

[0221] Kits of the invention can include labels or inserts. Labels or inserts include printed matter, e.g., paper or cardboard, or separate or affixed to a component, a kit or packing material (e.g., a box), or attached to an ampule, tube or vial containing a kit component. Labels or inserts can additionally include a computer readable medium, such as a disk (e.g., hard disk), optical disk such as CD- or DVD-ROM/RAM, DVD, MP3, magnetic tape, or an electrical storage media such as RAM and ROM or hybrids of these such as magnetic/optical storage media, FLASH media or memory type cards.

[0222] Labels or inserts can include identifying information of one or more components therein, dose amounts, clinical pharmacology of the active ingredient(s) including mechanism of action, pharmacokinetics and pharmacodynamics. Labels or inserts can include information identifying manufacturer information, lot numbers, manufacturer location and date.

[0223] Labels or inserts can include information on a condition, disorder, disease or symptom for which a kit component may be used. Labels or inserts can include instructions for the clinician or for a subject for using one or more of the kit components in a method, use, treatment protocol or therapeutic regimen. Instructions can include dosage amounts, frequency or duration, and instructions for practicing any of the methods and uses, treatment protocols or therapeutic regimes set forth herein. Exemplary instructions include, instructions for modulating an immune response or activity of a cell against an allergen; modulating an immune response against an allergen in a subject; desensitizing, or inducing, eliciting, increasing or improving immunological tolerance to a protein or peptide allergen; reducing risk or providing a subject protection against an allergic reaction, allergic response, allergic disorder or allergic disease; treating an allergic reaction, allergic response, allergic disorder or allergic disease; or detecting an allergic response or diagnosing an allergy in a subject (e.g., a Cockroach allergy such as to a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16).

[0224] Labels or inserts can include information on any benefit that a component may provide, such as a prophylactic or therapeutic benefit. Labels or inserts can include information on potential adverse side effects, such as warnings to the subject or clinician regarding situations where it would not be appropriate to use a particular composition. Adverse side effects could also occur when the subject has, will be or is currently taking one or more other medications that may be incompatible with the composition, or the subject has, will be or is currently undergoing another treatment protocol or therapeutic regimen which would be incompatible with the composition and, therefore, instructions could include information regarding such incompatibilities.

[0225] Invention kits can additionally include other components. Each component of the kit can be enclosed within an individual container and all of the various containers can be within a single package. Invention kits can be designed for cold storage. Invention kits can further be designed to contain to the protein, peptide, subsequence, portion, homologue, variant or derivative thereof (e.g., of a Cockroach allergen such as a protein or peptide of Cockroach enolase, Hsp60, RACK1, TP1, trypsin, vitellogenin, Bla g 1, Bla g 1.0101, Bla g 2, Bla g 4, Bla g 5, Bla g 6, Bla g 6.0101, Bla g 6.0201, Bla g 7, Bla g 9, Bla g 11, NBGA1, NBGA2, NBGA3, NBGA4, NBGA5, NBGA6, NBGA7, NBGA8, NBGA9, NBGA10, NBGA11, NBGA12, NBGA13, NBGA14, NBGA15, or NBGA16, or a Cockroach protein or peptide set forth in any of Tables 5-8), or combination compositions or pharmaceutical compositions.

[0226] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the invention, suitable methods and materials are described herein.

[0227] All publications and patent applications cited in this specification are herein incorporated by reference as if each individual publication or patent application were specifically and individually indicated to be incorporated by reference. The citation of any publication is for its disclosure prior to the filing date and should not be construed as an admission that the invention is not entitled to antedate such publication by virtue of prior invention.

[0228] As used in this specification and the appended claims, the use of an indefinite article or the singular forms a, an and the include plural reference unless the context clearly dictates otherwise. In addition, it should be understood that the individual peptides, proteins, antigens, allergens (referred to collectively as compositions), or groups of compositions, modeled or derived from the various components or combinations of the compositions, and substituents described herein, are disclosed by the application to the same extent as if each composition or group of compositions was set forth individually. Thus, selection of particular peptides, proteins, antigens, allergens, etc. is clearly within the scope of the invention.

[0229] As used in this specification and the appended claims, the terms comprise, comprising, comprises and other forms of these terms are intended in the non-limiting inclusive sense, that is, to include particular recited elements or components without excluding any other element or component. Unless defined otherwise all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art to which this invention belongs. As used herein, about means+ or 5%. The use of the alternative (e.g., or) should be understood to mean one, both, or any combination thereof of the alternatives, i.e., or can also refer to and.

[0230] As used in this specification and the appended claims, any concentration range, percentage range, ratio range or other integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one tenth and one hundredth of an integer), unless otherwise indicated. For example, although numerical values are often presented in a range format throughout this document, a range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the use of a range expressly includes all possible subranges, all individual numerical values within that range, and all numerical values or numerical ranges including integers within such ranges and fractions of the values or the integers within ranges unless the context clearly indicates otherwise. This construction applies regardless of the breadth of the range and in all contexts throughout this patent document. Thus, to illustrate, reference to a range of 90-100% includes 91-99%, 92-98%, 93-95%, 91-98%, 91-97%, 91-96%, 91-95%, 91-94%, 91-93%, and so forth. Reference to a range of 90-100%, includes 91%, 92%, 93%, 94%, 95%, 95%, 97%, etc., as well as 91.1%, 91.2%, 91.3%, 91.4%, 91.5%, etc., 92.1%, 92.2%, 92.3%, 92.4%, 92.5%, etc., and so forth. Reference to a range of 5-10, 10-20, 20-30, 30-40, 40-50, 50-75, 75-100, 100-150, and 150-175, includes ranges such as 5-20, 5-30, 5-40, 5-50, 5-75, 5-100, 5-150, 5-171, and 10-30, 10-40, 10-50, 10-75, 10-100, 10-150, 10-175, and 20-40, 20-50, 20-75, 20-100, 20-150, 20-175, and so forth. Further, for example, reference to a series of ranges of 2-72 hours, 2-48 hours, 4-24 hours, 4-18 hours and 6-12 hours, includes ranges of 2-6 hours, 2, 12 hours, 2-18 hours, 2-24 hours, etc., and 4-27 hours, 4-48 hours, 4-6 hours, etc.

[0231] Certain abbreviations, as used in this specification and the appended claims, are defined as follows: AR: Allergic rhinitis; BLAGA: Blattella germanica allergen; IA: Intermediate asthma; MMA: Mild/moderate asthma; NBGA: Novel Bla g antigen; ORF: Open reading frame; PBMC: Peripheral blood mononuclear cells; RACK1: Receptor for activated protein kinase C; SA: Severe asthma; SFC: Spot forming cells; TG: Timothy grass; and TPI: Triosephosphate isomerase.

[0232] Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it is readily apparent to those of ordinary skill in the art in light of the teachings of this invention that certain changes and modifications may be made thereto without departing from the spirit or scope of the appended claims. The invention is further exemplified by way of the following non-limited examples.

[0233] The invention is further exemplified by way of the following non-limited examples.

EXAMPLES

Example 1

[0234] This example includes a description of various materials and methods.

[0235] Study Subject Populations:

[0236] Subjects displaying symptoms of allergic rhinitis were recruited from St. Louis, New York City, Boston, and Cleveland clinics, following Institutional Review Board approved protocols and informed consent. Each was assigned a study identification number. Subjects with a skin prick test (wheal 3 mm) and IgE titers toward Bla g extract (0.35 kUA/L by ImmunoCAP assay) were classified as Bla g sensitized. Otherwise, individuals with negative skin prick tests and negative IgE titers were classified as controls. Subjects were further classified as allergic rhinitis and no asthma (AR), intermittent asthma (IA), mild/moderate asthma (MMA), or severe asthma (SA)) by clinical history, questionnaires, and medication scores. Asthma or allergic rhinitis status was based on having either 1) diagnosis by a doctor over 1 year before recruitment, or 2) meeting specific symptom criteria if no diagnosis or a recent diagnosis. Asthma severity classifications were based on current controller medication requirements and use of prednisone in the last year. Cockroach-sensitive individuals who were screened and did not meet these criteria were not enrolled.

[0237] Pertinent subject information is summarized in Table 3. In addition, a group of ten non-allergic donors (no allergic rhinitis symptoms and non Bla g sensitized) recruited in the San Diego area were included as non-allergic controls.

[0238] Generation of Bla g Transcriptome:

[0239] Blattella germanica females used for the whole transcriptome analysis were obtained from a colony reared at the Institut de Biologia Evolutiva (CSIC-UPF) at 30 C. and 70% humidity, supplied with water at libitum and a commercial dog food diet. The whole transcriptome was analyzed in three different tissues, fat body, ovary, and epidermis. Fat body and ovaries were taken from 3-day-old to 5-day-old adults, while the epidermis was obtained from the thoracic dorsum of 5-day-old and 6-day-old 6.sup.th instar nymphs. Three animals were used to pool ovary and epithelium, and five were necessary to pool the fat body. Total RNA was extracted with the GenElute Mammalian Total RNA Miniprep Kit (Sigma-Aldrich). RNA samples were sent to be sequenced at GATC-Biotech (Konstanz, Germany) by Roche pyrosequencing technology (454), a method of choice for generating library data from those species without genome annotated.sup.30,31, as it provides large reads that facilitates the de novo assembly. Data from the four libraries are accessible at the GEO database (accession code GSE63921).

[0240] Proteomic Analysis of Bla g Extract:

[0241] Novel Bla g antigens were identified as described in Schulten, et al 2013 for TG. Briefly, Bla g extract (Greer, cat#XPB46D3A4) and pooled sera from 15 Bla g allergic subjects were submitted to Applied Biomics for analysis. 2-D gels (3-10 pH range, 12% (vol/vol) acrylamide) of Bla g extract were incubated with the pool of sera and stained with goat anti-human IgE and rabbit anti-human IgG (Sigma-Aldrich), and visualized by using Cy2-conjugated donkey anti-goat IgG and Cy5-conjugated donkey anti-mouse IgG antibodies (Biotium). This was followed by mass spectrometry analysis of positive IgE and/or IgG protein spots and MALDI spectra were compared against the Bla g transcriptome, using MASCOT. 16 unique novel potential ORFs were identified (Table 4). A more detailed description of proteomic identification is in Supplementary Methods.

[0242] Peptide Synthesis and MHC Class II Binding Predictions:

[0243] 809 15-mer peptides overlapping by 5 residues were synthesized covering Bla g allergens, Bla g 1-9 and 11. In addition, from the proteomic identified sequences, 646 15-mer peptides with predicted promiscuous binding to MHC class II alleles were selected as described (Paul et al, submitted) and synthesized. Finally, 233 promiscuous binding 15-mer peptides from recently identified antigens (vitellogenin, Hsp60, enolase, triosephosphate isomerase (TPI), trypsin, and RACK1) were synthesized. In total, 1514 15-mer peptides were synthesized for epitope identification (Table 5). A more detailed description of binding prediction and peptide synthesis is in Supplementary Methods.

[0244] PBMC Isolation and Cell Cultures:

[0245] PBMC (peripheral blood mononuclear cells) were isolated from 450 mL (one unit) of blood by density gradient centrifugation as described and cryopreserved. For in vitro expansion of PBMC for peptide screening, cells were cultured in RPMI1640 (Omega Scientific)+5% human AB serum (Gemini Bioscience), GlutaMAX (Gibco), and penicillin/streptomycin (Omega Scientific) at 210.sup.6 per mL, stimulated with 10 ug/mL Bla g extract (Greer), and incubated at 37 C. in 5% CO.sub.2. Every three days, IL-2 and IL-7 (10 U/mL) were added to the cultures. Cells were harvested for peptide screening at day 14.

[0246] ELISPOT Assays:

[0247] Production of IFN, IL-5, IL-17, IL-10, and IL-21 (as representative of T.sub.H1, T.sub.H2, T.sub.H17, T.sub.R1, and T.sub.FH, respectively) in response to peptide stimulation was measured by ELISPOT as described previously. Antibodies used in ELISPOT were (coating and secondary, respectively): for IFN/IL-5 dual plates: anti-IFN clone 1-D1K and anti-IL-5 clone TRK5, anti-IFN-HRP clone GZ-4 and anti-IL-5-biotin clone 5A10; for IL-10/IL-17 dual plates: anti-IL-10 clone 9D7 and anti-IL-17 clone MT44.6, and anti-IL-10-ALP clone 12G8 and anti-IL-17-biotin clone MT504; for IL-21 single plates: anti-IL-21 clone MT21.4/821 and anti-IL-21-biotin clone MT21.3m (all from Mabtech). In brief, 110.sup.5 cells per well were incubated with peptide, peptide pool, or Bla g extract (10, 5, and 10 ug/ml, respectively) on anti-lymphokine antibody coated ELISPOT plates (Millipore #MSIPS4510) for 22 hours. Subsequently, secondary anti-lymphokine antibodies were added and incubated for 2 hours, washed, and avidin-peroxidase complex added for 1 hour. Plates were washed and spots developed with 3-amino-9-ethylcarbazole (Sigma #A6926) and Vector Blue (Vector #SK-5300) for IFN/IL-5 and IL-10/IL-17 dual plates or TMB (Sigma #T0565) for single IL-21. Criteria for peptide pool positivity were at least 100 spot forming cells (SFC) per 10.sup.6 PBMC, p0.05, and stimulation index 2. Criteria for peptide positivity were identical except with a threshold of 20 SFCs.

Example 2

[0248] This example includes a description of various Supplementary materials and methods.

[0249] Identification of Novel Bla g Extract Proteins:

[0250] To identify IgE and IgG reactive proteins from whole Bla g, a cockroach extract sample was run on two 2-D gels [3-10 pH range, 12% (vol/vol) acrylamide] followed by MS analysis of individual proteins spots (performed by Applied Biomics). One gel was stained with Coomassie blue, and the other was blotted onto a nitrocellulose membrane. The membrane was then incubated with 5% dried milk in PBS/0.05% Tween to block nonspecific binding, and subsequently probed with serum pooled from five Bla g-sensitive individuals at a dilution of 1:250. IgE and IgG binding were detected using goat anti-human IgE and rabbit anti-human IgG (Sigma-Aldrich), and visualized by using Cy2-conjugated donkey anti-goat IgG and Cy5-conjugated donkey anti-mouse IgG antibodies (Biotium).

[0251] Spots recognized by IgG, IgE, both or neither, were selected from the 2D blot, and the corresponding spots were identified on the stained SDS gel, cut out, and washed several times to remove staining dye and other inhibitory chemicals. To ensure that the correct spots were identified on the unstained gel, all gels (gel that was blotted, gel that was stained with Coomassie, and the unstained gel from which the spots were eventually picked) were run at the same time and under the exact same conditions to allow the assumption that the proteins run in the same x-y positions of the gels. Furthermore, for the spots selected from the blot, specialized software was used. Proteins on both the Western blot and the unstained gel were labeled with CyDye, which the software was able to align to ensure that the automated spot picker selected the right spots.

[0252] Spots were then dried to absorb maximum digestion buffer. Dried 2D gel spots were rehydrated in digestion buffer containing trypsin. Proteins were digested in gel at 37 C. and then extracted from the gel with TFA extraction buffer. Subsequently, the peptides were desalted by using C-18 Zip-tips, (Millipore) mixed with an -cyano-4-hydroxycinnamic acid matrix, and spotted into wells of a MALDI plate. Mass spectra of the peptides in each sample were obtained by using an Applied Biosystems Proteomics Analyzer.

[0253] Generation of Putative Protein Transcripts for Epitope Predictions:

[0254] In parallel, we obtained transcripts from Bla g mRNA that had been deep-sequenced by X. Belles (Institute of Evolutionary Biology, Barcelona Spain). Freshly ecdysed sixth (last) instar nymphs and adult females of the Bla g were obtained from a colony reared in the dark at 301 C. and 60-70% relative humidity. For the WB-6 samples, the entire animal except the head (to avoid interferences with the eye pigments) and the digestive tube (to avoid contamination with parasites) was used. Stage specific samples of 2-3 individuals were collected for each of the 9 days of the last instar nymph. Then a pool composed by day 0 to 8 aliquots was built in order to cover the entire last instar nymph. For the Ov-A samples, we dissected the ovary pair from adult virgin cockroaches in each day of the first gonadotrophic cycle, which lasts 8 days. The pooling procedure to get an extract covering in this case the whole first gonadotrophic cycle was equivalent to that followed in the WB-6 extract. All dissections and tissue sampling were carried out on carbon dioxide-anaesthetized individuals. RNA isolation from WB-6 and Ov-A samples was carried out with mirVana miRNA Isolated kit (Ambion), which increases the yield of small RNAs. The total amount of RNA in WB-6 and Ov-A samples was approximately 10 g. Sequencing was performed on an Illumina Genome Analyzer with Solexa technology.

[0255] The spectra were compared with the amino acid sequences encoded by the longest putative ORFs from the each of the de novo-assembled cockroach transcripts. All ORFs that had a >95% confidence hit as evaluated by the Mascot software package (Matrix Science) were considered hits. The amino acid sequences encoded by these ORFs were used for epitope prediction.

[0256] Epitope Prediction from Bla g Proteins:

[0257] Next the novel sequences were analyzed to predict HLA class II promiscuous binders. Protein ID details (total protein IDs count=95) were narrowed to consider only protein details with high confidence (76 entries), and further narrowed by removing duplicate accession numbers. The remaining 37 sequences were clustered using Epitope Cluster Analysis tool available through the IEDB Analysis Resource (http://tools.immuneepitope.org/tools/cluster/iedb_input) and BLAST 2 Sequences at NCBI (www.ncbi.nlm.nih.gov/blast/bl2seq/wblast2.cgi). The longest sequence in each cluster was considered as the reference sequence for the particular cluster and all other sequences in the cluster were aligned to the reference sequence using MEGA (http://megasoftware.net/). All sequences in each cluster were >60% identical to the respective reference sequence with >75% sequence coverage. A total of 19 unique clusters were obtained.

[0258] Next, each cluster was compared to known allergens from allergen.org. Cluster-8 was found to correspond to the known allergen Bla g 7, and was thus excluded from further analysis. Cluster-2 was 53% identical out of 96% coverage to the Per a 3 allergen from Periplaneta americana (American cockroach) & 51% identical out of 95% coverage to Bla g 3. However, as Bla g 3 has not been previously characterized (and is not present in allergen.org), Cluster-2 was retained in the analysis.

[0259] Each of the 18 remaining clusters was subjected to BLAST analysis at GenBank to identify similar proteins, and the best hit was noted. The 6 known Bla g allergens (1, 2, 4, 5, 6, 7) were included as a control set. To generate 15-mers for all protein clusters separately we generated 15-mer peptides overlapping by 10 residues, starting at position 1, and included a peptide covering the C-terminus. For example, for a 27-residue protein peptides 1-15, 6-20, 11-25 and 13-27 would be selected. For Clusters-1 and -2, all 15-mers from the reference sequence (longest sequence+other sequences at the ends if applicable) were included and additionally the 15-mers from other proteins of the same cluster that had 2 or more amino acid substitutions were also included. We removed 15-mers with X (3 from Cluster-16, 3 from Cluster-18 and 2 from Cluster-19).

[0260] To characterize the predicted HLA class II binding capacity of each peptide, we selected 24 common alleles for which algorithms were available. The MHC binding affinity for all 15-mers for each allele was generated using the stand-alone version of IEDB's MHC class II epitope prediction tool. Each allele was predicted independently using the IEDB's recommended approach, which for all alleles except DRB3*02:02 was the consensus method; for DRB3*02:02, where nn_align & smm_align methods are currently not available, the IEDB recommended is NetmhcIIpan. For each 15-mer, the number of alleles with an IEDB percentile score 20 was tabulated as a measure of promiscuity. All 15-mers predicted at the 20.sup.th percentile for 12 or more alleles (i.e., 50% of the total no. of alleles considered) were considered promiscuous binders. For clusters that had less than 5 15-mers at the above threshold, the selection threshold was lowered so as to include at least 5 15-mers from each cluster.

[0261] To ensure that each allergen is adequately represented in the final selected peptide set, the number of peptides for each protein cluster was determined after excluding peptides located within the first 20 residues of the N-terminus (which likely contain signal sequences) as well as redundancy from directly overlapping peptides (e.g., for peptides spanning 56-70 and 61-75, only the one with the highest predicted promiscuity was selected). Cluster-18 had only one valid peptide as per these criteria while all others had greater than or equal to 2 peptides. Accordingly, the selection threshold for Cluster-18 was also lowered until an additional peptide was identified; thereby ensuring that in the final selection at least 2 peptides from each cluster was included. In total, a final set of 318 predicted binders was selected from the novel allergen set, and synthesized as crude material on the 1 mg scale.

[0262] Epitope prediction from recent Bla g sequences from literature: Following a methodology similar to that described above, 15-mers were generated to span each of 8 novel Bla g antigens from both references (i.e., 2 from Jeong and 6 from Chuang).sup.11,17, as per standard protocol after aligning the sequences with previously identified proteins. We next predicted binding affinity for all 15mers for 24 class II alleles as above (Section 4). For all 15-mers the number of alleles with an IEDB percentile score 20 was tabulated as a measure of promiscuity. All 15-mers with 12 or more alleles (50% of the total no. of alleles considered) predicted at that threshold were selected as candidate promiscuous binders (n=178). Further analysis identified that 110 of these peptides were already present in sets of previously selected binders. After removal of these redundant peptides, final set of 68 new promiscuous binders was selected for further analysis. Of these 68, 8 are variants of the previously predicted binders. All 8 novel antigens identified in the Jeong and Chuang studies were represented by at least 5 15-mers in the final set of 68 selected peptides (and all 8 antigens were represented by more than 2 15-mers after exclusion of signal sequence region and directly overlapping 15-mers). These peptides were also synthesized as crude material on the 1 mg scale (3561 series).

Example 3

[0263] This example includes a description of study design for immunological characterization of Bla g allergens.

[0264] To characterize reactivity of Bla g sensitized subjects as a function of disease severity, we assembled a cohort of 90 subjects adult study participants, recruited from St Louis, New York City, Boston, and Cleveland (Table 3). Each donor provided a unit blood donation and was classified as Bla g sensitized (Bla g IgE titer 0.35 kUA/mL and skin prick test wheal 3 mm) or as control (0.35 Bla g IgE titer and skin prick test). Sensitized individuals were classified as allergic rhinitis and no asthma (AR), intermittent asthma (IA), mild/moderate asthma (MMA), or severe asthma (SA) based on clinical history, questionnaires, and medication scores. These subjects were 77% female and ranged in age from 19 to 56.

[0265] We synthesized overlapping peptide sets of 15 amino acids in length overlapping by 10 residues and covering the entire sequence of known Bla g Allergens, i.e. Bla g 1-7, 9 and 11, referred from hereafter collectively as BLAGA. A total of 809 BLAGA peptides were arranged in pools, encompassing on average 20 peptides.

Example 4

[0266] This example includes a description of differential immune reactivity and immunodominance against Bla g allergens in sensitized versus non-sensitized controls.

[0267] To assess T cell reactivity, we utilized a strategy applied to the definition of epitopes from various allergen sources.sup.15,16 utilizing in vitro stimulation with allergen extracts. Here, PBMC from each subject were stimulated in vitro with Bla g extract. After 14 days, pools of overlapping 15-mer peptides from the BLAGA were tested for responses, and positive pools deconvoluted to identify the specific epitopes. As readout, we utilized ELISPOT assays specific for IL-5, IFN, IL-10, IL-17 and IL-21, chosen as representative of T.sub.H2, T.sub.H1, T.sub.R1, T.sub.H17 and T.sub.FH reactivity, respectively.

[0268] FIG. 1A, depicts for each subject the overall response (expressed as total SFC/10.sup.6 PBMC for all BLAGA and for all cytokines). Vigorous T cell responses were detected against BLAGA in Bla g sensitized donors. As expected, the non-Bla g sensitized controls were associated with lower responses.

[0269] In the sensitized donors, Bla g 5, Bla g 4, Bla g 9 and Bla g 11 were immunodominant (FIG. 1B). In the non-Bla g sensitized controls Bla g 4 and 9 still relatively imunodominant, while Bla g 5 and Bla g 11 were hardly recognized at all.

[0270] As expected, the most dominant cytokine detected in Bla g sensitized individuals was IL-5 (FIG. 1C), followed by IL-10 and IFN. The levels of IL-5, IFN, and IL-10 were significantly lower in non-sensitized controls, and in fact IL-10 secretion in response to BLAGA was not detected in the control subjects. Lower levels of IL-17 and IL-21 were also detected, not significantly different between sensitized and control individuals.

Example 5

[0271] This example includes a definition of novel Bla g T cell antigens.

[0272] In the studies described above, 44% of sensitized subjects responded to extract stimulation but did not respond to any of the BLAGA peptides (data not shown). This suggested that additional uncharacterized antigenic proteins are present in the extract, in addition to the ten BLAGA commonly described.

[0273] Schulten et al recently described how novel T cell antigens can be discovered by a proteomic approach combined with HLA-binding predictions.sup.16,32 The same approach was utilized here to identify potential novel Bla g antigens. To this end, transcripts from Bla g mRNA were deep-sequenced. Subsequently, 2-D gels of Bla g extract followed by mass spectrometry analysis of individual protein spots and MALDI spectra of the peptides from these spots were used to derive sequences (FIG. 2). These transcripts along with the MALDI-derived peptide sequences were assembled in 16 unique novel potential ORFs, referred to hereafter as NBGA 1-16 (Novel Bla g Antigens; Table 4 and 7). Independently using similar proteomic techniques, Jeong and colleagues.sup.11,33 and Chuang and colleagues.sup.16,17 identified additional NGBA, including Enolase, Hsp60, RACK1, TPI, Trypsin and Vitellogenin. In total, these studies defined 22 different NBGA, 7 of which were non-IgE reactive, and 15 of which had IgE reactivity as defined by the immunoblot analysis of FIG. 2 and the Jeong and Chuang studies.sup.11,17 These sequences were scanned for predicted promiscuous HLA class II binding peptides using a prediction scheme previously described.sup.16. A total of 879 peptides were selected for synthesis.

Example 6

[0274] This example includes data demonstrating that NBGA induce a substantial proportion of total T cell responses.

[0275] To determine if NBGA were targeted by T cell responses in sensitized subjects, cytokine release in response to each peptide, following 2-week in vitro extract stimulation was measured in similar fashion to FIG. 1. A total of 13 NBGA were associated with detectable levels of cytokine release in more than one subject (FIG. 3A). The novel antigen, NBGA1, dominated the response (FIG. 3A), accounting for approximately half of total NBGA response. Significant reactivity was also observed for several other antigens, including NBGA2-5, NBGA7, TPI and RACK1. By contrast, ten other antigens (NBGA8-16 and vitellogenin) were essentially negative for any cytokine specific responses.

[0276] As in the case of the BLAGA responses, different immunodominance patterns were observed in the controls as compared to the sensitized individuals. For example, NBGA1 was recognized as dominant in both sensitized and controls, while NBGA7 was essentially recognized only in sensitized individuals.

[0277] Remarkably, most of the reactivity of sensitized subjects was encompassed by IgE+ NBGA (shown in the left of FIG. 3A), while, with exception of the NBGA5, IgE-NBGA (shown in the right of FIG. 3A) were essentially negative. IgE+ NBGA reactivity for all cytokines was stronger compared to IgE-NBGA (FIG. 3B). IL-5 encompassed the majority of the response, but IFN, IL-10, IL-17, and IL-21 responses were also detected. Non-sensitized control subjects also preferentially recognized IgE+ NBGA, but with lower magnitudes than sensitized individuals (FIG. 3B). In conclusion, the data presented in this section demonstrate that significant T cell reactivity is associated with NGBA antigens, mostly directed to IgE+ positive antigens.

Example 7

[0278] This example includes data demonstrating breadth and immunodominance at the epitope level.

[0279] Overall, a total of 465 peptides were recognized in at least one of the subjects. Many of these peptides overlap each other and as such likely to encompass the same epitope. The data was examined next to eliminate redundancy and overlaps, as described in the methods section. Accordingly, a set of 356 non-redundant epitopes was derived.

[0280] The patterns of immunodominance and breadth of responses at the level of individual epitopes are shown in FIG. 4. A total of 56% of the sensitized subjects recognized at least one BLAGA epitope. Combining BLAGA and NBGA epitopes increased the percentage of subjects responding to at least one epitope to 79% (FIG. 4A). Thus, combined use of epitopes derived from BLAGA and NBGA accounts for coverage of a larger percentage of Bla g sensitive individuals than would be possible with either antigen class alone.

[0281] Overall, 50% of the subjects recognized 6 peptides or more (FIG. 4A). To account for 90% of the total response 164 epitopes, were required and 23 epitopes were required to capture 50% of the responses (FIG. 4B). A list of these 164 epitopes, and the corresponding average magnitudes and response rates, is provided in Table 6. Overall, these data underline the remarkable breadth of responses detected in sensitized donors, and clearly points to the value of a systematic epitope identification effort, to allow comprehensive coverage of the patient population and examination of the pattern of immune recognition associated with each individual subject.

Example 8

[0282] This example includes data demonstrating that polarization of T cell responses correlates with sensitization status, while magnitude of T cell responses correlate with Asthma status.

[0283] In the next series of analyses, we correlated magnitude and functionality of T.sub.H subset responses with the sensitization and asthma status as defined above. In terms of magnitude of responses, a geometric mean magnitude of 251 SFC/106 cells was noted in non-sensitized controls (FIG. 5). The magnitude of responses progressively increased in AR subjects (491 SFC), patients with IA (605 SFC), and MMA (1786 SFC, p<0.05 to controls). Responses were somewhat lower in SA (1134 SFC), although still significantly higher than the control group, perhaps reflective of the immunosuppressive nature of medications administered to the SA group.

[0284] In terms of polarization of T cell responses, similar to what was observed for TG.sup.16,18 allergy, the cytokine patterns observed in Bla g allergic patients was highly polarized, with responses in all allergic subjects being dominated by IL-5, and accounting for of the response across all groups. This pattern was similar regardless of the AR versus asthma status of the sensitized donors. By contrast, the T cell response in control subjects was not highly polarized, with similar amounts of IL-5 (32%), IFN (21%) and IL-10 (25%) being detected. Thus, the sensitization status correlated with increased IL-5 polarization of responses to Bla g antigens while the AR versus Asthma status correlated with increased magnitude of response.

Example 9

[0285] This example includes data showing differential immunodominance of BLAGA and NBGA in control, rhinitis and asthmatic subjects.

[0286] We next investigated the immunodominance patterns for BLAGA and NBGA antigens (FIG. 6 and Table 1). Table 1 lists, for each antigen and subject category, the percentage of subjects responding and the average total response/donor associated with each particular antigen. FIG. 6 shows the same data in a pie chart format, in which the study subjects were divided in non-sensitized controls, sensitized non-asthmatics, and sensitized asthmatics. We expected, based, on the data shown in FIGS. 1 and 3, that a different pattern of immunodominance would be observed between sensitized and non-sensitized individuals.

[0287] In non-sensitized controls >70% of the total response was encompassed by the two antigens, Bla g 9 and NBGA1 (FIG. 6A and Table 1). In subjects with allergic rhinitis (FIG. 6B and Table 1). NBGA1 still encompassed a significant proportion of the response (21.3%), however Bla g 4 was the most dominant (31.8% of response), and the response to Bla g 5 (21.6%) was equivalent to that seen in NBGA1 (21.3%).

[0288] Intriguingly, the pattern further shifted in the sensitized asthmatic donors (FIG. 6C and Table 1). Bla g 5 and NBGA1 still accounted for large proportions of the response (32.7% and 11.9%, respectively), but responses to Bla g 4 were nearly absent (1.6%). Responses to Bla g 9 increased to 24.4%, and Bla g 11, which had very low responses in controls and rhinitis, increased to 8.1%.

[0289] Remarkably, Bla g 2, which is a dominant target of IgE responses along with Bla g 5, accounted for only a minor fraction (<1%) of T cell reactivity among both rhinitis and asthmatic subjects, highlighting the lack of correlation between immunodominance for IgE and T cell responses, in agreement with what has been previously reported in other allergies.sup.15,18.

[0290] When the pattern of responsiveness amongst different asthma severity was considered, some further minor differences were observed. For example, NBGA1 and 7 seemed to be recognized most prominently in IA subjects (Table 1), but overall similar patterns were observed in the different categories of asthmatic patients.

Example 10

[0291] This example includes data showing differential epitope recognition as a function of disease state.

[0292] Based on the above results, which showed differential patterns of relative immunodominance in sensitized and control individuals on one hand and asthmatic versus non-asthmatic subjects on the other hand, we hypothesized that the epitopes identified could be partitioned in sets associated with preferential recognition by specific patient groups.

[0293] The results of this in silico analysis shown in Table 2, define a set of 55 epitope sequences (Rhinitis Set in Table 2) accounting for 84% of the total response in the rhinitis subjects, but only 20% of the response of asthmatic subjects. Similarly, an epitope set of 147 epitopes (Asthmatic Set) could be defined, associated with preferential recognition (55% of total response) in Bla g sensitized subjects with asthma, but recognized in lower frequencies in rhinitis subjects (5%).

Example 11

[0294] This example includes data showing differential recognition of disease specific epitope pools.

[0295] We next validated the specificity of recognition for putative disease-state epitope sets. Randomly selected subjects from the AR and asthmatic groups were cultured in vitro for 14-days in the presence of epitope pools, followed by overnight restimulation with the respective epitope sets described in Table 2. After a 14-day in vitro restimulation as above, responses against the epitope sets were measured. Responses were measured by ELISPOT, and the relative and absolute IFN, IL-5, IL-10, IL-17, and IL-21 responses were calculated.

[0296] As seen in FIG. 7A the median percentage of responses of asthmatic subjects was highest in response to the Asthma Pools and decreased in the case of the Rhinitis Pools. In fact, for ten of 14 asthmatic subjects the largest proportion (>40%) of the response was directed to the Asthma Pools. Conversely, the responses observed in the AR (sensitized but non-asthmatic) subjects were dominated by the Rhinitis Pools (FIG. 7B). In fact, for five of the nine AR subjects the largest proportion (>40%) of response was directed to the Rhinitis Pools, Results were similar when the absolute magnitude of responses, rather than the relative magnitudes were plotted (FIGS. 7C-D). Similar trends were also noted when cultures were restimulated with extract followed by assay with the various peptide pools. In this case, the response rate for control and rhinitis subjects was much lower (data not shown), indicating that stimulation with high concentration of well-defined epitopes provides stronger stimulus. Overall the data suggest that these epitope pools could have potential applications to differentiate between Bla g sensitized rhinitis and asthmatic subjects.

Example 12

[0297] The following is a discussion of the data herein.

[0298] In this study, a thorough characterization of the CD4.sup.+ T cell responses in cockroach allergy is provided, at the level of the antigens and epitopes recognized, at the level of the functionality of associated T cell responses, and as a function of sensitization and asthmatic status. We determined if a differential signature would be associated with controls versus rhinitis only patients, and versus asthmatics. Surprisingly, differences in terms of antigens dominantly recognized in Bla g sensitized subjects with and without asthma, and also versus control subjects were observed. This represents the first report of differential recognition between asthmatics and non-asthmatics of T cell antigens in respiratory allergens in general and Bla g sensitized individuals in particular.

[0299] The study overall investigated the reactivity of approximately 1,600 different Bla g derived synthetic peptides. While over 400 peptides were associated with some measurable T cell responses, and a total of 164 different epitopes were recognized in multiple donors, and 23 of them accounted for 50% of the total response.

[0300] Previous to the studies herein, the nature of human T cell epitopes had not been systematically investigated in this system and only 30 Bla g T cell epitopes were described.sup.15. Accordingly, the studies herein expanded by more than an order of magnitude the number of epitopes available for study.

[0301] At the antigen level, the whole sequence of all classically defined Bla g allergens, Bla g 1, 2, 4-7, 9 and 11 was systematically investigated. These Bla g allergens only accounted for responses in 56% of Bla g sensitized individuals. To find the missing responses, transcriptomic/proteomic approach with Bla g extract and sensitized serum was employed. In Bla g extract, 16 novel antigens that had IgE and/or IgG reactivity in Bla g sensitized serum were identified. These novel antigens induced T cell responses in 43% of Bla g sensitized subjects, and the combined sets of Bla g and novel antigens were recognized by more than 79% of subjects.

[0302] Intriguingly, in direct contrast to what was detected for TG allergy, the non-IgE reactive antigens in Bla g extract had negligible T cell activity in all CD4.sup.+ subsets, suggesting a strong link between IgE and T cell activity in Bla g allergy. It is not apparent why different allergen species would have different patterns in IgE:T cell linkage at the antigen level. One possibility is that the T cell responses to TG epitopes from antigens that are not targeted by IgE are actually cross-reactive T cell responses specific for antigens from other pollen species that are targeted by IgE. Indeed, many TG epitopes show high cross-reactivity to other grass pollens. For Bla g antigens, a lesser degree of exposure to homologous antigens from other species may explain the stronger T cell:IgE linkage observed.

[0303] These data highlights how the combined transcriptomic/proteomic approach can expand the number of antigens associated with T cell reactivity. Given the fact that some of the sensitized donors which responded to extract did not see any of the known and novel proteins, it is likely that additional targets remain to be identified, which is also not completely surprising given the large number of proteins transcribed by the cockroach genome.

[0304] Certain allergens known to be dominant in terms of IgE responses, such as Bla g 2 was the target of only less than 4% of the total CD4.sup.+ T cell response to the Bla g antigens. Conversely other allergens less dominant at the IgE level, such as Bla g 9 and Bla g 4, and a novel antigen NBGA1 were immunodominant for T cell responses, accounted cumulatively for more than 75% of the response, similar to other reports.sup.15,34 The NBGA5 antigen was fairly prominently recognized at the T cell level, despite not being targeted by IgE responses and would thus represent a potential candidate for safer T cell specific immunotherapy regimens.

[0305] Overall, the data suggests that Specific Immunotherapy approaches aimed at modulating T cell responses might not need to target the most dominant IgE binding proteins. Indeed, targeting the most dominant T cell antigens that are less prominent in terms of IgE binding might offer an effective and safer immunotherapeutic approach.

[0306] In terms of functionality and magnitude of T cell responses, as expected, the responses of non-sensitized donors were weaker and not effectively polarized. In the sensitized donors, the majority of the response was polarized to the T.sub.H2 subset, but significant responses were also detected for lymphokines associated with T.sub.H1, T.sub.H17, T.sub.R1, and T.sub.FH subsets. However in contrast to other reports on the correlation between T.sub.H17 responses and asthma.sup.24, the relative contribution of IL-17 response to Bla g antigens was equivalent between AR and asthmatic groups. The magnitude of responses was progressively increased in AR subjects, IA, and MMA. Responses were somewhat lower in SA group, although still significantly higher than the control group, perhaps reflective of the immunosuppressive nature of medications administered to the SA group.

[0307] The observed preferences in antigen recognition associated with clinical status, with the extensive epitope identification, was utilized to develop epitope sets that could differentiate between rhinitis and asthmatic subjects. These epitope sets could be used to isolate the corresponding allergen-specific cells and examining whether differences might exist at the level of their transcriptional or epigenetic profiles, or whether changes in the associated signatures might precede or follow the evolution of allergic disease, or asthma remission or exacerbation. In a broader sense, these epitope sets may have diagnostic value in providing a standardized laboratory test of asthmatic status.

TABLE-US-00001 TABLE 1 Differential Immunodominance of Bla g Antigens as a Function of Allergic Clinical Status. Controls AR Asthmatic IA MMA SA Antigen % SFC % SFC % SFC % SFC % SFC % SFC Bla g 1 5 2 15 188 6 9 44 1044 15 24 Bla g 2 12 44 9 44 3 26 33 154 8 12 Bla g 4 4 54 18 1389 20 85 21 58 33 286 8 11 Bla g 5 1 2 41 945 29 1704 21 1179 56 1827 31 2872 Bla g 9 3 314 12 192 47 1275 39 715 67 2281 54 1914 Bla g 11 2 6 18 170 36 424 30 416 44 676 46 271 NBGA1 7 290 29 932 47 621 39 700 56 406 62 579 NBGA2 2 6 12 78 13 78 12 40 11 246 15 53 NBGA3 6 21 24 123 15 71 33 85 39 273 NBGA4 3 30 24 289 16 136 18 151 22 197 8 59 NBGA5 2 11 12 33 7 19 6 17 15 37 NBGA7 1 50 29 194 16 287 18 442 22 96 8 49 NBGA11 1 15 Enolase 1 9 6 3 6 42 3 27 11 151 8 3 RACK1 2 30 9 19 12 31 11 3 TPI 2 17 6 13 11 31 6 6 11 83 23 54 % denotes percentage of subjects responding to given antigen. SFC denotes the mean magnitude of response. denotes no response. Asthmatic combines the responses across IA, MMA, SA.

TABLE-US-00002 TABLE 2 Bla g-Sensitivity and Asthma Classification by Epitope Sets. Epitope sets encompass epitopes denoted in Table 6. Percentages are calculated from the total response per subject to the epitope sets. Epitope Set No. Epitopes AR Asthmatic Control 16 <1 1 Rhinitis 55 84 20 Asthma 147 5 55 denotes no response.

TABLE-US-00003 TABLE 3 Subject Cohort Information. Individuals classified as Bla g sensitized (wheal >3 mm and IgE titers >0.35 kUA/L) or control. Subjects further subdivided by asthmatic status based on history, questionnaires, and medication scores. Age Bla g Range Wheal Bla g IgE Group/Asthma Severity Female Male (years) (mm) (kUA/L) Control No Asthma 7 6 21-56 0.2 BLD Control Intermittent 2 3 22-33 0.2 BLD Control Moderate 2 0 44-48 0.0 BLD Control Total 11 9 21-56 0.2 BLD Bla g sensitized No 12 4 20-45 5.4 9.5 Asthma Bla g sensitized 28 3 19-53 6.0 6.9 Intermittent Bla g sensitized Mild 3 1 35-51 5.5 17.9 Bla g sensitized 4 1 20-49 6.5 16.9 Moderate Bla g sensitized Severe 10 2 19-53 6.4 14.3 Bla g Sensitized Total 60 12 19-53 6.1 10.1 BLD = below limit of detection.

TABLE-US-00004 TABLE 4 Novel Bla g Proteins Discovered in Proteomic Screen. Full sequence mRNA accession IDs listed. Length of protein given in amino acid residues. Novel Bla g Antigen Accession ID Length NBGA1 AJ005115 1583 NBGA2 LN794619 731 NBGA3 LN794625 264 NBGA4 LN794631 1585 NBGA5 GBID01003088 718 NBGA6 LN794620 468 NBGA7 LN794623 343 NBGA8 LN794629 207 NBGA9 LN794621 203 NBGA10 LN794632 197 NBGA11 LN794630 193 NBGA12 LN794626 187 NBGA13 LN794624 143 NBGA14 LN794628 140 NBGA15 LN794627 133 NBGA16 LN794622 130

TABLE-US-00005 TABLE 5 Bla g Peptides Included in Epitope Screen. (SEQ ID NOs.: 257-1833) Sequence Antigen Position Set NAIEFLNNIHDLLGI Bla g 1 1 Known Allergens LNNIHDLLGIPHIPV Bla g 1 6 Known Allergens DLLGIPHIPVTARKH Bla g 1 11 Known Allergens PHIPVTARKHHRRGV Bla g 1 16 Known Allergens TARKHHRRGVGITGL Bla g 1 21 Known Allergens HRRGVGITGLIDDII Bla g 1 26 Known Allergens GITGLIDDIIAILPV Bla g 1 31 Known Allergens IDDIIAILPVDDLYA Bla g 1 36 Known Allergens AILPVDDLYALFQEK Bla g 1 41 Known Allergens DDLYALFQEKLETSP Bla g 1 46 Known Allergens LFQEKLETSPEFKAL Bla g 1 51 Known Allergens LETSPEFKALYDAIR Bla g 1 56 Known Allergens EFKALYDAIRSPEFQ Bla g 1 61 Known Allergens YDAIRSPEFQSIVGT Bla g 1 66 Known Allergens SPEFQSIVGTLEAMP Bla g 1 71 Known Allergens SIVGTLEAMPEYQNL Bla g 1 76 Known Allergens LEAMPEYQNLIQKLK Bla g 1 81 Known Allergens EYQNLIQKLKDKGVD Bla g 1 86 Known Allergens IQKLKDKGVDVDHII Bla g 1 91 Known Allergens DKGVDVDHIIELIHQ Bla g 1 96 Known Allergens VDHIIELIHQIFNIV Bla g 1 101 Known Allergens ELIHQIFNIVRDTRG Bla g 1 106 Known Allergens IFNIVRDTRGLPEDL Bla g 1 111 Known Allergens RDTRGLPEDLQDFLA Bla g 1 116 Known Allergens DTRGLPEDLQDFLAL Bla g 1 117 Known Allergens LPEDLQDFLALIPTD Bla g 1 121 Known Allergens QDFLALIPTDQVLAI Bla g 1 126 Known Allergens LIPTDQVLAIAADYL Bla g 1 131 Known Allergens QVLAIAADYLANDAE Bla g 1 136 Known Allergens AADYLANDAEVKAAV Bla g 1 141 Known Allergens ANDAEVKAAVEYLKS Bla g 1 146 Known Allergens VKAAVEYLKSDEFET Bla g 1 151 Known Allergens EYLKSDEFETIVVTV Bla g 1 156 Known Allergens DEFETIVVTVDSLPE Bla g 1 161 Known Allergens IVVTVDSLPEFKNFL Bla g 1 166 Known Allergens DSLPEFKNFLNFLQT Bla g 1 171 Known Allergens FKNFLNFLQTNGLNA Bla g 1 176 Known Allergens NFLQTNGLNAIEFLN Bla g 1 181 Known Allergens NGLNAIEFLNNIHDL Bla g 1 186 Known Allergens IEFLNNIHDLLGIPH Bla g 1 191 Known Allergens NIHDLLGIPHIPVTG Bla g 1 196 Known Allergens LGIPHIPVTGRKHLR Bla g 1 201 Known Allergens IPVTGRKHLRRGVGI Bla g 1 206 Known Allergens RKHLRRGVGITGLID Bla g 1 211 Known Allergens HLRRGVGITGLIDDI Bla g 1 213 Known Allergens RGVGITGLIDDIIAI Bla g 1 216 Known Allergens TGLIDDIIAILPVDD Bla g 1 221 Known Allergens DIIAILPVDDLYALF Bla g 1 226 Known Allergens LPVDDLYALFQEKLE Bla g 1 231 Known Allergens LYALFQEKLETSPEF Bla g 1 236 Known Allergens QEKLETSPEFKALYD Bla g 1 241 Known Allergens TSPEFKALYDAIRSP Bla g 1 246 Known Allergens KALYDAIRSPEFQSI Bla g 1 251 Known Allergens AIRSPEFQSIVETLK Bla g 1 256 Known Allergens EFQSIVETLKAMPEY Bla g 1 261 Known Allergens VETLKAMPEYQSLIQ Bla g 1 266 Known Allergens AMPEYQSLIQKLKDK Bla g 1 271 Known Allergens QSLIQKLKDKGVDVD Bla g 1 276 Known Allergens KLKDKGVDVDHIIEL Bla g 1 281 Known Allergens GVDVDHIIELIHQIF Bla g 1 286 Known Allergens HIIELIHQIFNIVRD Bla g 1 291 Known Allergens IHQIFNIVRDTRGLP Bla g 1 296 Known Allergens NIVRDTRGLPEDLQD Bla g 1 301 Known Allergens DTRGLPEDLQDFLAL Bla g 1 305 Known Allergens TRGLPEDLQDFLALI Bla g 1 306 Known Allergens EDLQDFLALIPIDQI Bla g 1 311 Known Allergens FLALIPIDQILAIAA Bla g 1 316 Known Allergens PIDQILAIAADYLAN Bla g 1 321 Known Allergens LAIAADYLANDAEVQ Bla g 1 326 Known Allergens DYLANDAEVQAAVEY Bla g 1 331 Known Allergens DAEVQAAVEYLKSDE Bla g 1 336 Known Allergens AAVEYLKSDEFETIV Bla g 1 341 Known Allergens LKSDEFETIVVTVDS Bla g 1 346 Known Allergens FETIVVTVDSLPEFK Bla g 1 351 Known Allergens VTVDSLPEFKNFLNF Bla g 1 356 Known Allergens LPEFKNFLNFLQTNG Bla g 1 361 Known Allergens NFLNFLQTNGLNAIE Bla g 1 366 Known Allergens LQTNGLNAIEFINNI Bla g 1 371 Known Allergens LNAIEFINNIHDLLG Bla g 1 376 Known Allergens FINNIHDLLGIPHIP Bla g 1 381 Known Allergens HDLLGIPHIPATGRK Bla g 1 386 Known Allergens IPHIPATGRKHVRRG Bla g 1 391 Known Allergens ATGRKHVRRGVGING Bla g 1 396 Known Allergens HVRRGVGINGLIDDV Bla g 1 401 Known Allergens VGINGLIDDVIAILP Bla g 1 406 Known Allergens LIDDVIAILPVDELY Bla g 1 411 Known Allergens IAILPVDELYALFQE Bla g 1 416 Known Allergens VDELYALFQEKLESS Bla g 1 421 Known Allergens ALFQEKLESSPEFKA Bla g 1 426 Known Allergens KLESSPEFKALYDAI Bla g 1 431 Known Allergens PEFKALYDAIRSPEF Bla g 1 436 Known Allergens LYDAIRSPEFQSIVQ Bla g 1 441 Known Allergens RSPEFQSIVQTLKAM Bla g 1 446 Known Allergens QSIVQTLKAMPEYQD Bla g 1 451 Known Allergens TLKAMPEYQDLIQRL Bla g 1 456 Known Allergens PEYQDLIQRLKDKGV Bla g 1 461 Known Allergens LIQRLKDKGVDVDHF Bla g 1 466 Known Allergens KDKGVDVDHFIELIK Bla g 1 471 Known Allergens DVDHFIELIKKLFGL Bla g 1 476 Known Allergens DHFIELIKKLFGLSH Bla g 1 478 Known Allergens NLLEKLREKGVDVDK Bla g 1.0101 1 Known Allergens LEKLREKGVDVDKII Bla g 1.0101 3 Known Allergens EKGVDVDKIIELIRA Bla g 1.0101 8 Known Allergens VDKIIELIRALFGLT Bla g 1.0101 13 Known Allergens KIIELIRALFGLTLN Bla g 1.0101 15 Known Allergens IRALFGLTLNAKASR Bla g 1.0101 20 Known Allergens GLTLNAKASRNLQDD Bla g 1.0101 25 Known Allergens AKASRNLQDDLQDFL Bla g 1.0101 30 Known Allergens KASRNLQDDLQDFLA Bla g 1.0101 31 Known Allergens ASRNLQDDLQDFLAL Bla g 1.0101 32 Known Allergens LQDDLQDFLALIPVD Bla g 1.0101 36 Known Allergens QDFLALIPVDQIIAI Bla g 1.0101 41 Known Allergens LIPVDQIIAIATDYL Bla g 1.0101 46 Known Allergens QIIAIATDYLANDAE Bla g 1.0101 51 Known Allergens ATDYLANDAEVQAAV Bla g 1.0101 56 Known Allergens ANDAEVQAAVAYLQS Bla g 1.0101 61 Known Allergens VQAAVAYLQSDEFET Bla g 1.0101 66 Known Allergens AYLQSDEFETIVVAL Bla g 1.0101 71 Known Allergens DEFETIVVALDALPE Bla g 1.0101 76 Known Allergens IVVALDALPELQNFL Bla g 1.0101 81 Known Allergens DALPELQNFLNFLEA Bla g 1.0101 86 Known Allergens LQNFLNFLEANGLNA Bla g 1.0101 91 Known Allergens NFLEANGLNAIDFLN Bla g 1.0101 96 Known Allergens NGLNAIDFLNGIHDL Bla g 1.0101 101 Known Allergens IDFLNGIHDLLGIPH Bla g 1.0101 106 Known Allergens GIHDLLGIPHIPVSG Bla g 1.0101 111 Known Allergens DLLGIPHIPVSGRKY Bla g 1.0101 114 Known Allergens PHIPVSGRKYHIRRG Bla g 1.0101 119 Known Allergens SGRKYHIRRGVGITG Bla g 1.0101 124 Known Allergens YHIRRGVGITGLIDD Bla g 1.0101 128 Known Allergens HIRRGVGITGLIDDV Bla g 1.0101 129 Known Allergens RGVGITGLIDDVLAI Bla g 1.0101 132 Known Allergens TGLIDDVLAILPIED Bla g 1.0101 137 Known Allergens DVLAILPIEDLKALF Bla g 1.0101 142 Known Allergens LPIEDLKALFNEKLE Bla g 1.0101 147 Known Allergens LKALFNEKLETSPDF Bla g 1.0101 152 Known Allergens NEKLETSPDFLALYN Bla g 1.0101 157 Known Allergens TSPDFLALYNAIRSP Bla g 1.0101 162 Known Allergens LALYNAIRSPEFQSI Bla g 1.0101 167 Known Allergens AIRSPEFQSIVQTLN Bla g 1.0101 172 Known Allergens EFQSIVQTLNAMPEY Bla g 1.0101 177 Known Allergens VQTLNAMPEYQNLLQ Bla g 1.0101 182 Known Allergens AMPEYQNLLQKLREK Bla g 1.0101 187 Known Allergens QNLLQKLREKGVDVD Bla g 1.0101 192 Known Allergens KLREKGVDVDKIIEL Bla g 1.0101 197 Known Allergens GVDVDKIIELIRALF Bla g 1.0101 202 Known Allergens KIIELIRALFGLTLN Bla g 1.0101 207 Known Allergens IRALFGLTLNGKASR Bla g 1.0101 212 Known Allergens GLTLNGKASRNLQDD Bla g 1.0101 217 Known Allergens LNGKASRNLQDDLQD Bla g 1.0101 220 Known Allergens GKASRNLQDDLQDFL Bla g 1.0101 222 Known Allergens KASRNLQDDLQDFLA Bla g 1.0101 223 Known Allergens ASRNLQDDLQDFLAL Bla g 1.0101 224 Known Allergens SRNLQDDLQDFLALI Bla g 1.0101 225 Known Allergens DDLQDFLALIPVDQI Bla g 1.0101 230 Known Allergens FLALIPVDQIIAIAT Bla g 1.0101 235 Known Allergens PVDQIIAIATDYLAN Bla g 1.0101 240 Known Allergens IAIATDYLANDAEVQ Bla g 1.0101 245 Known Allergens DYLANDAEVQAAVAY Bla g 1.0101 250 Known Allergens DAEVQAAVAYLQSDE Bla g 1.0101 255 Known Allergens AAVAYLQSDEFETIV Bla g 1.0101 260 Known Allergens LQSDEFETIVVTLDA Bla g 1.0101 265 Known Allergens FETIVVTLDALPELQ Bla g 1.0101 270 Known Allergens VTLDALPELQNFLNF Bla g 1.0101 275 Known Allergens LPELQNFLNFLEANG Bla g 1.0101 280 Known Allergens NFLNFLEANGLNAID Bla g 1.0101 285 Known Allergens LEANGLNAIDFLNGI Bla g 1.0101 290 Known Allergens LNAIDFLNGIHDLLG Bla g 1.0101 295 Known Allergens FLNGIHDLLGIPHIP Bla g 1.0101 300 Known Allergens HDLLGIPHIPVSGRK Bla g 1.0101 305 Known Allergens IPHIPVSGRKYHIRR Bla g 1.0101 310 Known Allergens VSGRKYHIRRGVGIT Bla g 1.0101 315 Known Allergens HIRRGVGITGLIDDV Bla g 1.0101 321 Known Allergens VGITGLIDDVLAILP Bla g 1.0101 326 Known Allergens LIDDVLAILPLDDLK Bla g 1.0101 331 Known Allergens LAILPLDDLKALFNE Bla g 1.0101 336 Known Allergens LDDLKALFNEKLETS Bla g 1.0101 341 Known Allergens ALFNEKLETSPDFLA Bla g 1.0101 346 Known Allergens KLETSPDFLALYNAI Bla g 1.0101 351 Known Allergens PDFLALYNAIKSPEF Bla g 1.0101 356 Known Allergens LYNAIKSPEFQSIVQ Bla g 1.0101 361 Known Allergens KSPEFQSIVQTLNAM Bla g 1.0101 366 Known Allergens QSIVQTLNAMPEYQN Bla g 1.0101 371 Known Allergens TLNAMPEYQNLLEKL Bla g 1.0101 376 Known Allergens PEYQNLLEKLREKGV Bla g 1.0101 381 Known Allergens LLEKLREKGVDVDKI Bla g 1.0101 386 Known Allergens REKGVDVDKIIELIR Bla g 1.0101 391 Known Allergens DVDKIIELIRALFGL Bla g 1.0101 396 Known Allergens DKIIELIRALFGLTH Bla g 1.0101 398 Known Allergens SQKDPHVWDGRSAIV Bla g 11 18 Known Allergens HLFEWKFADIADECE Bla g 11 33 Known Allergens KFADIADECERFLGP Bla g 11 38 Known Allergens ADECERFLGPKGFAG Bla g 11 43 Known Allergens RFLGPKGFAGVQVSP Bla g 11 48 Known Allergens VQVSPVHENVIISSP Bla g 11 58 Known Allergens IISSPFRPWWERYQL Bla g 11 68 Known Allergens VSYKLVSRSGDENAF Bla g 11 83 Known Allergens VSRSGDENAFRDMVR Bla g 11 88 Known Allergens DENAFRDMVRRCNNV Bla g 11 93 Known Allergens NQMSGSWPDAHGQGG Bla g 11 118 Known Allergens SWPDAHGQGGSTADT Bla g 11 123 Known Allergens HGQGGSTADTYNLQY Bla g 11 128 Known Allergens STADTYNLQYPAVPY Bla g 11 133 Known Allergens YNLQYPAVPYGPGDF Bla g 11 138 Known Allergens PAVPYGPGDFHSTCT Bla g 11 143 Known Allergens GPGDFHSTCTVSNYQ Bla g 11 148 Known Allergens HSTCTVSNYQDPSNV Bla g 11 153 Known Allergens VSNYQDPSNVRNCEL Bla g 11 158 Known Allergens DPSNVRNCELVGLHD Bla g 11 163 Known Allergens RNCELVGLHDLNQGS Bla g 11 168 Known Allergens VGLHDLNQGSDYVRG Bla g 11 173 Known Allergens LNHLVDCGVAGFRVD Bla g 11 193 Known Allergens AAKHMWPADLQYIYS Bla g 11 208 Known Allergens WPADLQYIYSKVNNL Bla g 11 213 Known Allergens QYIYSKVNNLNTDHG Bla g 11 218 Known Allergens KVNNLNTDHGFPSGA Bla g 11 223 Known Allergens NTDHGFPSGARPFFY Bla g 11 228 Known Allergens FPSGARPFFYQEVID Bla g 11 233 Known Allergens RPFFYQEVIDLGGEA Bla g 11 238 Known Allergens QEVIDLGGEAIHSTE Bla g 11 243 Known Allergens LGGEAIHSTEYTGFG Bla g 11 248 Known Allergens IHSTEYTGFGRVTEF Bla g 11 253 Known Allergens YTGFGRVTEFKYSRD Bla g 11 258 Known Allergens RVTEFKYSRDIGDAF Bla g 11 263 Known Allergens KYSRDIGDAFRGNNA Bla g 11 268 Known Allergens IGDAFRGNNAIKWLV Bla g 11 273 Known Allergens RGNNAIKWLVNFGVG Bla g 11 278 Known Allergens IKWLVNFGVGWGYIP Bla g 11 283 Known Allergens NFGVGWGYIPDGDAL Bla g 11 288 Known Allergens WGYIPDGDALVFVDN Bla g 11 293 Known Allergens DGDALVFVDNHDNQR Bla g 11 298 Known Allergens VFVDNHDNQRGHGAG Bla g 11 303 Known Allergens HDNQRGHGAGGASIL Bla g 11 308 Known Allergens GHGAGGASILTYKTS Bla g 11 313 Known Allergens GASILTYKTSKLYKM Bla g 11 318 Known Allergens TYKTSKLYKMAVAFM Bla g 11 323 Known Allergens KLYKMAVAFMLAYPY Bla g 11 328 Known Allergens AVAFMLAYPYGYPRV Bla g 11 333 Known Allergens LAYPYGYPRVMSSFS Bla g 11 338 Known Allergens GYPRVMSSFSFDNSD Bla g 11 343 Known Allergens MSSFSFDNSDQGPPQ Bla g 11 348 Known Allergens FDNSDQGPPQDGNGN Bla g 11 353 Known Allergens QGPPQDGNGNIISPS Bla g 11 358 Known Allergens DGNGNIISPSINADG Bla g 11 363 Known Allergens IISPSINADGTCGNG Bla g 11 368 Known Allergens INADGTCGNGWVCEH Bla g 11 373 Known Allergens TCGNGWVCEHRWRQI Bla g 11 378 Known Allergens WVCEHRWRQIFNMVG Bla g 11 383 Known Allergens RWRQIFNMVGFRNAV Bla g 11 388 Known Allergens FNMVGFRNAVAGTAV Bla g 11 393 Known Allergens FRNAVAGTAVSNWWD Bla g 11 398 Known Allergens AGTAVSNWWDNGDKQ Bla g 11 403 Known Allergens SNWWDNGDKQISFCR Bla g 11 408 Known Allergens NGDKQISFCRGNKGF Bla g 11 413 Known Allergens ISFCRGNKGFVAFND Bla g 11 418 Known Allergens GNKGFVAFNDEFNND Bla g 11 423 Known Allergens VAFNDEFNNDLKQTL Bla g 11 428 Known Allergens EFNNDLKQTLQTCLP Bla g 11 433 Known Allergens LKQTLQTCLPAGDYC Bla g 11 438 Known Allergens QTCLPAGDYCDVISG Bla g 11 443 Known Allergens AGDYCDVISGSYENG Bla g 11 448 Known Allergens DVISGSYENGSCTGK Bla g 11 453 Known Allergens SYENGSCTGKTVTVG Bla g 11 458 Known Allergens SCTGKTVTVGSDGKA Bla g 11 463 Known Allergens TVTVGSDGKAYIEIL Bla g 11 468 Known Allergens SDGKAYIEILSSADD Bla g 11 473 Known Allergens YIEILSSADDGVLAI Bla g 11 478 Known Allergens SSADDGVLAIHVNSK Bla g 11 483 Known Allergens GVLAIHVNSKVGSKS Bla g 11 488 Known Allergens HVNSKVGSKSQTTTT Bla g 11 493 Known Allergens VGSKSQTTTTQSSHC Bla g 11 498 Known Allergens KSQTTTTQSSHCTCS Bla g 11 503 Known Allergens MIGLKLVTVLFAVAT Bla g 2 1 Known Allergens LVTVLFAVATITHAA Bla g 2 6 Known Allergens FAVATITHAAELQRV Bla g 2 11 Known Allergens ITHAAELQRVPLYKL Bla g 2 16 Known Allergens ELQRVPLYKLVHVFI Bla g 2 21 Known Allergens PLYKLVHVFINTQYA Bla g 2 26 Known Allergens VHVFINTQYAGITKI Bla g 2 31 Known Allergens NTQYAGITKIGNQNF Bla g 2 36 Known Allergens GITKIGNQNFLTVFD Bla g 2 41 Known Allergens GNQNFLTVFDSTSCN Bla g 2 46 Known Allergens LTVFDSTSCNVVVAS Bla g 2 51 Known Allergens STSCNVVVASQECVG Bla g 2 56 Known Allergens VVVASQECVGGACVC Bla g 2 61 Known Allergens QECVGGACVCPNLQK Bla g 2 66 Known Allergens GACVCPNLQKYEKLK Bla g 2 71 Known Allergens PNLQKYEKLKPKYIS Bla g 2 76 Known Allergens YEKLKPKYISDGNVQ Bla g 2 81 Known Allergens PKYISDGNVQVKFFD Bla g 2 86 Known Allergens DGNVQVKFFDTGSAV Bla g 2 91 Known Allergens VKFFDTGSAVGRGIE Bla g 2 96 Known Allergens TGSAVGRGIEDSLTI Bla g 2 101 Known Allergens GRGIEDSLTISNLTT Bla g 2 106 Known Allergens DSLTISNLTTSQQDI Bla g 2 111 Known Allergens SNLTTSQQDIVLADE Bla g 2 116 Known Allergens SQQDIVLADELSQEV Bla g 2 121 Known Allergens VLADELSQEVCILSA Bla g 2 126 Known Allergens LSQEVCILSADVVVG Bla g 2 131 Known Allergens CILSADVVVGIAAPG Bla g 2 136 Known Allergens DVVVGIAAPGCPNAL Bla g 2 141 Known Allergens IAAPGCPNALKGKTV Bla g 2 146 Known Allergens CPNALKGKTVLENFV Bla g 2 151 Known Allergens KGKTVLENFVEENLI Bla g 2 156 Known Allergens LENFVEENLIAPVFS Bla g 2 161 Known Allergens EENLIAPVFSIHHAR Bla g 2 166 Known Allergens APVFSIHHARFQDGE Bla g 2 171 Known Allergens IHHARFQDGEHFGEI Bla g 2 176 Known Allergens FQDGEHFGEIIFGGS Bla g 2 181 Known Allergens HFGEIIFGGSDWKYV Bla g 2 186 Known Allergens IFGGSDWKYVDGEFT Bla g 2 191 Known Allergens DWKYVDGEFTYVPLV Bla g 2 196 Known Allergens DGEFTYVPLVGDDSW Bla g 2 201 Known Allergens YVPLVGDDSWKFRLD Bla g 2 206 Known Allergens GDDSWKFRLDGVKIG Bla g 2 211 Known Allergens KFRLDGVKIGDTTVA Bla g 2 216 Known Allergens GVKIGDTTVAPAGTQ Bla g 2 221 Known Allergens DTTVAPAGTQAIIDT Bla g 2 226 Known Allergens PAGTQAIIDTSKAII Bla g 2 231 Known Allergens AIIDTSKAIIVGPKA Bla g 2 236 Known Allergens SKAIIVGPKAYVNPI Bla g 2 241 Known Allergens VGPKAYVNPINEAIG Bla g 2 246 Known Allergens YVNPINEAIGCVVEK Bla g 2 251 Known Allergens NEAIGCVVEKTTTRR Bla g 2 256 Known Allergens CVVEKTTTRRICKLD Bla g 2 261 Known Allergens TTTRRICKLDCSKIP Bla g 2 266 Known Allergens ICKLDCSKIPSLPDV Bla g 2 271 Known Allergens CSKIPSLPDVTFVIN Bla g 2 276 Known Allergens SLPDVTFVINGRNFN Bla g 2 281 Known Allergens TFVINGRNFNISSQY Bla g 2 286 Known Allergens GRNFNISSQYYIQQN Bla g 2 291 Known Allergens ISSQYYIQQNGNLCY Bla g 2 296 Known Allergens YIQQNGNLCYSGFQP Bla g 2 301 Known Allergens GNLCYSGFQPCGHSD Bla g 2 306 Known Allergens SGFQPCGHSDHFFIG Bla g 2 311 Known Allergens CGHSDHFFIGDFFVD Bla g 2 316 Known Allergens HFFIGDFFVDHYYSE Bla g 2 321 Known Allergens DFFVDHYYSEFNWEN Bla g 2 326 Known Allergens HYYSEFNWENKTMGF Bla g 2 331 Known Allergens FNWENKTMGFGRSVE Bla g 2 336 Known Allergens WENKTMGFGRSVESV Bla g 2 338 Known Allergens AVLALCATDTLANED Bla g 4 1 Known Allergens CATDTLANEDCFRHE Bla g 4 6 Known Allergens LANEDCFRHESLVPN Bla g 4 11 Known Allergens CFRHESLVPNLDYER Bla g 4 16 Known Allergens SLVPNLDYERFRGSW Bla g 4 21 Known Allergens LDYERFRGSWIIAAG Bla g 4 26 Known Allergens FRGSWIIAAGTSEAL Bla g 4 31 Known Allergens IIAAGTSEALTQYKC Bla g 4 36 Known Allergens TSEALTQYKCWIDRF Bla g 4 41 Known Allergens TQYKCWIDRFSYDDA Bla g 4 46 Known Allergens WIDRFSYDDALVSKY Bla g 4 51 Known Allergens SYDDALVSKYTDSQG Bla g 4 56 Known Allergens LVSKYTDSQGKNRTT Bla g 4 61 Known Allergens TDSQGKNRTTIRGRT Bla g 4 66 Known Allergens KNRTTIRGRTKFEGN Bla g 4 71 Known Allergens IRGRTKFEGNKFTID Bla g 4 76 Known Allergens KFEGNKFTIDYNDKG Bla g 4 81 Known Allergens KFTIDYNDKGKAFSA Bla g 4 86 Known Allergens YNDKGKAFSAPYSVL Bla g 4 91 Known Allergens KAFSAPYSVLATDYE Bla g 4 96 Known Allergens PYSVLATDYENYAIV Bla g 4 101 Known Allergens ATDYENYAIVEGCPA Bla g 4 106 Known Allergens NYAIVEGCPAAANGH Bla g 4 111 Known Allergens EGCPAAANGHVIYVQ Bla g 4 116 Known Allergens AANGHVIYVQIRFSV Bla g 4 121 Known Allergens VIYVQIRFSVRRFHP Bla g 4 126 Known Allergens IRFSVRRFHPKLGDK Bla g 4 131 Known Allergens RRFHPKLGDKEMIQH Bla g 4 136 Known Allergens KLGDKEMIQHYTLDQ Bla g 4 141 Known Allergens EMIQHYTLDQVNQHK Bla g 4 146 Known Allergens YTLDQVNQHKKAIEE Bla g 4 151 Known Allergens VNQHKKAIEEDLKHF Bla g 4 156 Known Allergens KAIEEDLKHFNLKYE Bla g 4 161 Known Allergens DLKHFNLKYEDLHST Bla g 4 166 Known Allergens KHFNLKYEDLHSTCH Bla g 4 168 Known Allergens MAPSYKLTYCPVKAL Bla g 5 1 Known Allergens KLTYCPVKALGEPIR Bla g 5 6 Known Allergens PVKALGEPIRFLLSY Bla g 5 11 Known Allergens GEPIRFLLSYGEKDF Bla g 5 16 Known Allergens FLLSYGEKDFEDYRF Bla g 5 21 Known Allergens GEKDFEDYRFQEGDW Bla g 5 26 Known Allergens EDYRFQEGDWPNLKP Bla g 5 31 Known Allergens QEGDWPNLKPSMPFG Bla g 5 36 Known Allergens PNLKPSMPFGKTPVL Bla g 5 41 Known Allergens SMPFGKTPVLEIDGK Bla g 5 46 Known Allergens KTPVLEIDGKQTHQS Bla g 5 51 Known Allergens EIDGKQTHQSVAISR Bla g 5 56 Known Allergens QTHQSVAISRYLGKQ Bla g 5 61 Known Allergens VAISRYLGKQFGLSG Bla g 5 66 Known Allergens YLGKQFGLSGKDDWE Bla g 5 71 Known Allergens FGLSGKDDWENLEID Bla g 5 76 Known Allergens KDDWENLEIDMIVDT Bla g 5 81 Known Allergens NLEIDMIVDTISDFR Bla g 5 86 Known Allergens MIVDTISDFRAAIAN Bla g 5 91 Known Allergens ISDFRAAIANYHYDA Bla g 5 96 Known Allergens AAIANYHYDADENSK Bla g 5 101 Known Allergens YHYDADENSKQKKWD Bla g 5 106 Known Allergens DENSKQKKWDPLKKE Bla g 5 111 Known Allergens QKKWDPLKKETIPYY Bla g 5 116 Known Allergens PLKKETIPYYTKKFD Bla g 5 121 Known Allergens TIPYYTKKFDEVVKA Bla g 5 126 Known Allergens TKKFDEVVKANGGYL Bla g 5 131 Known Allergens EVVKANGGYLAAGKL Bla g 5 136 Known Allergens NGGYLAAGKLTWADF Bla g 5 141 Known Allergens AAGKLTWADFYFVAI Bla g 5 146 Known Allergens TWADFYFVAILDYLN Bla g 5 151 Known Allergens YFVAILDYLNHMAKE Bla g 5 156 Known Allergens LDYLNHMAKEDLVAN Bla g 5 161 Known Allergens HMAKEDLVANQPNLK Bla g 5 166 Known Allergens DLVANQPNLKALREK Bla g 5 171 Known Allergens QPNLKALREKVLGLP Bla g 5 176 Known Allergens ALREKVLGLPAIKAW Bla g 5 181 Known Allergens VLGLPAIKAWVAKRP Bla g 5 186 Known Allergens PAIKAWVAKRPPTDL Bla g 5 190 Known Allergens MADEQLQLPPEQISV Bla g 6 1 Known Allergens LQLPPEQISVLRKAF Bla g 6 6 Known Allergens EQISVLRKAFDAFDR Bla g 6 11 Known Allergens LRKAFDAFDREKSGS Bla g 6 16 Known Allergens DAFDREKSGSISTNM Bla g 6 21 Known Allergens EKSGSISTNMVEEIL Bla g 6 26 Known Allergens ISTNMVEEILRLMGQ Bla g 6 31 Known Allergens VEEILRLMGQPFNRR Bla g 6 36 Known Allergens RLMGQPFNRRTLEEL Bla g 6 41 Known Allergens PFNRRTLEELIDEVD Bla g 6 46 Known Allergens TLEELIDEVDADKSG Bla g 6 51 Known Allergens IDEVDADKSGRLEFD Bla g 6 56 Known Allergens ADKSGRLEFDEFVTL Bla g 6 61 Known Allergens RLEFDEFVTLAAKFI Bla g 6 66 Known Allergens EFVTLAAKFIIEEDS Bla g 6 71 Known Allergens AAKFIIEEDSEAMEK Bla g 6 76 Known Allergens IEEDSEAMEKELREA Bla g 6 81 Known Allergens EAMEKELREAFRLYD Bla g 6 86 Known Allergens ELREAFRLYDKEGNG Bla g 6 91 Known Allergens FRLYDKEGNGYIPTS Bla g 6 96 Known Allergens KEGNGYIPTSCLREI Bla g 6 101 Known Allergens YIPTSCLREILRELD Bla g 6 106 Known Allergens CLREILRELDEQLTS Bla g 6 111 Known Allergens LRELDEQLTSDELDM Bla g 6 116 Known Allergens EQLTSDELDMMIEEI Bla g 6 121 Known Allergens DELDMMIEEIDADGS Bla g 6 126 Known Allergens MIEEIDADGSGTVDF Bla g 6 131 Known Allergens DADGSGTVDFDEFME Bla g 6 136 Known Allergens SGTVDFDEFMEMMTG Bla g 6 140 Known Allergens MDEIPAEQVVLLKKA Bla g 6.0101 1 Known Allergens DEIPAEQVVLLKKAF Bla g 6.0101 2 Known Allergens EQVVLLKKAFDAFDR Bla g 6.0101 7 Known Allergens LKKAFDAFDREKKGC Bla g 6.0101 12 Known Allergens DAFDREKKGCISTEM Bla g 6.0101 17 Known Allergens EKKGCISTEMVGTIL Bla g 6.0101 22 Known Allergens ISTEMVGTILEMLGT Bla g 6.0101 27 Known Allergens VGTILEMLGTRLDQD Bla g 6.0101 32 Known Allergens EMLGTRLDQDMLDEI Bla g 6.0101 37 Known Allergens RLDQDMLDEIIAEVD Bla g 6.0101 42 Known Allergens MLDEIIAEVDADGSG Bla g 6.0101 47 Known Allergens IAEVDADGSGELEFE Bla g 6.0101 52 Known Allergens ADGSGELEFEEFCTL Bla g 6.0101 57 Known Allergens ELEFEEFCTLASRFL Bla g 6.0101 62 Known Allergens EFCTLASRFLVEEDA Bla g 6.0101 67 Known Allergens ASRFLVEEDAEAMQH Bla g 6.0101 72 Known Allergens VEEDAEAMQHELREA Bla g 6.0101 77 Known Allergens EAMQHELREAFRLYD Bla g 6.0101 82 Known Allergens ELREAFRLYDKEGNG Bla g 6.0101 87 Known Allergens FRLYDKEGNGYITTA Bla g 6.0101 92 Known Allergens KEGNGYITTAVLREI Bla g 6.0101 97 Known Allergens YITTAVLREILKELD Bla g 6.0101 102 Known Allergens VLREILKELDDKITA Bla g 6.0101 107 Known Allergens LKELDDKITAEDLDM Bla g 6.0101 112 Known Allergens DKITAEDLDMMIEEI Bla g 6.0101 117 Known Allergens EDLDMMIEEIDSDGS Bla g 6.0101 122 Known Allergens MIEEIDSDGSGTVDF Bla g 6.0101 127 Known Allergens DSDGSGTVDFDEFME Bla g 6.0101 132 Known Allergens SGTVDFDEFMEVMTG Bla g 6.0101 136 Known Allergens GTVDFDEFMEVMTGE Bla g 6.0101 137 Known Allergens MDELPPEQIQLLKKA Bla g 6.0201 1 Known Allergens DELPPEQIQLLKKAF Bla g 6.0201 2 Known Allergens EQIQLLKKAFDAFDR Bla g 6.0201 7 Known Allergens ISTEMVGTILEMLGH Bla g 6.0201 27 Known Allergens VGTILEMLGHRLDDD Bla g 6.0201 32 Known Allergens EMLGHRLDDDMLQEI Bla g 6.0201 37 Known Allergens RLDDDMLQEIIAEVD Bla g 6.0201 42 Known Allergens MLQEIIAEVDADGSG Bla g 6.0201 47 Known Allergens ADGSGELEFEEFVSL Bla g 6.0201 57 Known Allergens ELEFEEFVSLASRFL Bla g 6.0201 62 Known Allergens EFVSLASRFLVEEDA Bla g 6.0201 67 Known Allergens ASRFLVEEDAEAMQQ Bla g 6.0201 72 Known Allergens VEEDAEAMQQELREA Bla g 6.0201 77 Known Allergens EAMQQELREAFRLYD Bla g 6.0201 82 Known Allergens FRLYDKEGNGYITTN Bla g 6.0201 92 Known Allergens KEGNGYITTNVLREI Bla g 6.0201 97 Known Allergens YITTNVLREILKELD Bla g 6.0201 102 Known Allergens MDAIKKKMQAMKLEK Bla g 7 1 Known Allergens KKMQAMKLEKDNAMD Bla g 7 6 Known Allergens MKLEKDNAMDRALLC Bla g 7 11 Known Allergens DNAMDRALLCEQQAR Bla g 7 16 Known Allergens RALLCEQQARDANIR Bla g 7 21 Known Allergens EQQARDANIRAEKAE Bla g 7 26 Known Allergens DANIRAEKAEEEARS Bla g 7 31 Known Allergens AEKAEEEARSLQKKI Bla g 7 36 Known Allergens EEARSLQKKIQQIEN Bla g 7 41 Known Allergens LQKKIQQIENDLDQT Bla g 7 46 Known Allergens QQIENDLDQTMEQLM Bla g 7 51 Known Allergens DLDQTMEQLMQVNAK Bla g 7 56 Known Allergens MEQLMQVNAKLDEKD Bla g 7 61 Known Allergens QVNAKLDEKDKALQN Bla g 7 66 Known Allergens LDEKDKALQNAESEV Bla g 7 71 Known Allergens KALQNAESEVAALNR Bla g 7 76 Known Allergens AESEVAALNRRIQLL Bla g 7 81 Known Allergens AALNRRIQLLEEDLE Bla g 7 86 Known Allergens RIQLLEEDLERSEER Bla g 7 91 Known Allergens EEDLERSEERLATAT Bla g 7 96 Known Allergens RSEERLATATAKLAE Bla g 7 101 Known Allergens LATATAKLAEASQAA Bla g 7 106 Known Allergens AKLAEASQAADESER Bla g 7 111 Known Allergens ASQAADESERARKIL Bla g 7 116 Known Allergens DESERARKILESKGL Bla g 7 121 Known Allergens ARKILESKGLADEER Bla g 7 126 Known Allergens ESKGLADEERMDALE Bla g 7 131 Known Allergens ADEERMDALENQLKE Bla g 7 136 Known Allergens MDALENQLKEARFMA Bla g 7 141 Known Allergens NQLKEARFMAEEADK Bla g 7 146 Known Allergens ARFMAEEADKKYDEV Bla g 7 151 Known Allergens EEADKKYDEVARKLA Bla g 7 156 Known Allergens KYDEVARKLAMVEAD Bla g 7 161 Known Allergens ARKLAMVEADLERAE Bla g 7 166 Known Allergens MVEADLERAEERAET Bla g 7 171 Known Allergens LERAEERAETGESKI Bla g 7 176 Known Allergens ERAETGESKIVELEE Bla g 7 181 Known Allergens GESKIVELEEELRVV Bla g 7 186 Known Allergens VELEEELRVVGNNLK Bla g 7 191 Known Allergens ELRVVGNNLKSLEVS Bla g 7 196 Known Allergens GNNLKSLEVSEEKAN Bla g 7 201 Known Allergens SLEVSEEKANLREEE Bla g 7 206 Known Allergens EEKANLREEEYKQQI Bla g 7 211 Known Allergens LREEEYKQQIKTLNT Bla g 7 216 Known Allergens YKQQIKTLNTRLKEA Bla g 7 221 Known Allergens KTLNTRLKEAEARAE Bla g 7 226 Known Allergens RLKEAEARAEFAERS Bla g 7 231 Known Allergens EARAEFAERSVQKLQ Bla g 7 236 Known Allergens FAERSVQKLQKEVDR Bla g 7 241 Known Allergens VQKLQKEVDRLEDEL Bla g 7 246 Known Allergens KEVDRLEDELVHEKE Bla g 7 251 Known Allergens LEDELVHEKEKYKYI Bla g 7 256 Known Allergens VHEKEKYKYICDDLD Bla g 7 261 Known Allergens KYKYICDDLDMTFTE Bla g 7 266 Known Allergens ICDDLDMTFTELIGN Bla g 7 270 Known Allergens MVDAAVLEKLEAGFA Bla g 9 1 Known Allergens VLEKLEAGFAKLAAS Bla g 9 6 Known Allergens EAGFAKLAASDSKSL Bla g 9 11 Known Allergens KLAASDSKSLLRKYL Bla g 9 16 Known Allergens DSKSLLRKYLTKEVF Bla g 9 21 Known Allergens LRKYLTKEVFDNLKT Bla g 9 26 Known Allergens TKEVFDNLKTKKTPT Bla g 9 31 Known Allergens DNLKTKKTPTFGSTL Bla g 9 36 Known Allergens KKTPTFGSTLLDVIQ Bla g 9 41 Known Allergens FGSTLLDVIQSGLEN Bla g 9 46 Known Allergens LDVIQSGLENHDSGV Bla g 9 51 Known Allergens SGLENHDSGVGIYAP Bla g 9 56 Known Allergens HDSGVGIYAPDAEAY Bla g 9 61 Known Allergens GIYAPDAEAYTVFAD Bla g 9 66 Known Allergens DAEAYTVFADLFDPI Bla g 9 71 Known Allergens TVFADLFDPIIEDYH Bla g 9 76 Known Allergens LFDPIIEDYHGGFKK Bla g 9 81 Known Allergens IEDYHGGFKKTDKHP Bla g 9 86 Known Allergens GGFKKTDKHPPKDWG Bla g 9 91 Known Allergens TDKHPPKDWGDVDTL Bla g 9 96 Known Allergens PKDWGDVDTLGNLDP Bla g 9 101 Known Allergens DVDTLGNLDPAGEYI Bla g 9 106 Known Allergens GNLDPAGEYIISTRV Bla g 9 111 Known Allergens AGEYIISTRVRCGRS Bla g 9 116 Known Allergens ISTRVRCGRSMQGYP Bla g 9 121 Known Allergens RCGRSMQGYPFNPCL Bla g 9 126 Known Allergens MQGYPFNPCLTEAQY Bla g 9 131 Known Allergens FNPCLTEAQYKEMED Bla g 9 136 Known Allergens TEAQYKEMEDKVSST Bla g 9 141 Known Allergens KEMEDKVSSTLSGLE Bla g 9 146 Known Allergens KVSSTLSGLEGELKG Bla g 9 151 Known Allergens LSGLEGELKGQFYPL Bla g 9 156 Known Allergens GELKGQFYPLTGMTK Bla g 9 161 Known Allergens QFYPLTGMTKEVQQK Bla g 9 166 Known Allergens TGMTKEVQQKLIDDH Bla g 9 171 Known Allergens EVQQKLIDDHFLFKE Bla g 9 176 Known Allergens LIDDHFLFKEGDRFL Bla g 9 181 Known Allergens FLFKEGDRFLQHANA Bla g 9 186 Known Allergens GDRFLQHANACRFWP Bla g 9 191 Known Allergens QHANACRFWPTGRGI Bla g 9 196 Known Allergens CRFWPTGRGIYHNDA Bla g 9 201 Known Allergens TGRGIYHNDAKTFLV Bla g 9 206 Known Allergens YHNDAKTFLVWCNEE Bla g 9 211 Known Allergens KTFLVWCNEEDHLRI Bla g 9 216 Known Allergens WCNEEDHLRIISMQM Bla g 9 221 Known Allergens DHLRIISMQMGGDLG Bla g 9 226 Known Allergens ISMQMGGDLGQVYRR Bla g 9 231 Known Allergens GGDLGQVYRRLVTAV Bla g 9 236 Known Allergens QVYRRLVTAVNDIEK Bla g 9 241 Known Allergens LVTAVNDIEKRVPFS Bla g 9 246 Known Allergens NDIEKRVPFSHDDRL Bla g 9 251 Known Allergens RVPFSHDDRLGFLTF Bla g 9 256 Known Allergens HDDRLGFLTFCPTNL Bla g 9 261 Known Allergens GFLTFCPTNLGTTVR Bla g 9 266 Known Allergens CPTNLGTTVRASVRI Bla g 9 271 Known Allergens GTTVRASVRIKVPKL Bla g 9 276 Known Allergens ASVRIKVPKLAADKK Bla g 9 281 Known Allergens KVPKLAADKKKLEEV Bla g 9 286 Known Allergens AADKKKLEEVAGKYN Bla g 9 291 Known Allergens KLEEVAGKYNLQVRG Bla g 9 296 Known Allergens AGKYNLQVRGTRGEH Bla g 9 301 Known Allergens LQVRGTRGEHTEAEG Bla g 9 306 Known Allergens TRGEHTEAEGGVYDI Bla g 9 311 Known Allergens TEAEGGVYDISNKRR Bla g 9 316 Known Allergens GVYDISNKRRMGLTE Bla g 9 321 Known Allergens SNKRRMGLTEYDAVK Bla g 9 326 Known Allergens MGLTEYDAVKGMNDG Bla g 9 331 Known Allergens YDAVKGMNDGIAELI Bla g 9 336 Known Allergens GMNDGIAELIKIESS Bla g 9 341 Known Allergens MNDGIAELIKIESSL Bla g 9 342 Known Allergens MKLFPLVALLVLVVG Bla g 11 1 Known Allergens LFPLVALLVLVVGVL Bla g 11 3 Known Allergens ALLVLVVGVLSQKDP Bla g 11 8 Known Allergens VVGVLSQKDPHVWDG Bla g 11 13 Known Allergens HVWDGRSAIVHLFEW Bla g 11 23 Known Allergens RSAIVHLFEWKFADI Bla g 11 28 Known Allergens KGFAGVQVSPVHENV Bla g 11 53 Known Allergens VHENVIISSPFRPWW Bla g 11 63 Known Allergens FRPWWERYQLVSYKL Bla g 11 73 Known Allergens ERYQLVSYKLVSRSG Bla g 11 78 Known Allergens RDMVRRCNNVGIRIY Bla g 11 98 Known Allergens RCNNVGIRIYVDVVL Bla g 11 103 Known Allergens GIRIYVDVVLNQMSG Bla g 11 108 Known Allergens VDVVLNQMSGSWPDA Bla g 11 113 Known Allergens LNQGSDYVRGKMIEY Bla g 11 178 Known Allergens DYVRGKMIEYLNHLV Bla g 11 183 Known Allergens KMIEYLNHLVDCGVA Bla g 11 188 Known Allergens DCGVAGFRVDAAKHM Bla g 11 198 Known Allergens GFRVDAAKHMWPADL Bla g 11 203 Known Allergens MKLFPLVALLVLVVG alpha-amylase 1 Literature novel antigens LFPLVALLVLVVGVL alpha-amylase 3 Literature novel antigens ALLVLVVGVLSQKDP alpha-amylase 8 Literature novel antigens VVGVLSQKDPHVWDG alpha-amylase 13 Literature novel antigens HVWDGRSAIVHLFEW alpha-amylase 23 Literature novel antigens RSAIVHLFEWKFADI alpha-amylase 28 Literature novel antigens KGFAGVQVSPVHENV alpha-amylase 53 Literature novel antigens VHENVIISSPFRPWW alpha-amylase 63 Literature novel antigens FRPWWERYQLVSYKL alpha-amylase 73 Literature novel antigens ERYQLVSYKLVSRSG alpha-amylase 78 Literature novel antigens RDMVRRCNNVGIRIY alpha-amylase 98 Literature novel antigens RCNNVGIRIYVDVVL alpha-amylase 103 Literature novel antigens GIRIYVDVVLNQMSG alpha-amylase 108 Literature novel antigens VDVVLNQMSGSWPDA alpha-amylase 113 Literature novel antigens LNQGSDYVRGKMIEY alpha-amylase 178 Literature novel antigens DYVRGKMIEYLNHLV alpha-amylase 183 Literature novel antigens KMIEYLNHLVDCGVA alpha-amylase 188 Literature novel antigens DCGVAGFRVDAAKHM alpha-amylase 198 Literature novel antigens GFRVDAAKHMWPADL alpha-amylase 203 Literature novel antigens AAKHMWPADLQYIYS alpha-amylase 208 Literature novel antigens WPADLQYIYSKVNNL alpha-amylase 213 Literature novel antigens QYIYSKVNNLNTDHG alpha-amylase 218 Literature novel antigens RPFFYQEVIDLGGEA alpha-amylase 238 Literature novel antigens IGDAFRGNNAIKWLV alpha-amylase 273 Literature novel antigens RGNNAIKWLVNFGVG alpha-amylase 278 Literature novel antigens IKWLVNFGVGWGYIP alpha-amylase 283 Literature novel antigens GASILTYKTSKLYKM alpha-amylase 318 Literature novel antigens TYKTSKLYKMAVAFM alpha-amylase 323 Literature novel antigens KLYKMAVAFMLAYPY alpha-amylase 328 Literature novel antigens AVAFMLAYPYGYPRV alpha-amylase 333 Literature novel antigens GYPRVMSSFSFDNSD alpha-amylase 343 Literature novel antigens DGNGNIISPSINADG alpha-amylase 363 Literature novel antigens WVCEHRWRQIFNMVG alpha-amylase 383 Literature novel antigens RWRQIFNMVGFRNAV alpha-amylase 388 Literature novel antigens FNMVGFRNAVAGTAV alpha-amylase 393 Literature novel antigens ISFCRGNKGFVAFND alpha-amylase 418 Literature novel antigens EFNNDLKQTLQTCLP alpha-amylase 433 Literature novel antigens YIEILSSADDGVLAI alpha-amylase 478 Literature novel antigens SSADDGVLAIHVNSK alpha-amylase 483 Literature novel antigens GVLAIHVNSKVGSKS alpha-amylase 488 Literature novel antigens VLEKLEAGFAKLAAS Arginine kinase 6 Literature novel antigens EAGFAKLAASDSKSL Arginine kinase 11 Literature novel antigens KLAASDSKSLLRKYL Arginine kinase 16 Literature novel antigens DSKSLLRKYLTKEVF Arginine kinase 21 Literature novel antigens LRKYLTKEVFDNLKT Arginine kinase 26 Literature novel antigens FGSTLLDVIQSGLEN Arginine kinase 46 Literature novel antigens DAEAYTVFADLFDPI Arginine kinase 71 Literature novel antigens AGEYIISTRVRCGRS Arginine kinase 116 Literature novel antigens RCGRSMQGYPFNPCL Arginine kinase 126 Literature novel antigens LIDDHFLFKEGDRFL Arginine kinase 181 Literature novel antigens FLFKEGDRFLQHANA Arginine kinase 186 Literature novel antigens GDRFLQHANACRFWP Arginine kinase 191 Literature novel antigens TGRGIYHNDAKTFLV Arginine kinase 206 Literature novel antigens WCNEEDHLRIISMQM Arginine kinase 221 Literature novel antigens DHLRIISMQMGGDLG Arginine kinase 226 Literature novel antigens QVYRRLVTAVNDIEK Arginine kinase 241 Literature novel antigens NDIEKRVPFSHDDRL Arginine kinase 251 Literature novel antigens RVPFSHDDRLGFLTF Arginine kinase 256 Literature novel antigens HDDRLGFLTFCPTNL Arginine kinase 261 Literature novel antigens GFLTFCPTNLGTTVR Arginine kinase 266 Literature novel antigens CPTNLGTTVRASVRI Arginine kinase 271 Literature novel antigens GTTVRASVRIKVPKL Arginine kinase 276 Literature novel antigens ASVRIKVPKLAADKK Arginine kinase 281 Literature novel antigens MPLQKLFARRIFDSR Enolase 1 Literature Novel Antigens LFARRIFDSRGNPTI Enolase 6 Literature Novel Antigens EVDLTTDLGLFRAAV Enolase 21 Literature Novel Antigens TDLGLFRAAVPSGAS Enolase 26 Literature Novel Antigens IDNVNKIIVPELLKQ Enolase 66 Literature Novel Antigens ELLKQSFEATQQKEI Enolase 76 Literature Novel Antigens DDFMLKLDGTPNKSK Enolase 91 Literature Novel Antigens PNKSKLGANAILGVS Enolase 101 Literature Novel Antigens LGANAILGVSIAVCK Enolase 106 Literature Novel Antigens KGVPLYRHIADLAGV Enolase 126 Literature Novel Antigens YRHIADLAGVPDVIL Enolase 131 Literature Novel Antigens GVPDVILPVPAFNVI Enolase 139 Literature Novel Antigens PDVILPVPAFNVING Enolase 141 Literature Novel Antigens QEFMILPTGAATFTE Enolase 166 Literature Novel Antigens SEVYHHLKNVIQGKF Enolase 186 Literature Novel Antigens HLKNVIQGKFGLDAT Enolase 191 Literature Novel Antigens IQGKFGLDATAVGDE Enolase 196 Literature Novel Antigens WIDKDQLTALYMEFI Enolase 271 Literature Novel Antigens QLTALYMEFIKEFPV Enolase 276 Literature Novel Antigens YMEFIKEFPVVSIED Enolase 281 Literature Novel Antigens HWDAWTAMTAATPIQ Enolase 301 Literature Novel Antigens TAMTAATPIQIVGDD Enolase 306 Literature Novel Antigens IVGDDLTVTNPTRIQ Enolase 316 Literature Novel Antigens LTVTNPTRIQTAIDK Enolase 321 Literature Novel Antigens KACNCLLLKVNQIGT Enolase 336 Literature Novel Antigens FIADLVVGLSTGQIK Enolase 381 Literature Novel Antigens RSERLAKYNQILRIE Enolase 401 Literature Novel Antigens MAKDIKFDIEARDKL Hsp60 1 Literature Novel Antigens KKGVDALANAVKVTL Hsp60 16 Literature Novel Antigens NVVLQKSFGGPQVTK Hsp60 36 Literature Novel Antigens LEDPIENLGAQMVKE Hsp60 61 Literature Novel Antigens DGTTTATVLAQAIVR Hsp60 86 Literature Novel Antigens RALEAVIIDLRKQSR Hsp60 121 Literature Novel Antigens VIIDLRKQSREVGGN Hsp60 126 Literature Novel Antigens TEKIKQVASISANND Hsp60 141 Literature Novel Antigens EGMQFDRGYQSPYFV Hsp60 191 Literature Novel Antigens SPYFVTNTEKMITEF Hsp60 201 Literature Novel Antigens DQPQILLSDKKIAAM Hsp60 216 Literature Novel Antigens LLSDKKIAAMKDLLP Hsp60 221 Literature Novel Antigens KIAAMKDLLPILEPV Hsp60 226 Literature Novel Antigens KDLLPILEPVAQSGK Hsp60 231 Literature Novel Antigens ILEPVAQSGKPLLII Hsp60 236 Literature Novel Antigens GEALATLVVNKIRGT Hsp60 256 Literature Novel Antigens TLVVNKIRGTLKVAA Hsp60 261 Literature Novel Antigens KIRGTLKVAAIKAPG Hsp60 266 Literature Novel Antigens LKVAAIKAPGFGDRR Hsp60 271 Literature Novel Antigens KAMLEDIAILTGGSV Hsp60 286 Literature Novel Antigens DIAILTGGSVISEET Hsp60 291 Literature Novel Antigens GSKLEDVKLNMLGKA Hsp60 306 Literature Novel Antigens DVKLNMLGKAERVII Hsp60 311 Literature Novel Antigens QERLAKLAGGVAVLY Hsp60 366 Literature Novel Antigens VAVLYVGAASEVEMK Hsp60 376 Literature Novel Antigens VDDALNATRAAVEEG Hsp60 396 Literature Novel Antigens IVAGGGVALVRAINS Hsp60 411 Literature Novel Antigens GVALVRAINSLDNLR Hsp60 416 Literature Novel Antigens RAINSLDNLRGENAD Hsp60 421 Literature Novel Antigens QDTGIQIVRRSLEEP Hsp60 436 Literature Novel Antigens KIGEYKNMIAEGIID Hsp60 481 Literature Novel Antigens EGIIDPTKVARVALE Hsp60 491 Literature Novel Antigens PTKVARVALENAASV Hsp60 496 Literature Novel Antigens RVALENAASVSGMLL Hsp60 501 Literature Novel Antigens VTEIKKDENNAVPSM Hsp60 521 Literature Novel Antigens GWVTQIATNPKYPDM RACK1 16 Literature Novel Antigens KYPDMILSCSRDKTL RACK1 26 Literature Novel Antigens ILSCSRDKTLIVWKL RACK1 31 Literature Novel Antigens RDKTLIVWKLTRDET RACK1 36 Literature Novel Antigens GHSHFVSDVVLSSDG RACK1 61 Literature Novel Antigens VSDVVLSSDGNYALS RACK1 66 Literature Novel Antigens LSSDGNYALSGSWDK RACK1 71 Literature Novel Antigens NYALSGSWDKTLRLW RACK1 76 Literature Novel Antigens TLRLWDLAAGRTTRR RACK1 86 Literature Novel Antigens KDVLSVAFSVDNRQI RACK1 106 Literature Novel Antigens VAFSVDNRQIVSGSR RACK1 111 Literature Novel Antigens DKTIKLWNTLAECKY RACK1 126 Literature Novel Antigens VSCVRFSPNHSNPII RACK1 151 Literature Novel Antigens FSPNHSNPIIVSAGW RACK1 156 Literature Novel Antigens SNPIIVSAGWDKVVK RACK1 161 Literature Novel Antigens DKVVKVWNLTNCKLK RACK1 171 Literature Novel Antigens VWNLTNCKLKINHIG RACK1 176 Literature Novel Antigens NCKLKINHIGHTGYL RACK1 181 Literature Novel Antigens GKDCKAMLWDLNDGK RACK1 211 Literature Novel Antigens AMLWDLNDGKHLHTL RACK1 216 Literature Novel Antigens DHNDIITALCFSPNR RACK1 231 Literature Novel Antigens ITALCFSPNRYWLCA RACK1 236 Literature Novel Antigens YWLCAAFGPSIKIWD RACK1 246 Literature Novel Antigens QTLFAGYFDNTIRVW RACK1 296 Literature Novel Antigens GYFDNTIRVWQVSVF RACK1 301 Literature Novel Antigens FDNTIRVWQVSVFAR RACK1 303 Literature Novel Antigens MGRKFWVGGNWKMNG TPI 1 Literature Novel Antigens EEIVKFLAAGPLDPN TPI 21 Literature Novel Antigens VEVVVGIPAIYLEST TPI 36 Literature Novel Antigens GIPAIYLESTKNILP TPI 41 Literature Novel Antigens YLESTKNILPSNVAA TPI 46 Literature Novel Antigens KNILPSNVAAAAQNC TPI 51 Literature Novel Antigens GAFTGEISPAMLNDI TPI 71 Literature Novel Antigens EISPAMLNDIGINWV TPI 76 Literature Novel Antigens MLNDIGINWVILGHS TPI 81 Literature Novel Antigens GINWVILGHSERRNV TPI 86 Literature Novel Antigens FGEKDDLISDKVVHA TPI 101 Literature Novel Antigens DLISDKVVHALESGL TPI 106 Literature Novel Antigens KVVHALESGLNVVAC TPI 111 Literature Novel Antigens GKTEEVVFQQTKAIA TPI 136 Literature Novel Antigens VVFQQTKAIADKIKD TPI 141 Literature Novel Antigens DKIKDWSKVVIAYEP TPI 151 Literature Novel Antigens WSKVVIAYEPVWAIG TPI 156 Literature Novel Antigens IAYEPVWAIGTGKTA TPI 161 Literature Novel Antigens QDVHKKLREWLSKNV TPI 181 Literature Novel Antigens DGFLVGGASLKPEFV TPI 226 Literature Novel Antigens GGASLKPEFVQIINA TPI 231 Literature Novel Antigens ASLKPEFVQIINAKN TPI 233 Literature Novel Antigens MFRLVVIATLLVASC Trypsin 1 Literature Novel Antigens VIATLLVASCLGAAT Trypsin 6 Literature Novel Antigens QLQFEYYGSLMCGAS Trypsin 46 Literature Novel Antigens YWTIDFDIAVARVST Trypsin 111 Literature Novel Antigens DYDGITANMICAAVP Trypsin 186 Literature Novel Antigens YPGVYSNVATLRDFV Trypsin 236 Literature Novel Antigens MTWNALLCCLLVSAA Vitellogenin 1 Literature Novel Antigens NALLCCLLVSAASAI Vitellogenin 4 Literature Novel Antigens AASAITPGWLPINSQ Vitellogenin 14 Literature Novel Antigens VANQYTGILYKARLS Vitellogenin 44 Literature Novel Antigens KARLSLDRNEDQLIT Vitellogenin 54 Literature Novel Antigens LDRNEDQLITGKVTE Vitellogenin 59 Literature Novel Antigens DQLITGKVTEAQFSP Vitellogenin 64 Literature Novel Antigens GKVTEAQFSPVNTQF Vitellogenin 69 Literature Novel Antigens AQFSPVNTQFSSGWD Vitellogenin 74 Literature Novel Antigens VNTQFSSGWDESVPD Vitellogenin 79 Literature Novel Antigens SSGWDESVPDEKLHW Vitellogenin 84 Literature Novel Antigens ESVPDEKLHWDVVPM Vitellogenin 89 Literature Novel Antigens QIELNSRGEVRKLRV Vitellogenin 109 Literature Novel Antigens VVVDEDKKVYRVFES Vitellogenin 144 Literature Novel Antigens RVFESTVTGRCEALY Vitellogenin 154 Literature Novel Antigens TVTGRCEALYEVDHL Vitellogenin 159 Literature Novel Antigens CEALYEVDHLYPTTY Vitellogenin 164 Literature Novel Antigens EVDHLYPTTYLNPWQ Vitellogenin 169 Literature Novel Antigens YPTTYLNPWQWTQQH Vitellogenin 174 Literature Novel Antigens LNPWQWTQQHDTKLR Vitellogenin 179 Literature Novel Antigens WTQQHDTKLRIMKTH Vitellogenin 184 Literature Novel Antigens DTKLRIMKTHQFTNC Vitellogenin 189 Literature Novel Antigens IMKTHQFTNCRHNSA Vitellogenin 194 Literature Novel Antigens NAFEYFHLKQHKPET Vitellogenin 214 Literature Novel Antigens AVSRVIADGDNLKNF Vitellogenin 234 Literature Novel Antigens IADGDNLKNFTFYSG Vitellogenin 239 Literature Novel Antigens IVLNPEIYNKQKGML Vitellogenin 259 Literature Novel Antigens VSHINVTVERKGREL Vitellogenin 274 Literature Novel Antigens VTVERKGRELTVIDY Vitellogenin 279 Literature Novel Antigens ELRNVGDLSYSTSLV Vitellogenin 294 Literature Novel Antigens RNSASMDLSSSSMSS Vitellogenin 314 Literature Novel Antigens MDLSSSSMSSSSSSS Vitellogenin 319 Literature Novel Antigens SSMSSSSSSSSSSSS Vitellogenin 324 Literature Novel Antigens SSSSSSSSSSSSSSS Vitellogenin 329 Literature Novel Antigens SSSSSSSSSSSSSSS Vitellogenin 334 Literature Novel Antigens SSSSSSSSSSSEEHH Vitellogenin 339 Literature Novel Antigens SSSSSSEEHHSHNQK Vitellogenin 344 Literature Novel Antigens SEEHHSHNQKLSKKR Vitellogenin 349 Literature Novel Antigens QVPLPRPLFEANFDA Vitellogenin 364 Literature Novel Antigens RPLFEANFDASSGLT Vitellogenin 369 Literature Novel Antigens ANFDASSGLTTEQPV Vitellogenin 374 Literature Novel Antigens SSGLTTEQPVTFRPR Vitellogenin 379 Literature Novel Antigens TEQPVTFRPRRQLFQ Vitellogenin 384 Literature Novel Antigens TFRPRRQLFQGQDMS Vitellogenin 389 Literature Novel Antigens RQLFQGQDMSEEETE Vitellogenin 394 Literature Novel Antigens GQDMSEEETEQNPEI Vitellogenin 399 Literature Novel Antigens EEETEQNPEIIPANL Vitellogenin 404 Literature Novel Antigens LIHNTKQVDVDPVGV Vitellogenin 424 Literature Novel Antigens KQVDVDPVGVAVRLS Vitellogenin 429 Literature Novel Antigens KDIAADLQGEPRVGE Vitellogenin 444 Literature Novel Antigens DLQGEPRVGEDRHIL Vitellogenin 449 Literature Novel Antigens PRVGEDRHILPRFTI Vitellogenin 454 Literature Novel Antigens AARKLYKLENDHPNY Vitellogenin 484 Literature Novel Antigens DHPNYMNWDTWRVYR Vitellogenin 494 Literature Novel Antigens MNWDTWRVYRDAVSQ Vitellogenin 499 Literature Novel Antigens WRVYRDAVSQAGTWS Vitellogenin 504 Literature Novel Antigens DAVSQAGTWSALNSI Vitellogenin 509 Literature Novel Antigens SEMVEPKEASHLITV Vitellogenin 529 Literature Novel Antigens LPAAVSDKNKAYLHF Vitellogenin 544 Literature Novel Antigens SDKNKAYLHFLFEMT Vitellogenin 549 Literature Novel Antigens IPYLVQEFDDAVKEN Vitellogenin 604 Literature Novel Antigens EHNPRKVIDLLLSLY Vitellogenin 669 Literature Novel Antigens LDQNEHADIRVEALF Vitellogenin 684 Literature Novel Antigens AELTHTESNNQVLSA Vitellogenin 714 Literature Novel Antigens TESNNQVLSASQSAI Vitellogenin 719 Literature Novel Antigens SQSAIKSAANVEGDI Vitellogenin 729 Literature Novel Antigens KSAANVEGDIYSEMR Vitellogenin 734 Literature Novel Antigens VEGDIYSEMRRKAKA Vitellogenin 739 Literature Novel Antigens RKAKAVEHLLSTRNM Vitellogenin 749 Literature Novel Antigens KINYDSLYNLNYIGS Vitellogenin 779 Literature Novel Antigens SLYNLNYIGSEDSIY Vitellogenin 784 Literature Novel Antigens NYIGSEDSIYPKSML Vitellogenin 789 Literature Novel Antigens NNLGRINTHVQKGYM Vitellogenin 809 Literature Novel Antigens INTHVQKGYMVSSMT Vitellogenin 814 Literature Novel Antigens VSSMTDLWEAFHTIY Vitellogenin 824 Literature Novel Antigens FHTIYKKDNGSPTDP Vitellogenin 834 Literature Novel Antigens KKDNGSPTDPKTLVK Vitellogenin 839 Literature Novel Antigens SPTDPKTLVKFVEGN Vitellogenin 844 Literature Novel Antigens FVEGNLKYFNMGVQK Vitellogenin 854 Literature Novel Antigens KTYKKPTNFNHTKLS Vitellogenin 889 Literature Novel Antigens TLTLPCAMGLPAYFK Vitellogenin 909 Literature Novel Antigens CAMGLPAYFKMNSPS Vitellogenin 914 Literature Novel Antigens LWKYNGEFSIQTDAK Vitellogenin 929 Literature Novel Antigens QTDAKTDVPMSLENF Vitellogenin 939 Literature Novel Antigens HAQLAFSTAFDNKEY Vitellogenin 969 Literature Novel Antigens FSTAFDNKEYISGLD Vitellogenin 974 Literature Novel Antigens DNKEYISGLDRKVEV Vitellogenin 979 Literature Novel Antigens ISGLDRKVEVHVPVK Vitellogenin 984 Literature Novel Antigens IIPLFTDRDYDVLQW Vitellogenin 1014 Literature Novel Antigens TDRDYDVLQWQTIPY Vitellogenin 1019 Literature Novel Antigens TTIHNVPDFETVYMD Vitellogenin 1034 Literature Novel Antigens TAHFEKKMGENTGIV Vitellogenin 1059 Literature Novel Antigens KKMGENTGIVFKVKY Vitellogenin 1064 Literature Novel Antigens DTDQEFLDTKWFLDE Vitellogenin 1079 Literature Novel Antigens LFTGLNYDVPTKDIF Vitellogenin 1099 Literature Novel Antigens NYDVPTKDIFYNNLT Vitellogenin 1104 Literature Novel Antigens YNNLTVYYDHEDTKN Vitellogenin 1114 Literature Novel Antigens VYYDHEDTKNHAVSF Vitellogenin 1119 Literature Novel Antigens EDTKNHAVSFTVTKE Vitellogenin 1124 Literature Novel Antigens HAVSFTVTKEQSKFY Vitellogenin 1129 Literature Novel Antigens TVTKEQSKFYETLNP Vitellogenin 1134 Literature Novel Antigens LKLSSGKKQKHRNVK Vitellogenin 1154 Literature Novel Antigens GKKQKHRNVKSHRIR Vitellogenin 1159 Literature Novel Antigens SHRIRREYTEDENPA Vitellogenin 1169 Literature Novel Antigens REYTEDENPAIPKDK Vitellogenin 1174 Literature Novel Antigens DENPAIPKDKQPNSH Vitellogenin 1179 Literature Novel Antigens IPKDKQPNSHPRRQE Vitellogenin 1184 Literature Novel Antigens QPNSHPRRQEYLSKS Vitellogenin 1189 Literature Novel Antigens MALTGDATAVVLDMT Vitellogenin 1204 Literature Novel Antigens VLDMTLKFEGPAESY Vitellogenin 1214 Literature Novel Antigens LKFEGPAESYFTTTV Vitellogenin 1219 Literature Novel Antigens FYDQHYYEEKKRNQF Vitellogenin 1249 Literature Novel Antigens YYEEKKRNQFCLSWS Vitellogenin 1254 Literature Novel Antigens EFDPNSKVHAIMNIG Vitellogenin 1284 Literature Novel Antigens IMNIGKECENGGSAV Vitellogenin 1294 Literature Novel Antigens KECENGGSAVANIDM Vitellogenin 1299 Literature Novel Antigens KNLTVSKLCDHEMRT Vitellogenin 1324 Literature Novel Antigens SKLCDHEMRTKRDHV Vitellogenin 1329 Literature Novel Antigens HEMRTKRDHVLPACR Vitellogenin 1334 Literature Novel Antigens KRDHVLPACRNSTER Vitellogenin 1339 Literature Novel Antigens LPACRNSTERASDLN Vitellogenin 1344 Literature Novel Antigens NSTERASDLNRVHVD Vitellogenin 1349 Literature Novel Antigens INYNLKQHETFKRRV Vitellogenin 1364 Literature Novel Antigens KQHETFKRRVYKVYD Vitellogenin 1369 Literature Novel Antigens LYPHVSEDVIVDNPA Vitellogenin 1389 Literature Novel Antigens DNTRAFNVSIETPVL Vitellogenin 1414 Literature Novel Antigens FNVSIETPVLSVNAT Vitellogenin 1419 Literature Novel Antigens ETPVLSVNATSVRLQ Vitellogenin 1424 Literature Novel Antigens SVNATSVRLQSWQSE Vitellogenin 1429 Literature Novel Antigens SVRLQSWQSEMLRMN Vitellogenin 1434 Literature Novel Antigens PRTSFAKRFAKWALP Vitellogenin 1449 Literature Novel Antigens AKRFAKWALPLYYKP Vitellogenin 1454 Literature Novel Antigens KWALPLYYKPTCVVD Vitellogenin 1459 Literature Novel Antigens LYYKPTCVVDSSYIN Vitellogenin 1464 Literature Novel Antigens TCVVDSSYINTFDNF Vitellogenin 1469 Literature Novel Antigens ILDIPQKFNMEYFKV Vitellogenin 1499 Literature Novel Antigens AFKPTSPVPNMQREV Vitellogenin 1514 Literature Novel Antigens SPVPNMQREVLVFLR Vitellogenin 1519 Literature Novel Antigens NAKIELKPNQGMPEV Vitellogenin 1534 Literature Novel Antigens LKPNQGMPEVYVEGK Vitellogenin 1539 Literature Novel Antigens GMPEVYVEGKRVDYN Vitellogenin 1544 Literature Novel Antigens YVEGKRVDYNHHHST Vitellogenin 1549 Literature Novel Antigens RVDYNHHHSTDLNVS Vitellogenin 1554 Literature Novel Antigens HHHSTDLNVSQDRIG Vitellogenin 1559 Literature Novel Antigens DLNVSQDRIGYVYAL Vitellogenin 1564 Literature Novel Antigens QDRIGYVYALPTKAA Vitellogenin 1569 Literature Novel Antigens YVYALPTKAAHIVFP Vitellogenin 1574 Literature Novel Antigens PTKAAHIVFPSYEIE Vitellogenin 1579 Literature Novel Antigens HIVFPSYEIEMFYDG Vitellogenin 1584 Literature Novel Antigens SYEIEMFYDGSRIMI Vitellogenin 1589 Literature Novel Antigens MFYDGSRIMIQASNM Vitellogenin 1594 Literature Novel Antigens SRIMIQASNMYRNFT Vitellogenin 1599 Literature Novel Antigens QASNMYRNFTKGLCG Vitellogenin 1604 Literature Novel Antigens YRNFTKGLCGNMDGE Vitellogenin 1609 Literature Novel Antigens KGLCGNMDGEFVNDV Vitellogenin 1614 Literature Novel Antigens NMDGEFVNDVLTPWG Vitellogenin 1619 Literature Novel Antigens FVNDVLTPWGCYAKD Vitellogenin 1624 Literature Novel Antigens LTPWGCYAKDMALFV Vitellogenin 1629 Literature Novel Antigens CYAKDMALFVASYAD Vitellogenin 1634 Literature Novel Antigens MALFVASYADNSNSE Vitellogenin 1639 Literature Novel Antigens ASYADNSNSEVRKIK Vitellogenin 1644 Literature Novel Antigens NSNSEVRKIKATQNE Vitellogenin 1649 Literature Novel Antigens VRKIKATQNEQTCVP Vitellogenin 1654 Literature Novel Antigens ATQNEQTCVPQFHQP Vitellogenin 1659 Literature Novel Antigens QTCVPQFHQPLVSHQ Vitellogenin 1664 Literature Novel Antigens QFHQPLVSHQMRLSQ Vitellogenin 1669 Literature Novel Antigens LVSHQMRLSQVIKLA Vitellogenin 1674 Literature Novel Antigens MRLSQVIKLADTSSS Vitellogenin 1679 Literature Novel Antigens VIKLADTSSSSESSS Vitellogenin 1684 Literature Novel Antigens DTSSSSESSSSSESH Vitellogenin 1689 Literature Novel Antigens SESSSSSESHENNSS Vitellogenin 1694 Literature Novel Antigens SSESHENNSSPSSES Vitellogenin 1699 Literature Novel Antigens ENNSSPSSESQVNKS Vitellogenin 1704 Literature Novel Antigens PSSESQVNKSKRQPN Vitellogenin 1709 Literature Novel Antigens QVNKSKRQPNSRPRS Vitellogenin 1714 Literature Novel Antigens KRQPNSRPRSSSSSS Vitellogenin 1719 Literature Novel Antigens SRPRSSSSSSSSSSS Vitellogenin 1724 Literature Novel Antigens SSSSSSSSSSESNES Vitellogenin 1729 Literature Novel Antigens SSSSSESNESVLAKK Vitellogenin 1734 Literature Novel Antigens ESNESVLAKKIINNQ Vitellogenin 1739 Literature Novel Antigens VLAKKIINNQIGPKP Vitellogenin 1744 Literature Novel Antigens IINNQIGPKPTLIPS Vitellogenin 1749 Literature Novel Antigens IGPKPTLIPSQSPMT Vitellogenin 1754 Literature Novel Antigens TLIPSQSPMTSDDKC Vitellogenin 1759 Literature Novel Antigens QSPMTSDDKCMTQQP Vitellogenin 1764 Literature Novel Antigens SDDKCMTQQPRHTYY Vitellogenin 1769 Literature Novel Antigens MTQQPRHTYYENQFC Vitellogenin 1774 Literature Novel Antigens RHTYYENQFCVSEKP Vitellogenin 1779 Literature Novel Antigens ENQFCVSEKPLDTCM Vitellogenin 1784 Literature Novel Antigens VSEKPLDTCMPLICH Vitellogenin 1789 Literature Novel Antigens LDTCMPLICHATESY Vitellogenin 1794 Literature Novel Antigens PLICHATESYTIDVN Vitellogenin 1799 Literature Novel Antigens ATESYTIDVNFYCVP Vitellogenin 1804 Literature Novel Antigens TIDVNFYCVPLGPAA Vitellogenin 1809 Literature Novel Antigens FYCVPLGPAANHYMK Vitellogenin 1814 Literature Novel Antigens LGPAANHYMKLVKKG Vitellogenin 1819 Literature Novel Antigens NHYMKLVKKGILPDL Vitellogenin 1824 Literature Novel Antigens LVKKGILPDLSRNRN Vitellogenin 1829 Literature Novel Antigens ILPDLSRNRNGKRVV Vitellogenin 1834 Literature Novel Antigens SRNRNGKRVVLPVEI Vitellogenin 1839 Literature Novel Antigens GKRVVLPVEIPIQCE Vitellogenin 1844 Literature Novel Antigens VLPVEIPIQCEPVLN Vitellogenin 1849 Literature Novel Antigens SCITYQRGSHAGNKL Enolase 11 Literature Novel Antigens AGNKLAMQEFMILPT Enolase 21 Literature Novel Antigens NKLAMQEFMILPTGA Enolase 23 Literature Novel Antigens AMQEFMILPTGAATF Enolase 26 Literature Novel Antigens MGSEVYHHLKNVIKG Enolase 46 Literature Novel Antigens YHHLKNVIKGKFGLD Enolase 51 Literature Novel Antigens KDGLDLIKDAIEKAG Enolase 83 Literature Novel Antigens LDLIKDAIEKAGYTG Enolase 86 Literature Novel Antigens LIKDAIEKAGYTGKI Enolase 88 Literature Novel Antigens KIEIGMDVAASEFFR Enolase 101 Literature Novel Antigens KYDLDFKNPNTDKSK Enolase 118 Literature Novel Antigens SKWIDKDQLTALYME Enolase 131 Literature Novel Antigens KDQLTALYMEFIKEF Enolase 136 Literature Novel Antigens ALYMEFIKEFPVVSI Enolase 141 Literature Novel Antigens FIKEFPVVSIEDPFD Enolase 146 Literature Novel Antigens QDHWDAWTAMTAATP Enolase 161 Literature Novel Antigens AWTAMTAATPIQIVG Enolase 166 Literature Novel Antigens DDLTVTNPTRIQTAI Enolase 181 Literature Novel Antigens NCLLLKVNQIGTVTE Enolase 201 Literature Novel Antigens LLLKVNQIGTVTESI Enolase 203 Literature Novel Antigens GTVTESIQAHTLAKA Enolase 211 Literature Novel Antigens VTESIQAHTLAKANG Enolase 213 Literature Novel Antigens NGWGTMVSHRSGETE Enolase 226 Literature Novel Antigens WGTMVSHRSGETEDS Enolase 228 Literature Novel Antigens ETEDSFIADLVVGLS Enolase 238 Literature Novel Antigens DSFIADLVVGLSTGQ Enolase 241 Literature Novel Antigens PCRSERLAKYNQILR Enolase 261 Literature Novel Antigens RLAKYNQILRIEEEL Enolase 266 Literature Novel Antigens AKYNQILRIEEELGD Enolase 268 Literature Novel Antigens NALLCCLLVSAASAI NBGA1 26 Novel antigens ALLCCLLVSAASAIT NBGA1 27 Novel antigens CLLVSAASAITPGWL NBGA1 31 Novel antigens TPGWLPINSQLDYHV NBGA1 41 Novel antigens PINSQLDYHVHGRTF NBGA1 46 Novel antigens LDYHVHGRTFSSLFQ NBGA1 51 Novel antigens HGRTFSSLFQVANQY NBGA1 56 Novel antigens SSLFQVANQYTGILY NBGA1 61 Novel antigens TGILYKARLSLDRNE NBGA1 71 Novel antigens EKLHWDVVPMSQQPF NBGA1 116 Novel antigens DVVPMSQQPFQIELN NBGA1 121 Novel antigens SQQPFQIELNSRGEV NBGA1 126 Novel antigens SRGEVRKLRVNKFVE NBGA1 136 Novel antigens RKLRVNKFVELWEIN NBGA1 141 Novel antigens NKFVELWEINMIKAI NBGA1 146 Novel antigens LWEINMIKAIISQLQ NBGA1 151 Novel antigens MIKAIISQLQVVVDE NBGA1 156 Novel antigens ISQLQVVVDEDKKVY NBGA1 161 Novel antigens DKKVYRVFESTVTGR NBGA1 171 Novel antigens DTKLRIMKNHQFTNC NBGA1 211 Novel antigens QFTNCRHNSAYKLHF NBGA1 221 Novel antigens RHNSAYKLHFNAFEY NBGA1 226 Novel antigens YKLHFNAFEYFHLKQ NBGA1 231 Novel antigens FHLKQHKPETFLSNS NBGA1 241 Novel antigens HKPETFLSNSAVSRV NBGA1 246 Novel antigens FLSNSAVSRVIADGD NBGA1 251 Novel antigens NLKNFTFYSGETIHK NBGA1 266 Novel antigens TFYSGETIHKIVLNP NBGA1 271 Novel antigens ETIHKIVLNPEIYNK NBGA1 276 Novel antigens EIYNKQKGMLVSHIN NBGA1 286 Novel antigens QKGMLVSHINVTVER NBGA1 291 Novel antigens KGRELTVIDYELRNV NBGA1 306 Novel antigens TVIDYELRNVGDLSY NBGA1 311 Novel antigens GDLSYSTSLVKAHSM NBGA1 321 Novel antigens STSLVKAHSMRNSAS NBGA1 326 Novel antigens KAHSMRNSASMDLSS NBGA1 331 Novel antigens SHNQKLSKKRQVPLP NBGA1 376 Novel antigens LSKKRQVPLPRPLFE NBGA1 381 Novel antigens QNPEIIPANLLPTYN NBGA1 431 Novel antigens IPANLLPTYNLIHNT NBGA1 436 Novel antigens LPTYNLIHNTKQVDV NBGA1 441 Novel antigens DPVGVAVRLSKDIAA NBGA1 456 Novel antigens AVRLSKDIAADLQGE NBGA1 461 Novel antigens DRHILPRFTILVRLL NBGA1 481 Novel antigens PRFTILVRLLKQLKV NBGA1 486 Novel antigens LVRLLKQLKVSQIME NBGA1 491 Novel antigens KQLKVSQIMEAARKL NBGA1 496 Novel antigens SQIMEAARKLYKLEN NBGA1 501 Novel antigens YKLENDHPNYMNWDT NBGA1 511 Novel antigens AGTWSALNSIQQFIS NBGA1 536 Novel antigens ALNSIQQFISSEMVE NBGA1 541 Novel antigens QQFISSEMVEPKEAS NBGA1 546 Novel antigens PKEASHLITVLPAAV NBGA1 556 Novel antigens HLITVLPAAVSDKNK NBGA1 561 Novel antigens AYLHFLFEMTKDPVF NBGA1 576 Novel antigens LFEMTKDPVFKNMTY NBGA1 581 Novel antigens KDPVFKNMTYVNTSL NBGA1 586 Novel antigens KNMTYVNTSLVLAFS NBGA1 591 Novel antigens VNTSLVLAFSEVIHQ NBGA1 596 Novel antigens VLAFSEVIHQVEMHQ NBGA1 601 Novel antigens EVIHQVEMHQVRDLK NBGA1 606 Novel antigens VEMHQVRDLKIKSVY NBGA1 611 Novel antigens VRDLKIKSVYIPYLV NBGA1 616 Novel antigens IKSVYIPYLVQEFDD NBGA1 621 Novel antigens QEFDDAVKENNSIKI NBGA1 631 Novel antigens AVKENNSIKIQLYTH NBGA1 636 Novel antigens NSIKIQLYTHALGVT NBGA1 641 Novel antigens QLYTHALGVTGNTHI NBGA1 646 Novel antigens ALGVTGNTHILHYLR NBGA1 651 Novel antigens GNTHILHYLRPYIIQ NBGA1 656 Novel antigens LHYLRPYIIQLKTIT NBGA1 661 Novel antigens PYIIQLKTITHHQRL NBGA1 666 Novel antigens LKTITHHQRLFMVQS NBGA1 671 Novel antigens HHQRLFMVQSLERVV NBGA1 676 Novel antigens FMVQSLERVVEHNPR NBGA1 681 Novel antigens LERVVEHNPRKVIDL NBGA1 686 Novel antigens KVIDLLLSLYLDQNE NBGA1 696 Novel antigens LLSLYLDQNEHADIR NBGA1 701 Novel antigens HADIRVEALFLLMKA NBGA1 711 Novel antigens VEALFLLMKADPSIH NBGA1 716 Novel antigens LLMKADPSIHVLKMV NBGA1 721 Novel antigens DPSIHVLKMVAELTH NBGA1 726 Novel antigens VLKMVAELTHTESNN NBGA1 731 Novel antigens QVLSASQSAIKSAAN NBGA1 746 Novel antigens YSEMRRKAKAVEHLL NBGA1 766 Novel antigens VEHLLSTRNMDVSYS NBGA1 776 Novel antigens STRNMDVSYSKSYLY NBGA1 781 Novel antigens DVSYSKSYLYGYKSK NBGA1 786 Novel antigens KSYLYGYKSKKINYD NBGA1 791 Novel antigens GYKSKKINYDSLYNL NBGA1 796 Novel antigens KINYDSLYNLNNIGS NBGA1 801 Novel antigens EDSIYPKSMLLNIFT NBGA1 816 Novel antigens PKSMLLNIFTNNLGR NBGA1 821 Novel antigens LNIFTNNLGRINTHV NBGA1 826 Novel antigens QKGYMVSSMTDLWEA NBGA1 841 Novel antigens DLWEAFHTIYKKDNG NBGA1 851 Novel antigens KTLVKFVEGNLKYFN NBGA1 871 Novel antigens LKYFNMGVQKFWAFD NBGA1 881 Novel antigens MGVQKFWAFDNTTFS NBGA1 886 Novel antigens FWAFDNTTFSNASAV NBGA1 891 Novel antigens NTTFSNASAVIQEFL NBGA1 896 Novel antigens NASAVIQEFLKTYKK NBGA1 901 Novel antigens IQEFLKTYKKPTNFN NBGA1 906 Novel antigens PTNFNHTKLSSSSSI NBGA1 916 Novel antigens HTKLSSSSSITLTLP NBGA1 921 Novel antigens SSSSITLTLPCAMGL NBGA1 926 Novel antigens PAYFKMNSPSLWKYN NBGA1 941 Novel antigens MNSPSLWKYNGEFSI NBGA1 946 Novel antigens GEFSIQTDAKTDVPM NBGA1 956 Novel antigens TDVPMSLENFMNITG NBGA1 966 Novel antigens SLENFMNITGSINLM NBGA1 971 Novel antigens MNITGSINLMFSQMY NBGA1 976 Novel antigens SINLMFSQMYHAQLA NBGA1 981 Novel antigens FSQMYHAQLAFSTAF NBGA1 986 Novel antigens RKVEVHVPVKFQINL NBGA1 1011 Novel antigens HVPVKFQINLDFKNH NBGA1 1016 Novel antigens FQINLDFKNHNGFIR NBGA1 1021 Novel antigens DFKNHNGFIRIIPLF NBGA1 1026 Novel antigens NGFIRIIPLFTDRDY NBGA1 1031 Novel antigens DVLQWQTIPYTTIHN NBGA1 1046 Novel antigens QTIPYTTIHNVPDFE NBGA1 1051 Novel antigens RLFHTQPSITYQTLK NBGA1 1051 Novel antigens VPDFETVYMDQLFKL NBGA1 1061 Novel antigens YQTLKQSTWINYFKL NBGA1 1061 Novel antigens TVYMDQLFKLIHVRK NBGA1 1066 Novel antigens QSTWINYFKLIHVRK NBGA1 1066 Novel antigens QLFKLIHVRKTAHFE NBGA1 1071 Novel antigens NYFKLIHVRKTAHFE NBGA1 1071 Novel antigens IHVRKTAHFEKKMGE NBGA1 1076 Novel antigens NTGIVFKVKYDTDQE NBGA1 1091 Novel antigens FKVKYDTDQEFLDTK NBGA1 1096 Novel antigens FLDTKWFLDEFKVLQ NBGA1 1106 Novel antigens WFLDEFKVLQLFTGL NBGA1 1111 Novel antigens FKVLQLFTGLNYDVP NBGA1 1116 Novel antigens TKDIFYNNLTVYYDH NBGA1 1131 Novel antigens YIMIMKTPKTIAVSF NBGA1 1141 Novel antigens QSKFYETLNPVVQQN NBGA1 1161 Novel antigens ETLNPVVQQNLKLSS NBGA1 1166 Novel antigens VVQQNLKLSSGKKQK NBGA1 1171 Novel antigens HRNVKSHRIRREYTE NBGA1 1186 Novel antigens PRRQEYLSKSMALTG NBGA1 1216 Novel antigens YLSKSMALTGDATAV NBGA1 1221 Novel antigens DATAVVLDMTLKFEG NBGA1 1231 Novel antigens PAESYFTTTVSHATS NBGA1 1246 Novel antigens FTTTVSHATSLVNGS NBGA1 1251 Novel antigens SHATSLVNGSSNYLL NBGA1 1256 Novel antigens LVNGSSNYLLFYDQH NBGA1 1261 Novel antigens SNYLLFYDQHYYEEK NBGA1 1266 Novel antigens KRNQFCLSWSVYKPQ NBGA1 1281 Novel antigens CLSWSVYKPQVPIMN NBGA1 1286 Novel antigens VYKPQVPIMNIYSAF NBGA1 1291 Novel antigens VPIMNIYSAFEFDPN NBGA1 1296 Novel antigens IYSAFEFDPNSKVHA NBGA1 1301 Novel antigens SKVHAIMNIGKECEN NBGA1 1311 Novel antigens GGSAVANIDMLRLSE NBGA1 1326 Novel antigens ANIDMLRLSEHLDYV NBGA1 1331 Novel antigens LRLSEHLDYVKNLTV NBGA1 1336 Novel antigens HLDYVKNLTVSKLCD NBGA1 1341 Novel antigens ASDLNRVHVDINYNL NBGA1 1376 Novel antigens RVHVDINYNLKQHET NBGA1 1381 Novel antigens FKRRVYKVYDFVRTH NBGA1 1396 Novel antigens YKVYDFVRTHLYPHV NBGA1 1401 Novel antigens FVRTHLYPHVSEDVI NBGA1 1406 Novel antigens SEDVIVDNPAQFISA NBGA1 1416 Novel antigens VDNPAQFISANFTLK NBGA1 1421 Novel antigens QFISANFTLKDNTRA NBGA1 1426 Novel antigens NFTLKDNTRAFNVSI NBGA1 1431 Novel antigens DNTRAFNVSIKTPVL NBGA1 1436 Novel antigens FNVSIKTPVLSVNAT NBGA1 1441 Novel antigens KTPVLSVNATVVRLQ NBGA1 1446 Novel antigens ETPVLSVNATSVRLQ NBGA1 1446 Novel antigens SVNATVVRLQSWQSE NBGA1 1451 Novel antigens VVRLQSWQSEMLRMN NBGA1 1456 Novel antigens SWQSEMLRMNPRTSF NBGA1 1461 Novel antigens MLRMNPRTSFAKRFA NBGA1 1466 Novel antigens AKRFAKWALPLYNKP NBGA1 1476 Novel antigens SSYINTFDNFTYSAH NBGA1 1496 Novel antigens TFDNFTYSAHHIVQN NBGA1 1501 Novel antigens TYSAHHIVQNDAFYT NBGA1 1506 Novel antigens HIVQNDAFYTILDIP NBGA1 1511 Novel antigens DAFYTILDIPQKFNM NBGA1 1516 Novel antigens QKFNMEYFKVAFKPT NBGA1 1526 Novel antigens EYFKVAFKPTSPVPN NBGA1 1531 Novel antigens MQREVLVFLRNAKIE NBGA1 1546 Novel antigens LVFLRNAKIELKPNQ NBGA1 1551 Novel antigens DLNVSQDRIGYVYAF NBGA1 1586 Novel antigens QDRIGYVYALPTKAA NBGA1 1591 Novel antigens YVYALPTKAAHIVFP NBGA1 1596 Novel antigens HIVFPSYEIEMFYDG NBGA1 1606 Novel antigens SYEIEMFYDGSRIMI NBGA1 1611 Novel antigens MFYDGSRIMIQASNM NBGA1 1616 Novel antigens SRIMIQASNMYRNFT NBGA1 1621 Novel antigens QASNMYRNFTKGLLW NBGA1 1626 Novel antigens LTPWGCYAKDMALFV NBGA1 1651 Novel antigens CYAKDMALFVASYAD NBGA1 1656 Novel antigens MALFVASYADNSNSE NBGA1 1661 Novel antigens LVSHQMRLSQVIKLA NBGA1 1696 Novel antigens GVLVFTKENFKKGVS NBGA10 16 Novel antigens DNEFVLVEFYAPWCG NBGA10 31 Novel antigens PTLKFFRSGSPIDYS NBGA10 91 Novel antigens DEIVSWLLKKTGPVA NBGA10 111 Novel antigens VDDAKSFIDASNVAI NBGA10 131 Novel antigens SFIDASNVAIIGFFK NBGA10 136 Novel antigens AAKNFLAAANAIDDY NBGA10 156 Novel antigens PQIEVTFEIDANGIL NBGA11 31 Novel antigens TFEIDANGILQVSAE NBGA11 36 Novel antigens LESYAYSLKNQLADK NBGA11 101 Novel antigens KKELEDIVQPIIAKL NBGA11 156 Novel antigens DIVQPIIAKLYQGAG NBGA11 161 Novel antigens LELGALLTAMAMVTA NBGA12 16 Novel antigens LLTAMAMVTAKLATV NBGA12 21 Novel antigens STDSTLVYKIQPVNN NBGA12 71 Novel antigens LVYKIQPVNNAHGGG NBGA12 76 Novel antigens ASYFKSNCPDAYSYA NBGA12 151 Novel antigens SSLEVFFQQQRILLR NBGA13 1 Novel antigens FFQQQRILLRLHRCF NBGA13 6 Novel antigens RILLRLHRCFQVLGR NBGA13 11 Novel antigens WGGDVAFVKHLTALE NBGA13 26 Novel antigens AFVKHLTALENTDGH NBGA13 31 Novel antigens NQLNEIRHAILAAGD NBGA13 96 Novel antigens IRHAILAAGDLYSRR NBGA13 101 Novel antigens DGTKDLLFKNSATGL NBGA13 126 Novel antigens KDLLFKNSATGLLSV NBGA13 129 Novel antigens KHCLQMASNTMPYQI NBGA14 16 Novel antigens MPYQIASGFSTSQLA NBGA14 26 Novel antigens ASGFSTSQLAMIQNA NBGA14 31 Novel antigens TSQLAMIQNAIDEYH NBGA14 36 Novel antigens ERDDYVTIHWENIQS NBGA14 121 Novel antigens YGKIIKRLEAKGFKL NBGA15 1 Novel antigens KGFKLVAMKFVWADE NBGA15 11 Novel antigens VAMKFVWADEELLKK NBGA15 16 Novel antigens FPGLVKYMSSGPVVP NBGA15 41 Novel antigens MVWEGLNVVKTGRLM NBGA15 56 Novel antigens LNVVKTGRLMLGATD NBGA15 61 Novel antigens STRMELQHLQSIEVF NBGA16 1 Novel antigens LQHLQSIEVFPEDEG NBGA16 6 Novel antigens ILSCRIIGAQKFDVV NBGA16 76 Novel antigens SKDFQYTNEANIYKL NBGA16 101 Novel antigens YTNEANIYKLNIAEI NBGA16 106 Novel antigens NIYKLNIAEIFPEDS NBGA16 111 Novel antigens LILATAALAVAYPSP NBGA2 5 Novel antigens ILATAALAVAYPSPG NBGA2 6 Novel antigens QDYKVLADKTYLTRQ NBGA2 21 Novel antigens LADKTYLTRQRDLLK NBGA2 26 Novel antigens YLTRQRDLLKLLVRI NBGA2 31 Novel antigens RDLLKLLVRIQQPNY NBGA2 36 Novel antigens LLVRIQQPNYYADQY NBGA2 41 Novel antigens YADQYEIGQSYDIEA NBGA2 51 Novel antigens YDIEANINNYKYPYV NBGA2 61 Novel antigens NINNYKYPYVVKNFV NBGA2 66 Novel antigens KYPYVVKNFVAAYKN NBGA2 71 Novel antigens VKNFVAAYKNGMLAR NBGA2 76 Novel antigens PYYTTQSYETKLLFD NBGA2 96 Novel antigens QSYETKLLFDLFYYA NBGA2 101 Novel antigens KLLFDLFYYANDYDT NBGA2 106 Novel antigens LFYYANDYDTFYKTA NBGA2 111 Novel antigens HINEGQFLYALSSAL NBGA2 131 Novel antigens QFLYALSSALFQRED NBGA2 136 Novel antigens LNDYILPAPYEIYPW NBGA2 151 Novel antigens EIYPWLFVDSDVIQR NBGA2 161 Novel antigens LFVDSDVIQRAYETR NBGA2 166 Novel antigens DVIQRAYETRMSDVH NBGA2 171 Novel antigens MSDVHLTAPKTYIFP NBGA2 181 Novel antigens LTAPKTYIFPVNYTV NBGA2 186 Novel antigens TYIFPVNYTVHTPEQ NBGA2 191 Novel antigens ELNYFYHDVGLNTYY NBGA2 206 Novel antigens YHDVGLNTYYSYYYF NBGA2 211 Novel antigens LNTYYSYYYFNYPTF NBGA2 216 Novel antigens SYYYFNYPTFFNSTE NBGA2 221 Novel antigens NYPTFFNSTEYGVQF NBGA2 226 Novel antigens DRRGEMFYYTRQQLY NBGA2 241 Novel antigens PRHGEQFYYFYQQIY NBGA2 241 Novel antigens MFYYTRQQLYARYFL NBGA2 246 Novel antigens QFYYFYQQIYARYML NBGA2 246 Novel antigens RQQLYARYFLERLSN NBGA2 251 Novel antigens YQQIYARYMLERYSN NBGA2 251 Novel antigens ARYFLERLSNDLPDV NBGA2 256 Novel antigens EPLHYDRPFQTEYNP NBGA2 271 Novel antigens KPFTYNKAFKTPYNP NBGA2 271 Novel antigens DRPFQTEYNPQLRYP NBGA2 276 Novel antigens NKAFKTPYNPQLRYP NBGA2 276 Novel antigens PVRPYEYSRRSLYYS NBGA2 296 Novel antigens PARPAYMVPQDFDLY NBGA2 296 Novel antigens EYSRRSLYYSNGYSH NBGA2 301 Novel antigens SLYYSNGYSHYYGNY NBGA2 306 Novel antigens NYYTGDYHPSYYYGY NBGA2 331 Novel antigens DYHPSYYYGYATQYD NBGA2 336 Novel antigens YYYGYATQYDYYYPE NBGA2 341 Novel antigens ATQYDYYYPEDLQSY NBGA2 346 Novel antigens YYYPEDLQSYERRVR NBGA2 351 Novel antigens GYFFGFQGEKYPLYE NBGA2 371 Novel antigens FQGEKYPLYENYIKG NBGA2 376 Novel antigens YPLYENYIKGIDYLG NBGA2 381 Novel antigens NQRFYGSIYHYYRQL NBGA2 406 Novel antigens GSIYHYYRQLAGKSV NBGA2 411 Novel antigens YYRQLAGKSVDPYNN NBGA2 416 Novel antigens DPYNNYGLAPSALQN NBGA2 426 Novel antigens YGLAPSALQNIYTTL NBGA2 431 Novel antigens SALQNIYTTLRDPAN NBGA2 436 Novel antigens RDPANWQILKRVNYL NBGA2 446 Novel antigens WQILKRVNYLFQRYK NBGA2 451 Novel antigens RVNYLFQRYKGYLPR NBGA2 456 Novel antigens EHFDVDLDNVVNVKV NBGA2 496 Novel antigens AEDGKYIDYRARQTR NBGA2 511 Novel antigens YIDYRARQTRLNHKP NBGA2 516 Novel antigens QATDAYVRVFLGPKY NBGA2 541 Novel antigens YVRVFLGPKYDYLHS NBGA2 546 Novel antigens DRRHYFVEIDRFPYK NBGA2 566 Novel antigens FVEIDRFPYKVQAGK NBGA2 571 Novel antigens RFPYKVQAGKTTITR NBGA2 576 Novel antigens SVVSPDYQSYRTLMR NBGA2 596 Novel antigens DYQSYRTLMRKVYDA NBGA2 601 Novel antigens RTLMRKVYDAYEGKD NBGA2 606 Novel antigens YEGKDQFYYDKSEQY NBGA2 616 Novel antigens QFYYDKSEQYCGYPE NBGA2 621 Novel antigens GQEYTFYVIVTPYAK NBGA2 646 Novel antigens FYVIVTPYAKQDDHD NBGA2 651 Novel antigens YKSFSYCGVGANHRI NBGA2 671 Novel antigens SHDFVTPNMYFKDVV NBGA2 701 Novel antigens TPNMYFKDVVIYHKK NBGA2 706 Novel antigens FSNMDIKGKNALVTG NBGA3 1 Novel antigens AATGIGLEYVKQLLE NBGA3 16 Novel antigens GLEYVKQLLENGAQH NBGA3 21 Novel antigens KQLLENGAQHVAVCD NBGA3 26 Novel antigens KELVEKYGKGKAIFI NBGA3 51 Novel antigens KAIFIKCDVTNIPEF NBGA3 61 Novel antigens EDAFKKAYNAFKSLD NBGA3 76 Novel antigens KAYNAFKSLDIVINN NBGA3 81 Novel antigens FKSLDIVINNAGILN NBGA3 86 Novel antigens IVINNAGILNDEKWE NBGA3 91 Novel antigens DEKWELQIAINVNGV NBGA3 101 Novel antigens LQIAINVNGVVRGTL NBGA3 106 Novel antigens GGKGGVIVNIASILG NBGA3 131 Novel antigens VIVNIASILGLQNMA NBGA3 136 Novel antigens ASILGLQNMAGCPVY NBGA3 141 Novel antigens GCPVYVGTKHAVVGI NBGA3 151 Novel antigens AVVGISRSFGMPFHF NBGA3 161 Novel antigens MPFHFDRTGVRVLTM NBGA3 171 Novel antigens DRTGVRVLTMCPGVT NBGA3 176 Novel antigens AKGMMHMIKKGANGS NBGA3 226 Novel antigens GNKPVYEVAIPDRLT NBGA3 246 Novel antigens VYEVAIPDRLTLRVE NBGA3 250 Novel antigens AGVLWVCATGMARQV NBGA4 11 Novel antigens QTLFLLLLLLAAVSA NBGA4 31 Novel antigens LLLLLAAVSASQQCK NBGA4 36 Novel antigens AGNTYVYSFEGGTTT NBGA4 66 Novel antigens QGDGVKLHLKAKAEV NBGA4 86 Novel antigens THLNDLESHPVSFSF NBGA4 126 Novel antigens SEASLNLKRAILAHF NBGA4 156 Novel antigens NLKRAILAHFQVAPQ NBGA4 161 Novel antigens ILAHFQVAPQETARS NBGA4 166 Novel antigens RGGTTTITKSRNLNK NBGA4 201 Novel antigens CHLREHLRQDFASVT NBGA4 216 Novel antigens HLRQDFASVTYHVES NBGA4 221 Novel antigens FASVTYHVESDLQNS NBGA4 226 Novel antigens TQEFKHQLQGGVLRV NBGA4 246 Novel antigens KYLYRPFANQDAGAK NBGA4 266 Novel antigens DAGAKTVVDSKLTYV NBGA4 276 Novel antigens QSIIFHPPNVHPGSG NBGA4 306 Novel antigens KEFANVVRVVRHTSK NBGA4 346 Novel antigens VVRVVRHTSKNDLLS NBGA4 351 Novel antigens NDLLSVYNQVKSGAG NBGA4 361 Novel antigens FKDKSAGTKMFLDAL NBGA4 376 Novel antigens AGTKMFLDALFRAGT NBGA4 381 Novel antigens VAVELLKSNKITGPH NBGA4 401 Novel antigens AEFYYLQLAYTRHVT NBGA4 416 Novel antigens LQLAYTRHVTKAALL NBGA4 421 Novel antigens TRHVTKAALLAAVTL NBGA4 426 Novel antigens KAALLAAVTLLEQPN NBGA4 431 Novel antigens AAVTLLEQPNPSKLA NBGA4 436 Novel antigens AEVDEFLEKLSLLLN NBGA4 471 Novel antigens FLEKLSLLLNGGCKV NBGA4 476 Novel antigens SLLLNGGCKVSNYDE NBGA4 481 Novel antigens SNYDEEVKIVATLKA NBGA4 491 Novel antigens EVKIVATLKALQNAH NBGA4 496 Novel antigens ATLKALQNAHHLNDA NBGA4 501 Novel antigens HLNDAVTSKLQTCLL NBGA4 511 Novel antigens DDGVPTRIRSAVLDV NBGA4 526 Novel antigens CKAKDISLEVLKNYQ NBGA4 546 Novel antigens ISLEVLKNYQLDSEL NBGA4 551 Novel antigens LKNYQLDSELRIKAF NBGA4 556 Novel antigens LDSELRIKAFLALVE NBGA4 561 Novel antigens RIKAFLALVECPCNK NBGA4 566 Novel antigens KELLDKEPSYQVGSF NBGA4 586 Novel antigens KEPSYQVGSFIVSYL NBGA4 591 Novel antigens QVGSFIVSYLRNLRA NBGA4 596 Novel antigens IVSYLRNLRASANPS NBGA4 601 Novel antigens RNLRASANPSKEKQK NBGA4 606 Novel antigens AVFGEIRTTKRFPID NBGA4 621 Novel antigens IRTTKRFPIDFRKFS NBGA4 626 Novel antigens RFPIDFRKFSNNFEF NBGA4 631 Novel antigens FRKFSNNFEFSYLLG NBGA4 636 Novel antigens NNFEFSYLLGGANVG NBGA4 641 Novel antigens TTVESNVIYSQNSFL NBGA4 656 Novel antigens NVIYSQNSFLPRATT NBGA4 661 Novel antigens LNLTTEFFGHSVNLL NBGA4 676 Novel antigens EFFGHSVNLLEVELR NBGA4 681 Novel antigens GYFNTHTAAEVVQKG NBGA4 711 Novel antigens DVENTAKQRFNHAIR NBGA4 731 Novel antigens AKQRFNHAIRGKRSV NBGA4 736 Novel antigens NHAIRGKRSVTKEQL NBGA4 741 Novel antigens TKEQLELVKSKSVSP NBGA4 751 Novel antigens ELVKSKSVSPYHSET NBGA4 756 Novel antigens DRELLLELSTRLFGA NBGA4 771 Novel antigens RLFGAEVGWLALHHN NBGA4 781 Novel antigens EVGWLALHHNARDAA NBGA4 786 Novel antigens TTFNLLDKVMKKAKD NBGA4 806 Novel antigens FDYKLRQHNTFLDTE NBGA4 821 Novel antigens FLDTELVYPTSLGFP NBGA4 831 Novel antigens LVYPTSLGFPLKLVL NBGA4 836 Novel antigens SLGFPLKLVLAGSSA NBGA4 841 Novel antigens LKLVLAGSSAVHVEL NBGA4 846 Novel antigens VHDLVHNLKNSHVHF NBGA4 866 Novel antigens HNLKNSHVHFRFVPS NBGA4 871 Novel antigens SHVHFRFVPSAAVEF NBGA4 876 Novel antigens RFVPSAAVEFVGAFV NBGA4 881 Novel antigens AAVEFVGAFVVDAYA NBGA4 886 Novel antigens VGAFVVDAYAVEAGL NBGA4 891 Novel antigens VDAYAVEAGLKVAAT NBGA4 896 Novel antigens VEAGLKVAATLHTAT NBGA4 901 Novel antigens KVAATLHTATGSDIT NBGA4 906 Novel antigens DVGVDVTVGLPVQKQ NBGA4 926 Novel antigens PVQKQDIVTLKTEVL NBGA4 936 Novel antigens DIVTLKTEVLTTVQE NBGA4 941 Novel antigens HGCFDQLSPLVGLTF NBGA4 976 Novel antigens VGLTFCTTMSFPWDP NBGA4 986 Novel antigens FPWDPVASKAAFYPL NBGA4 996 Novel antigens AFYPLNGPSKFSLVV NBGA4 1006 Novel antigens TSYHFRASLNKADPH NBGA4 1026 Novel antigens KKSLELLLETPGSKT NBGA4 1041 Novel antigens ERKLGLILERTYDPY NBGA4 1056 Novel antigens TYDPYHGVKAQLNSP NBGA4 1066 Novel antigens HGVKAQLNSPWKQVS NBGA4 1071 Novel antigens QLNSPWKQVSAELAF NBGA4 1076 Novel antigens DEQEYYVKLGASVTG NBGA4 1106 Novel antigens THQFNVAGSVTVDKT NBGA4 1156 Novel antigens TDLKVYYGENHVVLK NBGA4 1206 Novel antigens YYGENHVVLKSGFKR NBGA4 1211 Novel antigens HVVLKSGFKRPSANN NBGA4 1216 Novel antigens QYPDFGVNLIWNHKR NBGA4 1241 Novel antigens GVNLIWNHKRDKNNF NBGA4 1246 Novel antigens DKNNFGNSLAVVHGR NBGA4 1256 Novel antigens EARFTLNQEAHYQFD NBGA4 1276 Novel antigens LNQEAHYQFDSIHKF NBGA4 1281 Novel antigens HYQFDSIHKFEFASK NBGA4 1286 Novel antigens SIHKFEFASKNKVTY NBGA4 1291 Novel antigens EFASKNKVTYPLLGI NBGA4 1296 Novel antigens PLLGIIGKLDASVQP NBGA4 1306 Novel antigens KTFHLDVEASYEKHK NBGA4 1321 Novel antigens RVIVSEGKSKFTTEL NBGA4 1371 Novel antigens NNIDFQIDAEAKIHG NBGA4 1406 Novel antigens QPDPYKLDSGLVYNP NBGA4 1421 Novel antigens KLDSGLVYNPQLFDA NBGA4 1426 Novel antigens KVFLKNYLVGNAQFK NBGA4 1471 Novel antigens NYLVGNAQFKYTNGE NBGA4 1476 Novel antigens GSATLNVDVPKLGRK NBGA4 1491 Novel antigens DLHVKGSQHVATVEL NBGA4 1511 Novel antigens GSQHVATVELYYNAE NBGA4 1516 Novel antigens ATVELYYNAEKKLAF NBGA4 1521 Novel antigens YYNAEKKLAFHTDTD NBGA4 1526 Novel antigens KKLAFHTDTDLKKDS NBGA4 1531 Novel antigens LDSKNVLSILNYKTE NBGA4 1546 Novel antigens VLSILNYKTEVNVKG NBGA4 1551 Novel antigens YTGPFSVDNVLEFKL NBGA5 16 Novel antigens KKLQFTYSESLDLDD NBGA5 51 Novel antigens SSGKASYESFQNFRV NBGA5 246 Novel antigens SYESFQNFRVEADIE NBGA5 251 Novel antigens LKKWHVLLANKPQAK NBGA5 271 Novel antigens LKADVFFNKFNPTDN NBGA5 336 Novel antigens RQPLSFDHAVELKLL NBGA5 436 Novel antigens TYNFHSYLNEKALGV NBGA5 456 Novel antigens KALGVILTLPQRIIA NBGA5 466 Novel antigens KAAVHLLVAVKASKE NBGA5 511 Novel antigens DGASYISTLAYQDEK NBGA5 616 Novel antigens AQIQVVIHLDEQYIY NBGA5 636 Novel antigens EQYIYVKSPTAELIK NBGA5 646 Novel antigens SKAVYYKKILPTRSS NBGA5 696 Novel antigens YKKILPTRSSPLISC NBGA5 701 Novel antigens IESIRKQTAIEIEQL NBGA6 96 Novel antigens KQTAIEIEQLNARVV NBGA6 101 Novel antigens KLQIQITELEMSLDV NBGA6 131 Novel antigens TIKKQSLTLTEIQAH NBGA6 156 Novel antigens GIAQRKLQSVTAELE NBGA6 186 Novel antigens RVNELTTINVNLASA NBGA6 226 Novel antigens TTINVNLASAKSKVE NBGA6 231 Novel antigens EQERIVKIEAIKKSL NBGA6 286 Novel antigens LSLIRAKHRTFVTTS NBGA6 431 Novel antigens PQKFKVVFDTGSSNL NBGA7 36 Novel antigens VVFDTGSSNLWVPSK NBGA7 41 Novel antigens WVPSKKCHLTNIACL NBGA7 51 Novel antigens KCHLTNIACLLHNKY NBGA7 56 Novel antigens NIACLLHNKYDSTKS NBGA7 61 Novel antigens NGTSFAIQYGSGSLS NBGA7 81 Novel antigens SGSLSGFLSTDVLDI NBGA7 91 Novel antigens GFLSTDVLDIGGLKV NBGA7 96 Novel antigens DVLDIGGLKVQKQTF NBGA7 101 Novel antigens EPGLAFVAAKFDGIL NBGA7 121 Novel antigens FVAAKFDGILGMAYS NBGA7 126 Novel antigens FDGILGMAYSTISVD NBGA7 131 Novel antigens TISVDGVTPVFYNMV NBGA7 141 Novel antigens GVTPVFYNMVKQGLV NBGA7 146 Novel antigens FYNMVKQGLVSQPIF NBGA7 151 Novel antigens KQGLVSQPIFSFYLS NBGA7 156 Novel antigens SQPIFSFYLSRDPGA NBGA7 161 Novel antigens SDPNHYKGDFTYLSV NBGA7 186 Novel antigens YKGDFTYLSVDRKMY NBGA7 191 Novel antigens TYLSVDRKMYWQFKM NBGA7 196 Novel antigens DRKMYWQFKMDKIQI NBGA7 201 Novel antigens WQFKMDKIQIGNGSF NBGA7 206 Novel antigens IAGPVSEVTALNRQI NBGA7 236 Novel antigens SEVTALNRQIGGTPI NBGA7 241 Novel antigens ILGGKKFTLEGKDYI NBGA7 276 Novel antigens KFTLEGKDYILRVSQ NBGA7 281 Novel antigens GKDYILRVSQLGHTV NBGA7 286 Novel antigens LGHTVCLSGFMGIDL NBGA7 296 Novel antigens CLSGFMGIDLPKGPL NBGA7 301 Novel antigens WILGDVFIGKFYTEF NBGA7 316 Novel antigens VFIGKFYTEFDMENN NBGA7 321 Novel antigens FYTEFDMENNRVGFA NBGA7 326 Novel antigens AGEKVRIIIDRFMDF NBGA8 16 Novel antigens RIIIDRFMDFREQEK NBGA8 21 Novel antigens VPPELVVVFDVRLAV NBGA8 66 Novel antigens VVVFDVRLAVTVDHA NBGA8 71 Novel antigens HDEFLNEDIFLKGID NBGA8 176 Novel antigens NEDIFLKGIDIFCQI NBGA8 181 Novel antigens LKGIDIFCQIIPAVA NBGA8 186 Novel antigens IFCQIIPAVANVAPP NBGA8 191 Novel antigens TLGEAISSSTLRVFA NBGA9 6 Novel antigens NIREGGFAHFEARLE NBGA9 76 Novel antigens SSRITTFFNFGYVAL NBGA9 111 Novel antigens TFFNFGYVALTIKHV NBGA9 116 Novel antigens GYVALTIKHVTTHDI NBGA9 121 Novel antigens

TABLE-US-00006 TABLE 6 Non-redundant Bla g Epitopes (SEQ ID NOs.: 1834-1997) Average Magnitude Response Rate Sequence Antigen Position of Response per Subject TIPYYTKKFDEVVKA Bla g 5 126 311.6 11.4 ISDFRAAIANYHYDA Bla g 5 96 216.2 18.6 YFVAILDYLNHMAKE Bla g 5 156 137.2 15.7 VAISRYLGKQFGLSG Bla g 5 66 94.9 8.6 MIVDTISDFRAAIAN Bla g 5 91 91.4 7.1 DLVANQPNLKALREK Bla g 5 171 91.0 7.1 HDDRLGFLTFCPTNL Bla g 9 261 83.1 7.1 KNRTTIRGRTKFEGN Bla g 4 71 81.7 2.9 DRKMYWQFKMDKIQI NBGA7 201 78.8 5.7 ALREKVLGLPAIKAW Bla g 5 181 77.1 12.9 IRGRTKFEGNKFTID Bla g 4 76 75.5 5.7 NDIEKRVPFSHDDRL Bla g 9 251 72.8 15.7 HMAKEDLVANQPNLK Bla g 5 166 68.8 4.3 VLEKLEAGFAKLAAS Bla g 9 6 65.5 14.3 NYAIVEGCPAAANGH Bla g 4 111 64.6 1.4 GIRIYVDVVLNQMSG Bla g 11 108 62.5 4.3 RWRQIFNMVGFRNAV Bla g 11 388 61.7 11.4 NIACLLHNKYDSTKS NBGA7 61 61.0 2.9 NGGYLAAGKLTWADF Bla g 5 141 58.5 5.7 LNIFTNNLGRINTHV NBGA1 826 57.6 4.3 KTPVLEIDGKQTHQS Bla g 5 51 57.0 14.3 PAYFKMNSPSLWKYN NBGA1 941 56.1 4.3 PKSMLLNIFTNNLGR NBGA1 821 52.5 7.1 FQINLDFKNHNGFIR NBGA1 1021 52.0 1.4 SSLFQVANQYTGILY NBGA1 61 50.2 10.0 VLGLPAIKAWVAKRP Bla g 5 186 48.5 14.3 QVYRRLVTAVNDIEK Bla g 9 241 44.1 5.7 RHNSAYKLHFNAFEY NBGA1 226 44.0 1.4 KLAASDSKSLLRKYL Bla g 9 16 43.8 7.1 RLFGAEVGWLALHHN NBGA4 781 35.5 1.4 RVPFSHDDRLGFLTF Bla g 9 256 34.2 7.1 WVCEHRWRQIFNMVG Bla g 11 383 33.9 4.3 ATDYENYAIVEGCPA Bla g 4 106 32.7 1.4 KFTIDYNDKGKAFSA Bla g 4 86 32.0 11.4 AAIANYHYDADENSK Bla g 5 101 26.2 11.4 FGSTLLDVIQSGLEN Bla g 9 46 26.1 8.6 HYQFDSIHKFEFASK NBGA4 1286 24.4 1.4 TKKFDEVVKANGGYL Bla g 5 131 24.3 4.3 YLGKQFGLSGKDDWE Bla g 5 71 22.6 8.6 LNQEAHYQFDSIHKF NBGA4 1281 22.6 2.9 KCHLTNIACLLHNKY NBGA7 56 22.6 5.7 GVTPVFYNMVKQGLV NBGA7 146 20.8 1.4 RCGRSMQGYPFNPCL Bla g 9 126 20.4 10.0 STSLVKAHSMRNSAS NBGA1 326 19.9 4.3 LKYFNMGVQKFWAFD NBGA1 881 19.8 8.6 GASILTYKTSKLYKM Bla g 11 318 19.3 7.1 NLEIDMIVDTISDFR Bla g 5 86 19.1 2.9 AKGMMHMIKKGANGS NBGA3 226 18.7 2.9 PAIKAWVAKRPPTDL Bla g 5 190 18.7 10.0 VPIMNIYSAFEFDPN NBGA1 1296 18.5 4.3 KAHSMRNSASMDLSS NBGA1 331 16.4 4.3 EAGFAKLAASDSKSL Bla g 9 11 16.0 7.1 DVLQWQTIPYTTIHN NBGA1 1046 15.9 2.9 KLYKMAVAFMLAYPY Bla g 11 328 15.8 7.1 AGTWSALNSIQQFIS NBGA1 536 15.7 7.1 VIYVQIRFSVRRFHP Bla g 4 126 15.1 2.9 RGNNAIKWLVNFGVG Bla g 11 278 15.0 5.7 KFEGNKFTIDYNDKG Bla g 4 81 14.2 4.3 PLKKETIPYYTKKFD Bla g 5 121 14.2 5.7 QKGYMVSSMTDLWEA NBGA1 841 13.9 8.6 SPYFVTNTEKMITEF Hsp60 201 13.6 2.9 RILLRLHRCFQVLGR NBGA13 11 13.5 1.4 RSEERLATATAKLAE Bla g 7 101 13.3 1.4 WCNEEDHLRIISMQM Bla g 9 221 13.1 7.1 RCNNVGIRIYVDVVL Bla g 11 103 13.0 2.9 LDYLNHMAKEDLVAN Bla g 5 161 13.0 10.0 AKRFAKWALPLYNKP NBGA1 1476 12.2 1.4 GEKDFEDYRFQEGDW Bla g 5 26 12.0 8.6 FYTEFDMENNRVGFA NBGA7 326 11.3 2.9 CPTNLGTTVRASVRI Bla g 9 271 11.2 4.3 FRPWWERYQLVSYNL Bla g 11 16 10.8 4.3 IVINNAGILNDEKWE NBGA3 91 10.8 4.3 DENSKQKKWDPLKKE Bla g 5 111 10.3 5.7 LIPVDQIIAIATDYL Bla g 1.01 46 9.8 1.4 GHSHFVSDVVLSSDG RACK1 61 9.6 2.9 IHENLIVTSPFRPWW Bla g 11 6 9.3 2.9 KAIFIKCDVTNIPEF NBGA3 61 9.3 7.1 MAPSYKLTYCPVKAL Bla g 5 1 8.8 4.3 LNAIEFINNIHDLLG Bla g 1 376 8.8 2.9 FLLSYGEKDFEDYRF Bla g 5 21 8.5 8.6 QDVHKKLREWLSKNV TPI 181 8.5 1.4 HGRTFSSLFQVANQY NBGA1 56 8.4 4.3 WVPSKKCHLTNIACL NBGA7 51 8.4 5.7 KNMTYVNTSLVLAFS NBGA1 591 8.4 2.9 KDDWENLEIDMIVDT Bla g 5 81 8.4 2.9 QKKWDPLKKETIPYY Bla g 5 116 7.7 4.3 MNITGSINLMFSQMY NBGA1 976 7.6 5.7 PVDQIIAIATDYLAN Bla g 1.01 240 7.5 2.9 QIIAIATDYLANDAE Bla g 1.01 51 7.5 2.9 MGVQKFWAFDNTTFS NBGA1 886 7.3 7.1 IQGKFGLDATAVGDE Enolase 196 6.9 1.4 QQFISSEMVEPKEAS NBGA1 546 6.8 2.9 IDDIIAILPVDDLYA Bla g 1 36 6.6 2.9 QPNLKALREKVLGLP Bla g 5 176 6.5 5.7 KVFLKNYLVGNAQFK NBGA4 1471 6.4 1.4 VVRLQSWQSEMLRMN NBGA1 1456 6.4 2.9 HTKLSSSSSITLTLP NBGA1 921 6.2 5.7 KIGEYKNMIAEGIID Hsp60 481 6.2 1.4 KALQNAESEVAALNR Bla g 7 76 6.0 1.4 IRFSVRRFHPKLGDK Bla g 4 131 5.8 2.9 KAIEEDLKHFNLKYE Bla g 4 161 5.7 2.9 THQFNVAGSVTVDKT NBGA4 1156 5.6 2.9 IRHAILAAGDLYSRR NBGA13 101 5.5 1.4 RDMVRRCNNVGIRIY Bla g 11 98 5.2 5.7 KLGDKEMIQHYTLDQ Bla g 4 141 5.0 1.4 NASAVIQEFLKTYKK NBGA1 901 5.0 2.9 VVFDTGSSNLWVPSK NBGA7 41 4.7 4.3 EVVKANGGYLAAGKL Bla g 5 136 4.6 5.7 AQIQVVIHLDEQYIY NBGA5 636 4.6 5.7 ALNSIQQFISSEMVE NBGA1 541 4.4 4.3 KAAVHLLVAVKASKE NBGA5 511 4.4 1.4 LVYPTSLGFPLKLVL NBGA4 836 4.4 2.9 DKKVYRVFESTVTGR NBGA1 171 4.4 2.9 QTHQSVAISRYLGKQ Bla g 5 61 4.3 4.3 TGILYKARLSLDRNE NBGA1 71 4.3 2.9 SINLMFSQMYHAQLA NBGA1 981 4.3 1.4 STSCNVVVASQECVG Bla g 2 56 4.2 4.3 KQLKVSQIMEAARKL NBGA1 496 4.2 4.3 PNLKPSMPFGKTPVL Bla g 5 41 4.2 2.9 NTTFSNASAVIQEFL NBGA1 896 4.2 5.7 RIKAFLALVECPCNK NBGA4 566 4.2 1.4 KKLQFTYSESLDLDD NBGA5 51 4.2 2.9 VEALFLLMKADPSIH NBGA1 716 4.2 1.4 SVNATVVRLQSWQSE NBGA1 1451 4.1 2.9 LNTYYSYYYFNYPTF NBGA2 216 4.1 2.9 VNQHKKAIEEDLKHF Bla g 4 156 4.0 2.9 VFIGKFYTEFDMENN NBGA7 321 4.0 2.9 LTVFDSTSCNVVVAS Bla g 2 51 4.0 2.9 LVFLRNAKIELKPNQ NBGA1 1551 4.0 2.9 DCGVAGFRVDAAKHM Bla g 11 198 3.9 2.9 SEVTALNRQIGGTPI NBGA7 241 3.9 2.9 NVIYSQNSFLPRATT NBGA4 661 3.8 1.4 EIDGKQTHQSVAISR Bla g 5 56 3.8 4.3 YHYDADENSKQKKWD Bla g 5 106 3.7 2.9 KVIDLLLSLYLDQNE NBGA1 696 3.6 7.1 DRRGEMFYYTRQQLY NBGA2 241 3.5 1.4 LWEINMIKAIISQLQ NBGA1 151 3.5 2.9 EMIQHYTLDQVNQHK Bla g 4 146 3.5 2.9 ARYFLERLSNDLPDV NBGA2 256 3.5 2.9 DVLDIGGLKVQKQTF NBGA7 101 3.5 2.9 KELVEKYGKGKAIFI NBGA3 51 3.4 2.9 ERYQLVSYNLNSRSG Bla g 11 21 3.4 1.4 FSQMYHAQLAFSTAF NBGA1 986 3.4 2.9 VYEVAIPDRLTLRVE NBGA3 250 3.4 2.9 DPSIHVLKMVAELTH NBGA1 726 3.4 1.4 GKDYILRVSQLGHTV NBGA7 286 3.4 4.3 IAGPVSEVTALNRQI NBGA7 236 3.3 2.9 SHVHFRFVPSAAVEF NBGA4 876 3.3 1.4 FRKFSNNFEFSYLLG NBGA4 636 3.3 1.4 GEPIRFLLSYGEKDF Bla g 5 16 3.3 2.9 VQKLQKEVDRLEDEL Bla g 7 246 3.3 1.4 KEFANVVRVVRHTSK NBGA4 346 3.3 2.9 GQEYTFYVIVTPYAK NBGA2 646 3.2 2.9 LGHTVCLSGFMGIDL NBGA7 296 3.2 2.9 CATDTLANEDCFRHE Bla g 4 6 3.2 2.9 AAVAYLQSDEFETIV Bla g 1.01 260 3.2 1.4 KTPVLSVNATVVRLQ NBGA1 1446 3.2 1.4 QTLFLLLLLLAAVSA NBGA4 31 3.2 1.4 LKNYQLDSELRIKAF NBGA4 556 3.2 1.4 LRLSEHLDYVKNLTV NBGA1 1336 3.1 1.4 HHQRLFMVQSLERVV NBGA1 676 3.1 2.9 LNDYILPAPYEIYPW NBGA2 151 3.0 2.9 NAIEFLNNIHDLLGI Bla g 1 1 3.0 1.4 AVLALCATDTLANED Bla g 4 1 3.0 2.9

TABLE-US-00007 TABLE 7 Novel CR Proteins (SEQ ID NOs.: 1998-2030) Sequence ALLCCLLVSAASAITPGWLPINSQLDYHVHGRTFSSLFQVANQYTGILYKAR NBGA1 LSLDRNEDQLITGKVTEAQFAPVNTQFSSGWDESVPDEKLHWDVVPMSQQP FQIELNSRGEVRKLRVNKFVELWEINMIKAIISQLQVVVDEDKKVYRVFEST VTGRCEALYEVDHLYPTTYLNPWQWTQQHDTKLRIMKNHQFTNCRHNSA YKLHFNAFEYFHLKQHKPETFLSNSAVSRVIADGDNLKNFTFYSGETIHKIVL NPEIYNKQKGMLVSHINVTVERKGRELTVIDYELRNVGDLSYSTSLVKAHS MRNSASMDLSSSSMSSSSSSSSSSSSSSSSSSSSSSSEEHHSHNQKLSKKRQVP LPRPLFEANFDASSGLTTEQPVTFRPRRQLFQGQDMSEEETEQNPEIIPANLLP TYNLIHNTKQVDVDPVGVAVRLSKDIAADLQGEPRVGEDRHILPRFTILVRL LKQLKVSQIMEAARKLYKLENDHPNYMNWDTWRVYRDAVSQAGTWSAL NSIQQFISSEMVEPKEASHLITVLPAAVSDKNKAYLHFLFEMTKDPVFKNMT YVNTSLVLAFSEVIHQVEMHQVRDLKIKSVYIPYLVQEFDDAVKENNSIKIQ LYTHALGVTGNTHILHYLRPYIIQLKTITHHQRLFMVQSLERVVEHNPRKVI DLLLSLYLDQNEHADIRVEALFLLMKADPSIHVLKMVAELTHTESNNQVLS ASQSAIKSAANVEGDIYSEMRRKAKAVEHLLSTRNMDVSYSKSYLYGYKSK KINYDSLYNLNNIGSEDSIYPKSMLLNIFTNNLGRINTHVQKGYMVSSMTDL WEAFHTIYKKDNGSPTDPKTLVKFVEGNLKYFNMGVQKFWAFDNTTFSNA SAVIQEFLKTYKKPTNFNHTKLSSSSSITLTLPCAMGLPAYFKMNSPSLWKY NGEFSIQTDAKTDVPMSLENFMNITGSINLMFSQMYHAQLAFSTAFDNKEYI SGLDRKVEVHVPVKFQINLDFKNHNGFIRIIPLFTDRDYDVLQWQTIPYTTIH NVPDFETVYMDQLFKLIHVRKTAHFEKKMGENTGIVFKVKYDTDQEFLDTK WFLDEFKVLQLFTGLNYDVPTKDIFYNNLTVYYDHEDTKNHAVSFTVTKEQ SKFYETLNPVVQQNLKLSSGKKQKHRNVKSHRIRREYTEDENPAIPKDKQP NSHPRRQEYLSKSMALTGDATAVVLDMTLKFEGPAESYFTTTVSHATSLVN GSSNYLLFYDQHYYEEKKRNQFCLSWSVYKPQVPIMNIYSAFEFDPNSKVH AIMNIGKECENGGSAVANIDMLRLSEHLDYVKNLTVSKLCDHEMRTKRDH VLPACRNSTERASDLNRVHVDINYNLKQHETFKRRVYKVYDFVRTHLYPH VSEDVIVDNPAQFISANFTLKDNTRAFNVSIKTPVLSVNATVVRLQSWQSEM LRMNPRTSFAKRFAKWALPLYNKPTCVVDSSYINTFDNFTYSAHHIVQNDA FYTILDIPQKFNMEYFKVAFKPTSPVPNMQREVLVFLRNAKIELKPNQGMPE VYVEGKRVDYNHHHSTDLNVSQDRIGYVYAFXXXXSSRKP YHCLSSGINAEYAGSSSTPCSNMTWNALLCCLLVSAASAITPGWLPINSQLD NBGA1 YHVHGRTFSSLFQVANQYTGILYKARLSLDRNEDQLITGKVTEAQFSPVNTQ FSSGWDESVPDEKLHWDVVPMSQQPFQIELNSRGEVRKLRVNKFVELWEIN MIKAIISQLQVVVDEDKKVYRVFESTVTGRCEALYEVDHLYPTTYLNPWQW TQQHDTKLRIMKNHQFTNCRHNSAYKLHFNAFEYFHLKQHKPETFLSNSAV SRVIADGDNLKNFTFYSGETIHKIVLNPEIYNKQKGMLVSHINVTVERKGRE LTVIDYELRNVGDLSYSTSLVKAHSMRNSASMDLSSSSMSSSSSSSSSSSSSSS SSSSSSEEHHSHNQKLSKKRQVPLPRPLFEANFDASSGLTTEQPVTFRPRRQL FQGQDMSEEETEQNPEIIPANLLPTYNLIHNTKQVDVDPVGVAVRLSKDIAA DLQGEPRVGEDRHILPRFTILVRLLKQLKVSQIMEAARKLYKLENDHPNYM NWDTWRVYRDAVSQAGTWSALNSIQQFISSEMVEPKEASHLITVLPAAVSD KNKAYLHFLFEMTKDPVFKNMTYVNTSLVLAFSEVIHQVEMHQVRDLKIKS VYIPYLVQEFDDAVKENNSIKIQLYTHALGVTGNTHILHYLRPYIIQLKTITH HQRLFMVQSLERVVEHNPRKVIDLLLSLYLDQNEHADIRVEALFLLMKADP SIHVLKMVAELTHTESNNQVLSASQSAIKSAANVEGDIYSEMRRKAKAVEH LLSTRNMDVSYSKSYLYGYKSKKINYDSLYNLNYIGSEDSIYPKSMLLNIFT NNLGRINTHVQKGYMVSSMTDLWEAFHTIYKKDNGSPTDPKTLVKFVEGN LKYFNMGVQKFWAFDNTTFSNASAVIQEFLKTYKKPTNFNHTKLSSSSSITL TLPCAMGLPAYFKMNSPSLWKYNGEFSIQTDAKTDVPMSLENFMNITGSINL MFSQMYHAQLAFSTAFDNKEYISGLDRKVEVHVPVKFQINLDFKNHNGFIRI IPLFTDRDYDVLQWQTIPYTTIHNVPDFETVYMDQLFKLIHVRKTAHFEKKM GENTGIVFKVKYDTDQEFLDTKWFLDEFKVLQLFTGLNYDVPTKDIFYNNL TVYYDHEDTKNHAVSFTVTKEQSKFYETLNPVVQQNLKLSSGKKQKHRNV KSHRIRREYTEDENPAIPKDKQPNSHPRRQEYLSKXMALTGDATAVVLDMT LKFEGPAESYFT TAHFEKKMGENTGIVFKVKYDTDQEFLDTKWFLDEFKVLQLFTGLNYDVPT NBGA1 KDIFYNNLTVYYDHEDTKNHAVSFTVTKEQSKFYETLNPVVQQNLKLSSGK KQKHRNVKSHRIRREYTEDENPAIPKDKQPNSHPRRQEYLSKSMALTGDAT AVVLDMTLKFEGPAESYFTTTVSHATSLVNGSSNYLLFYDQHYYEEKKRNQ FCLSWSVYKPQVPIMNIYSAFEFDPNSKVHAIMNIGKECENGGSAVANIDML RLSEHLDYVKNLTVSKLCDHEMRTKRDHVLPACRNSTERASDLNRVHVDIN YNLKQHETFKRRVYKVYDFVRTHLYPHVSEDVIVDNPAQFISANFTLKDNT RAFNVSIETPVLSVNATSVRLQSWQSEMLRMNPRTSFAKRFAKWALPLYYK PTCVVDSSYINTFDNFTYSAHHIVQNDAFYTILDIPQKFNMEYFKVAFKPTSP VPNMQREVLVFLRNAKIELKPNQGMPEVYVEGKRVDYNHHHSTDLNVSQD RIGYVYALPTKAAHIVFPSYEIEMFYDGSRIMIQASNMYRNFTKGLCGNMD GEFVNDVLTPWGCYAKDMALFVASYADNSNSEVRKIKATQNEQTCVPQFH QPLVSHQMRLSQVIKLADTSSSSESSSSSESHENNSSPSSESQVNKSKRQPNS RPRSSSSSSSSSSSESNESVLAKKIINNQIGPKPTLIPSQSPMTSDDKCMTQQPR HTYYENQFCVSEKPLDTCMPLICHATESYTIDVNFYCVPLGPAANHYMKLV KKGILPDLSRNRNGKRVVLPVEIPIQCEPVLN ESNNQVLSASQSAIKSAANVEGDIYSEMRRKAKAVEHLLSTRNMDVSYSKS NBGA1 YLYGYKSKKINYDSLYNLNYIGSEDSIYPKSMLLNIFTNNLGRINTHVQKGY MVSSMTDLWEAFHTIYKKDNGSPTDPKTLVKFVEGNLKYFNMGVQKFWAF DNTTFSNASAVIQEFLKTYKKPTNFNHTKLSSSSSITLTLPCAMGLPAYFKMN SPSLWKYNGEFSIQTDAKTDVPMSLENFMNITGSINLMFSQMYHAQLAFSTA FDNKEYISGLDRKVEVHVPVKFQINLDFKNHNGFIRIIPLFTDRDYDVLQWQ TIPYTTIHNVPDFETVYMDQLFKLIHVRKTAHFEKKMGENTGIVFKVKYDTD QEFLDTKWFLDEFKVLQLFTGLNYDVPTKDIFYNNLTVYYDHEDTKNHAVS FTVTKEQSKFYETLNPVVQQNLKLSSGKKQKHRNVKSHRIRREYTEDENPAI PKDKQPNSHPRRQEYLSKSMALTGDATAVVLDMTLKFEGPAESYFTTTVSH ATSLVNGSSNYLLFYDQHYYEEKKRNQFCLSWSVYKPQVPIMNIYSAFEFDP NSKVHAIMNIGKECENGGSAVANIDMLRLSEHLDYVKNLTVSKLCDHEMR TKRDHVLPACRNSTERASDLNRVHVDINYNLKQHETFKRRVYKVYDFVRT HLYPHVSEDVIVDNPAQFISANFTLKDNTRAFNVSIKTTCT YKLENDHPNYMNWDTWRVYRDAVSQAGTWSALNSIQQFISSEMVEPKEAS NBGA1 HLITVLPAAVSDKNKAYLHFLFEMTKDPVFKNMTYVNTSLVLAFSEVIHQV EMHQVRDLKIKSVYIPYLVQEFDDAVKENNSIKIQLYTHALGVTGNTHILHY LRPYIIQLKTITHHQRLFMVQSLERVVEHNPRKVIDLLLSLYLDQNEHADIRV EALFLLMKADPSIHVLKMVAELTHTESNNQVLSASQSAIKSAANVEGDIYSE MRRKAKAVEHLLSTRNMDVSYSKSYLYGYKSKKINYDSLYNLNYIGSEDSI YPKSMLLNIFTNNLGRINTHVQKGYMVSSMTDLWEAFHTIYKKDNGSPTDP KTLVKFVEGNLKYFNIGCPEILGI EQKINYDSLYNLNYIGSEDSIYPKSMLLNIFTNNLGRINTHVQKGYMVSSMT NBGA1 DLWEAFHTIYKKDNGSPTDPKTLVKFVEGNLKYFNMGVQKFWAFDNTTFS NASAVIQEFLKTYKKPTNFNHTKLSSSSSITLTLPCAMGLPAYFKMNSPSLW KYNGEFSIQTDAKTDVPMSLENFMNITGSINLMFSQMYHAQLAFSTAFDNK EYISGLDRKVEVHVPVKFQINLDFKNHNGFIRIIPLFTDRDYDVLQWQTIPYT TIHNVPDFETVYMDQLFKLIHVRKTAHFEKKMGENTGIVFKVKYDTDQEFL DTKWFLDEFKVLQLFTGLNYDVPTKDIFYNNLTVYYDHEDTKNHSRIFYCD KRTI MTWNALLCCLLVSAASAITPGWLPINSQLDYHVHGRTFSSLFQVANQYTGIL NBGA1 YKARLSLDRNEDQLITGKVTEAQFSPVNTQFSSGWDESVPDEKLHWDVVP MSQQPFQIELNSRGEVRKLRVNKFVELWEINMIKAIISQLQVVVDEDKKVYR VFESTVTGRCEALYEVDHLYPTTYLNPWQWTQQHDTKLRIMKNHQFTNCR HNSAYKLHFNAFEYFHLKQHKPETFLSNSAVSRVIADGDNLKNFTFYSGETI HKIVLNPEIYNKQKGMLVSHINVTVERKGRELTVIDYELRNVGDLSYSTSLV KDTFDEK NLQKPTNFNHTKLSSSSSITLTLPCAMGLPAYFKMNSPSLWKYNGEFSIQTD NBGA1 AKTDVPMSLENFMNITGSINLMFSQMYHAQLAFSTAFDNKEYISGLDRKVE VHVPVKFQINLDFKNHNGFIRIIPLFTDRDYDVLQWQTIPYTTIHNVPDFETV YMDQLFKLIHVRKTAHFEKKMGENTGIVFKVKYDTDQEFLDTKWFLDEFK VLQLFTGLNYDVPTKDIFYNNLTVYYDHEDTKNHAVSFTVTKEQSKFYETL NPVVQQNLKLSSGKKQKHRNVKSH LYIMIMKTPKTIAVSFTVTKEQSKFYETLNPVVQQNLKLSSGKKQKHRNVKS NBGA1 HRIRREYTEDENPAIPKDKQPNSHPRRQEYLSKSMALTGDATAVVLDMTLK FEGPAESYFTTTVSHATSLVNGSSNYLLFYDQHYYEEKKRNQFCLSWSVYK PQVPIMNIYSAFEFDPNSKVHAIMNIGKECENGGSAVANIDMLRLSEHLDYV KNLTVSKLCDHEMRTKRDHVLPACRNSTERASDLNRVHVDINYNLKQHET FKR QHETFKRRVYKVYDFVRTHLYPHVSEDVIVDNPAQFISANFTLKDNTRAFN NBGA1 VSIKTPVLSVNATVVRLQSWQSEMLRMNPRTSFAKRFAKWALPLYNKPTCV VDSSYINTFDNFTYSAHHIVQNDAFYTILDIPQKFNMEYFKVAFKPTSPVPN MQREVLVFLRNAKXELKPNQGMPEVYVEGKRVDYNHHHSTDLNVSQDRIG YVYALPTKAAHIVFPSYEIEMFYDGSRIMIQASNMYRNFTKGLCGKISVHI TSLGSINLMFSQMYHAQLAFSTAFDNKEYISGLDRKVEVHVPVKFQINLDFK NBGA1 NHNGFIRIIPLFTDRDYDVCNGRLFHTQPSITYQTLKQSTWINYFKLIHVRKT AHFEKKMGENTGIVFKVKYDTDQEFLDTKWFLDEFKVLQLFTGLNYDVPT KDIFYNNLTVYYDHEDTKNHAVSFTVTKEQSKFYETLNPVVQQNLKLSSGK KQKHRNVKSHRIRREYTE SSSTPCSNMTWNALLCCLLVSAASAITPGWLPINSQLDYHVHGRTFSSLFQV NBGA1 ANQYTGILYKARLSLDRNEDQLITGKVTEAQFSPVNTQFSSGWDESVPDEKL HWDVVPMSQQPFQIELNSRGEVRKLRVNKFVELWEINMIKAIISQLQVVVD EDKKVYRVFESTVTGRCEALYEVDHLYPTTYLNPWQWTQQHDTKL YHVHGRTFSSLFQVANQYTGILYKARLSLDRNEDQLITGKVTEAQFSPVNTQ NBGA1 FSSGWDESVPDEKLHWDVVPMSQQPFQIELNSRGEVRKLRVNKFVELWEIN MIKAIISQLQVVVDEDKKVYRVFESTVTGRCEALYEVDHLYPNNIY WQWTQQHDTKLRIMKNHQFTNCRHNSAYKLHFNAFEYFHLKQHKPETFLS NBGA1 NSAVSRVIADGDNLKNFTFYSGETIHKIVLNPEIYNKQKGMLVSHINVTVER KGRELTVIDYELRNVGRSLLLN RHNSAYKLHFNAFEYFHLKQHKPETFLSNSAVSRVIADGDNLKNFTFYSGET NBGA1 IHKIVLNPEIYNKQKGMLVSHINVTVERKGRELTVIDYELRNVGDLSYSTSL VKAHSMRNSASIGS FNMEYFKVAFKPTSPVPNMQREVLVFLRNAKIELKPNQGMPEVYVEGKRV NBGA1 DYNHHHSTDLNVSQDRIGYVYALPTKAAHIVFPSYEIEMFYDGSRIMIQASN MYRNFTKGLLW TALXLILATAALAVAYPSPGQDYKVLADKTYLTRQRDLLKLLVRIQQPNYY NBGA2 ADQYEIGQSYDIEANINNYKYPYVVKNFVAAYKNGMLARGVPYSPYYTTQ SYETKLLFDLFYYANDYDTFYKTACWARDHINEGQFLYALSSALFQREDLN DYILPAPYEIYPWLFVDSDVIQRAYETRMSDVHLTAPKTYIFPVNYTVHTPE QELNYFYHDVGLNTYYSYYYFNYPTFFNSTEYGVQFDRRGEMFYYTRQQL YARYFLERLSNDLPDVEPLHYDRPFQTEYNPQLRYPNGEDMPVRPYEYSRR SLYYSNGYSHYYGNYYGGNNEYYTGNYYTGDYHPSYYYGYATQYDYYYP EDLQSYERRVRDAIDYGYFFGFQGEKYPLYENYIKGIDYLGDVIEGNGDMV NQRFYGSIYHYYRQLAGKSVDPYNNYGLAPSALQNIYTTLRDPANWQILKR VNYLFQRYKGYLPRYTYDELSFPGIRIDNVDVGKLVTYFEHFDVDLDNVVN VKVAEDGKYIDYRARQTRLNHKPFTYNIEVHSEQATDAYVRVFLGPKYDYL HSEYDLNDRRHYFVEIDRFPYKVQAGKTTITRNSRDSSVVSPDYQSYRTLMR KVYDAYEGKDQFYYDKSEQYCGYPERLLLPKGKLGGQEYTFYVIVTPYAK QDDHDFEPYNYKSFSYCGVGANHRIPDDKPLGYPFDRPVYSHDFVTPNMYF KDVVIYHKKYEEINAATTHQ YYGGNNNYYNGNYYTGDYKPTYYYGYANQYDYYYPEDLQTYERRVRDAIDYG NBGA2 YFFGFPGGKYPLYDDYIKGIDYLGDAIEGNGDTVNKRLYGSIYHYYRQLAGKN VDPYNDIGLAPSALQNIYTTLRDPANWQILKRVNYLFQRYKGYLPRYTYDELS FPGVRVDNVDVGKLVTYFDYFDIDLDNVVNVKVAEDGKYVDYRARXTRLN HKPFTYNVEVYSEQATDVYVRVFLGPKYDYLHREYDLNDRRHYFVEIDRFP YKVQSGKTTITRNSRDSSVVSPDYQSYRTLMRKVYDAYEGKDKFYYDRSE NYCGYPERLLLPKGKLGGQEYTFYVIVTPYVKQDDHDFEPYNYKSFSYCGV GANHRIPDDKPLGYPFDRPVYR YEYDVPRHGEQFYYFYQQIYARYMLERYSNDMPDIKPFTYNKAFKTPYNPQ NBGA2 LRYPNGQEVPARPAYMVPQDFDLYMCLTSXNY FSNMDIKGKNALVTGAATGIGLEYVKQLLENGAQHVAVCDLDVRKGENAV NBGA3 KELVEKYGKGKAIFIKCDVTNIPEFEDAFKKAYNAFKSLDIVINNAGILNDEK WELQIAINVNGVVRGTLLGLEYMGKDKGGKGGVIVNIASILGLQNMAGCPV YVGTKHAVVGISRSFGMPFHFDRTGVRVLTMCPGVTDTPLISEAHHRQPGE WGEECGRELDSLPKQPPENVAKGMMHMIKKGANGSVWVCEGNKPVYEVA IPDRLTLRVE CLSSGINAEYAGVLWVCATGMARQVTSKGQQTLFLLLLLLAAVSASQQCKP NBGA4 KCEGKSSAFQTHYEAGNTYVYSFEGGTTTSLPGQQGDGVKLHLKAKAEVSF GDACEAVLKLKDVQVTGPDAQKFTHLNDLESHPVSFSFENGVVGGHICANG HDSEASLNLKRAILAHFQVAPQETARSGKSVVLDVFGLCPTDYSYTERGGTT TITKSRNLNKCHLREHLRQDFASVTYHVESDLQNSPLMESTQEFKHQLQGG VLRVSESHEKYLYRPFANQDAGAKTVVDSKLTYVGHNKKTAPAVSGAEQQ SIIFHPPNVHPGSGSAASVVDALHKAHQAMPEYVGENAAKEFANVVRVVRH TSKNDLLSVYNQVKSGAGFKDKSAGTKMFLDALFRAGTGDAVEVAVELLK SNKITGPHAEFYYLQLAYTRHVTKAALLAAVTLLEQPNPSKLAYLGVGALA GRYCSEHRCDGVAEVDEFLEKLSLLLNGGCKVSNYDEEVKIVATLKALQNA HHLNDAVTSKLQTCLLDDGVPTRIRSAVLDVFQSDACKAKDISLEVLKNYQ LDSELRIKAFLALVECPCNKKANDLKELLDKEPSYQVGSFIVSYLRNLRASA NPSKEKQKAVFGEIRTTKRFPIDFRKFSNNFEFSYLLGGANVGTTVESNVIYS QNSFLPRATTLNLTTEFFGHSVNLLEVELRQENLDLLAEGLFGPKGYFNTHT AAEVVQKGKEHWTDVENTAKQRFNHAIRGKRSVTKEQLELVKSKSVSPYH SETDRELLLELSTRLFGAEVGWLALHHNARDAAKNAFDTTFNLLDKVMKK AKDFDYKLRQHNTFLDTELVYPTSLGFPLKLVLAGSSAVHVELEGKVDVHD LVHNLKNSHVHFRFVPSAAVEFVGAFVVDAYAVEAGLKVAATLHTATGSD ITVKATEDVGVDVTVGLPVQKQDIVTLKTEVLTTVQEKGKPEVNTEISLPGT PRRDYHGCFDQLSPLVGLTFCTTMSFPWDPVASKAAFYPLNGPSKFSLVVE NEDVTSYHFRASLNKADPHKKSLELLLETPGSKTERKLGLILERTYDPYHGV KAQLNSPWKQVSAELAFTDNDKELSLLAKVTNDEQEYYVKLGASVTGDPN HATYHPLLEYKTPERKSSLVSKKGAKGAPEKLTHQFNVAGSVTVDKTANSK KYTFNDVVFTTPQGQYKVDGTVTSEGPTAFSTDLKVYYGENHVVLKSGFK RPSANNFNVHANVQPSQYPDFGVNLIWNHKRDKNNFGNSLAVVHGRDPNS EEARFTLNQEAHYQFDSIHKFEFASKNKVTYPLLGIIGKLDASVQPKTFHLD VEASYEKHKFEAELNANHGQQHTGDYDVKFHAKVLDNSLEFETKRVIVSE GKSKFTTELQVHPGGKYEAVADVTHVFERNNIDFQIDAEAKIHGQPDPYKL DSGLVYNPQLFDAHHKINVGAENYVDVSVNFKRGSGGNPSGNAKVFLKNY LVGNAQFKYTNGEGSATLNVDVPKLGRKLKGTGDLHVKGSQHVATVELY YNAEKKLAFHTDTDLKKDSLDSKNVLSILNYKTEVNVKGTLQGKLEDGQL KGEFGCNSA PKGKVSRTLKFHDHHYTGPFSVDNVLEFKLPSDKVKHIKMESHLQGELAEK NBGA5 KLQFTYSESLDLDDKTYKLSLESNNELEKGSNKLILVLPNKEPATYVNSWYF NYDDYRSKDVLKGGLTLTRNENAKFSIDVSGKKDYSDLDVHAKLDTPYEK LKHAELSLKNKYVPAPRLEVDTDFSLTVDDKKLAVVNKLTPGPFAGFPNIDF TATHPEGKTRVYVHLTSHKKNEVSGKAELEWPTNGGGKLTSSGKASYESFQ NFRVEADIESAKLNLKKWHVLLANKPQAKGSSSKTLQIQATEAGQPVINGR LEFHVEDKENTYKAGVSGNVQVRSQSQPLKADVFFNKFNPTDNGELGAEV GITIHLGDKSFDALSKHTNKESRASVSVCYQAGQCSVAEAHSVVKVLDFNH LEHDFGAKFDFKACGVNEGFVLTGKNVRQPLSFDHAVELKLLNEKHTTYNF HSYLNEKALGVILTLPQRIIALEGKLGYDKEKGERKVDLGFWLDKKKQPDN KAAVHLLVAVKASKEGTTFHGDAKFSHPALNKEFSVTGKGIALQDDTLLDA SVDLDIFAKKNQKITLVAKLERIPISHGYNVTGHLSAKGKLIDVSLDGGAALS ADGASYISTLAYQDEKHKSKSAQIQVVIHLDEQYIYVKSPTAELIKIERHESN NGKNAKGEVFVLGLEPVEFDETEDFPVSSKAVYYKKILPTRSSPLISCTIC AGQTREHKEALTRENKKLGDDLHDARNQLADLNRRFHELEIELRRLENERE NBGA6 ELTAAYKEAEAGRKAEEQRAQRLSAELGNFRHEAERRLAEKDEEIESIRKQT AIEIEQLNARVVEAETKLKTEVTRIKKKLQIQITELEMSLDVANKNNIELQKTI KKQSLTLTEIQAHYDEVQRQLQVTLDQYGIAQRKLQSVTAELEEIRGNYEG ALRAKRTAEQQYEETISRVNELTTINVNLASAKSKVEQELSTLAGDYDEVTR ELRAADERYQRVQVELKHTVEILHEEQERIVKIEAIKKSLEIEVKNLSVRLEE VEANAIVGGKRIISKLEARVRDLELELDEEKRRHAETIKILRKKERQVKEVMI QSEEDQKNVSLLQENLDKLVQRVNIYKRQLQEQEGMSQQSVTRVRRFQREL EAAEDRADTAESNLSLIRAKHRTFVTTSTVPGSQVYLVQETHRTTTTSEGI VHQVRLREYIDGPTPEPLSNYLDAQYYGPISLGTPPQKFKVVFDTGSSNLWV NBGA7 PSKKCHLTNIACLLHNKYDSTKSSTYEQNGTSFAIQYGSGSLSGFLSTDVLDI GGLKVQKQTFAEAMSEPGLAFVAAKFDGILGMAYSTISVDGVTPVFYNMV KQGLVSQPIFSFYLSRDPGAAEGGELILGGSDPNHYKGDFTYLSVDRKMYW QFKMDKIQIGNGSFCADGCEAIADTGTSLIAGPVSEVTALNRQIGGTPIVGGE YMVDCNLIPKLPEIDFILGGKKFTLEGKDYILRVSQLGHTVCLSGFMGIDLPK GPLWILGDVFIGKFYTEFDMENNRVGFAEAV HEGTPGHGSLLLEDTAGEKVRIIIDRFMDFREQEKKKLQSNPNLTVGDVTTV NBGA8 NLTQLKGGVQSNVVPPELVVVFDVRLAVTVDHAEFEAMVKKWCAEAGPG TYVEYEQKEPKVQVTKLDNSNPWWLAFKSACDDMNLELKPAIFPGGTDSR YVRGVGLPALGFSPMNKTPVLLHDHDEFLNEDIFLKGIDIFCQIIPAVANVAP PKK ALSPTTLGEAISSSTLRVFARTSVTGDLGIPEQQRYIEKVEELEAYQQQQQYK NBGA9 YVQELPESTSPPEFKTPIKDQPNIREGGFAHFEARLEPIGDSTLQVEWLKDGR PVEASSRITTFFNFGYVALTIKHVTTHDIGVYTCRAFNRLGQATTSAQLTVVS KKDIILESQHPGGLEKIQYLEDSSRYDRSTREETTVTQKPRFMG LFSTNILCDEIKNDEGVLVFTKENFKKGVSDNEFVLVEFYAPWCGHCKSLAP NBGA10 EYIKAAKKLADQESTIKLAKVDATEETELAEEHGVRGYPTLKFFRSGSPIDYS GGRTSDEIVSWLLKKTGPVAKDIASVDDAKSFIDASNVAIIGFFKDSSSEAAK NFLAAANAIDDYPFGITADDAVFGEYSVDGEKVILLQEV TREGERPMTKDNHLLGKFDLTGIPPAPRGVPQIEVTFEIDANGILQVSAEDKG NBGA11 TGNREKIVITNDQNRLTPDDIERMIKDAEKFADDDKKLKERVEARNELESYA YSLKNQLADKEKLGAKVSDSDKTKMEEAIDEKIKWLEENQDVDTEEYKTQ KKELEDIVQPIIAKLYQGAGGAPPPSNSDDDDELKDEL QITVTTDDIGQDVSGLELGALLTAMAMVTAKLATVETSCNAQAQEDNHQR NBGA12 PWLNSPSMATKDRTSMTSVSSTDSTLVYKIQPVNNAHGGGDRRCGVAGCS KDLNPGCPNELRVNNGCKSSCYAFNTDQYCCRGQYGTVETCDTSRWPVNS ASYFKSNCPDAYSYAYDDRTSTFTCDDRAYRTHHLLD SSLEVFFQQQRILLRLHRCFQVLGRWGGDVAFVKHLTALENTDGHNTAAW NBGA13 ASGLKSEDYELLCPDGGRAPVTEYLRCHLAQVPPHMVVTSNDKTENQLNEI RHAILAAGDLYSRRPDLFKLFGDFDGTKDLLFKNSATGLLSV RHQATQSTQQKKWYXKHCLQMASNTMPYQIASGFSTSQLAMIQNAIDEYH NBGA14 AKTCVTLRPYNSATDRDYVYIKGDESGCWSYVGRIGGRQELNLGTGCFSLG TVEHELLHAWGFYHQQSATERDDYVTIHWENIQSGTENN YGKIIKRLEAKGFKLVAMKFVWADEELLKKHYADLSSRPFFPGLVKYMSSG NBGA15 PVVPMVWEGLNVVKTGRLMLGATDPKDSNPGTIRGDLCIQVGRNIIHGSDS VESANKEINLWFDSKELIAWKPAVEAWVYED STRMELQHLQSIEVFPEDEGQYVCXAVNSIGTAKTTCKLKVKPMQDAGRKA NBGA16 KSGDKAPVIVDHLKSDFVKDGEPVILSCRIIGAQKFDVVWLHNNKEIKPSKD FQYTNEANIYKLNIAEIFPEDSGTYTC

TABLE-US-00008 TABLE 8 Diagnostic Sets (SEQ ID NOs.: 2031-2257) Epitope Sequence Protein Pos Set DCGVAGFRVDAAKHM Bla g 11 alpha-amylase 198 AR LDYERFRGSWIIAAG Bla g 4 lipocalin 26 AR KNRTTIRGRTKFEGN Bla g 4 lipocalin 71 AR IRGRTKFEGNKFTID Bla g 4 lipocalin 76 AR KFEGNKFTIDYNDKG Bla g 4 lipocalin 81 AR ATDYENYAIVEGCPA Bla g 4 lipocalin 106 AR NYAIVEGCPAAANGH Bla g 4 lipocalin 111 AR VIYVQIRFSVRRFHP Bla g 4 lipocalin 126 AR IRFSVRRFHPKLGDK Bla g 4 lipocalin 131 AR KLGDKEMIQHYTLDQ Bla g 4 lipocalin 141 AR KAIEEDLKHFNLKYE Bla g 4 lipocalin 161 AR KTPVLEIDGKQTHQS Bla g 5 GST 51 AR DENSKQKKWDPLKKE Bla g 5 GST 111 AR QKKWDPLKKETIPYY Bla g 5 GST 116 AR PLKKETIPYYTKKFD Bla g 5 GST 121 AR TIPYYTKKFDEVVKA Bla g 5 GST 126 AR TKKFDEVVKANGGYL Bla g 5 GST 131 AR YFVAILDYLNHMAKE Bla g 5 GST 156 AR QPNLKALREKVLGLP Bla g 5 GST 176 AR ALREKVLGLPAIKAW Bla g 5 GST 181 AR VLGLPAIKAWVAKRP Bla g 5 GST 186 AR VLEKLEAGFAKLAAS Bla g 9 arginine kinase 6 AR FGSTLLDVIQSGLEN Bla g 9 arginine kinase 46 AR NDIEKRVPFSHDDRL Bla g 9 arginine kinase 251 AR ALNSIQQFISSEMVE NBGA1 541 AR VEALFLLMKADPSIH NBGA1 716 AR DPSIHVLKMVAELTH NBGA1 726 AR PKSMLLNIFTNNLGR NBGA1 821 AR LNIFTNNLGRINTHV NBGA1 826 AR KTLVKFVEGNLKYFN NBGA1 871 AR LKYFNMGVQKFWAFD NBGA1 881 AR MGVQKFWAFDNTTFS NBGA1 886 AR NASAVIQEFLKTYKK NBGA1 901 AR HTKLSSSSSITLTLP NBGA1 921 AR SVNATVVRLQSWQSE NBGA1 1451 AR VVRLQSWQSEMLRMN NBGA1 1456 AR PRHGEQFYYFYQQIY NBGA2 241 AR DYQSYRTLMRKVYDA NBGA2 601 AR GQEYTFYVIVTPYAK NBGA2 646 AR KAIFIKCDVTNIPEF NBGA3 61 AR IVINNAGILNDEKWE NBGA3 91 AR KEFANVVRVVRHTSK NBGA4 346 AR RIKAFLALVECPCNK NBGA4 566 AR FRKFSNNFEFSYLLG NBGA4 636 AR NVIYSQNSFLPRATT NBGA4 661 AR RLFGAEVGWLALHHN NBGA4 781 AR LVYPTSLGFPLKLVL NBGA4 836 AR SHVHFRFVPSAAVEF NBGA4 876 AR KKLQFTYSESLDLDD NBGA5 51 AR AQIQVVIHLDEQYIY NBGA5 636 AR GVTPVFYNMVKQGLV NBGA7 146 AR SEVTALNRQIGGTPI NBGA7 241 AR GKDYILRVSQLGHTV NBGA7 286 AR NAIEFLNNIHDLLGI Bla g 1 midgut microvilli protein 1 Asthma IDDIIAILPVDDLYA Bla g 1 midgut microvilli protein 36 Asthma LIPVDQIIAIATDYL Bla g 1 midgut microvilli protein 46 Asthma QIIAIATDYLANDAE Bla g 1 midgut microvilli protein 51 Asthma ATDYLANDAEVQAAV Bla g 1 midgut microvilli protein 56 Asthma EYQNLIQKLKDKGVD Bla g 1 midgut microvilli protein 86 Asthma IQKLKDKGVDVDHII Bla g 1 midgut microvilli protein 91 Asthma DKGVDVDHIIELIHQ Bla g 1 midgut microvilli protein 96 Asthma DTRGLPEDLQDFLAL Bla g 1 midgut microvilli protein 117 Asthma LIPTDQVLAIAADYL Bla g 1 midgut microvilli protein 131 Asthma QVLAIAADYLANDAE Bla g 1 midgut microvilli protein 136 Asthma LKALFNEKLETSPDF Bla g 1 midgut microvilli protein 152 Asthma EYLKSDEFETIVVTV Bla g 1 midgut microvilli protein 156 Asthma DEFETIVVTVDSLPE Bla g 1 midgut microvilli protein 161 Asthma IVVTVDSLPEFKNFL Bla g 1 midgut microvilli protein 166 Asthma DDLQDFLALIPVDQI Bla g 1 midgut microvilli protein 230 Asthma PVDQIIAIATDYLAN Bla g 1 midgut microvilli protein 240 Asthma IAIATDYLANDAEVQ Bla g 1 midgut microvilli protein 245 Asthma DYLANDAEVQAAVAY Bla g 1 midgut microvilli protein 250 Asthma DAEVQAAVAYLQSDE Bla g 1 midgut microvilli protein 255 Asthma AAVAYLQSDEFETIV Bla g 1 midgut microvilli protein 260 Asthma VTLDALPELQNFLNF Bla g 1 midgut microvilli protein 275 Asthma LPELQNFLNFLEANG Bla g 1 midgut microvilli protein 280 Asthma HDLLGIPHIPVSGRK Bla g 1 midgut microvilli protein 305 Asthma IPHIPVSGRKYHIRR Bla g 1 midgut microvilli protein 310 Asthma VSGRKYHIRRGVGIT Bla g 1 midgut microvilli protein 315 Asthma PIDQILAIAADYLAN Bla g 1 midgut microvilli protein 321 Asthma DYLANDAEVQAAVEY Bla g 1 midgut microvilli protein 331 Asthma VTVDSLPEFKNFLNF Bla g 1 midgut microvilli protein 356 Asthma LQTNGLNAIEFINNI Bla g 1 midgut microvilli protein 371 Asthma LNAIEFINNIHDLLG Bla g 1 midgut microvilli protein 376 Asthma ATGRKHVRRGVGING Bla g 1 midgut microvilli protein 396 Asthma HVRRGVGINGLIDDV Bla g 1 midgut microvilli protein 401 Asthma VGINGLIDDVIAILP Bla g 1 midgut microvilli protein 406 Asthma IAILPVDELYALFQE Bla g 1 midgut microvilli protein 416 Asthma KLESSPEFKALYDAI Bla g 1 midgut microvilli protein 431 Asthma PEFKALYDAIRSPEF Bla g 1 midgut microvilli protein 436 Asthma LYDAIRSPEFQSIVQ Bla g 1 midgut microvilli protein 441 Asthma RSPEFQSIVQTLKAM Bla g 1 midgut microvilli protein 446 Asthma QSIVQTLKAMPEYQD Bla g 1 midgut microvilli protein 451 Asthma TLKAMPEYQDLIQRL Bla g 1 midgut microvilli protein 456 Asthma IHENLIVTSPFRPWW Bla g 11 alpha-amylase 6 Asthma FRPWWERYQLVSYNL Bla g 11 alpha-amylase 16 Asthma ERYQLVSYNLNSRSG Bla g 11 alpha-amylase 21 Asthma RCNNVGIRIYVDVVL Bla g 11 alpha-amylase 103 Asthma GIRIYVDVVLNQMSG Bla g 11 alpha-amylase 108 Asthma RGNNAIKWLVNFGVG Bla g 11 alpha-amylase 278 Asthma GASILTYKTSKLYKM Bla g 11 alpha-amylase 318 Asthma KLYKMAVAFMLAYPY Bla g 11 alpha-amylase 328 Asthma WVCEHRWRQIFNMVG Bla g 11 alpha-amylase 383 Asthma RWRQIFNMVGFRNAV Bla g 11 alpha-amylase 388 Asthma LTVFDSTSCNVVVAS Bla g 2 inactive aspartic protease 51 Asthma STSCNVVVASQECVG Bla g 2 inactive aspartic protease 56 Asthma GRGIEDSLTISNLTT Bla g 2 inactive aspartic protease 106 Asthma SQQDIVLADELSQEV Bla g 2 inactive aspartic protease 121 Asthma AVLALCATDTLANED Bla g 4 lipocalin 1 Asthma CATDTLANEDCFRHE Bla g 4 lipocalin 6 Asthma LANEDCFRHESLVPN Bla g 4 lipocalin 11 Asthma PYSVLATDYENYAIV Bla g 4 lipocalin 101 Asthma VNQHKKAIEEDLKHF Bla g 4 lipocalin 156 Asthma KHFNLKYEDLHSTCH Bla g 4 lipocalin 168 Asthma MAPSYKLTYCPVKAL Bla g 5 GST 1 Asthma KLTYCPVKALGEPIR Bla g 5 GST 6 Asthma FLLSYGEKDFEDYRF Bla g 5 GST 21 Asthma GEKDFEDYRFQEGDW Bla g 5 GST 26 Asthma PNLKPSMPFGKTPVL Bla g 5 GST 41 Asthma QTHQSVAISRYLGKQ Bla g 5 GST 61 Asthma VAISRYLGKQFGLSG Bla g 5 GST 66 Asthma YLGKQFGLSGKDDWE Bla g 5 GST 71 Asthma KDDWENLEIDMIVDT Bla g 5 GST 81 Asthma NLEIDMIVDTISDFR Bla g 5 GST 86 Asthma MIVDTISDFRAAIAN Bla g 5 GST 91 Asthma ISDFRAAIANYHYDA Bla g 5 GST 96 Asthma AAIANYHYDADENSK Bla g 5 GST 101 Asthma YHYDADENSKQKKWD Bla g 5 GST 106 Asthma EVVKANGGYLAAGKL Bla g 5 GST 136 Asthma NGGYLAAGKLTWADF Bla g 5 GST 141 Asthma AAGKLTWADFYFVAI Bla g 5 GST 146 Asthma HMAKEDLVANQPNLK Bla g 5 GST 166 Asthma DLVANQPNLKALREK Bla g 5 GST 171 Asthma AAKFIIEEDSEAMEK Bla g 6 troponin C 76 Asthma IEEDSEAMEKELREA Bla g 6 troponin C 81 Asthma EAMEKELREAFRLYD Bla g 6 troponin C 86 Asthma ELREAFRLYDKEGNG Bla g 6 troponin C 91 Asthma FRLYDKEGNGYIPTS Bla g 6 troponin C 96 Asthma KEGNGYIPTSCLREI Bla g 6 troponin C 101 Asthma YIPTSCLREILRELD Bla g 6 troponin C 106 Asthma DELDMMIEEIDADGS Bla g 6 troponin C 126 Asthma KALQNAESEVAALNR Bla g 7 tropomysin 76 Asthma RSEERLATATAKLAE Bla g 7 tropomysin 101 Asthma VQKLQKEVDRLEDEL Bla g 7 tropomysin 246 Asthma KEVDRLEDELVHEKE Bla g 7 tropomysin 251 Asthma EAGFAKLAASDSKSL Bla g 9 arginine kinase 11 Asthma KLAASDSKSLLRKYL Bla g 9 arginine kinase 16 Asthma RCGRSMQGYPFNPCL Bla g 9 arginine kinase 126 Asthma LIDDHFLFKEGDRFL Bla g 9 arginine kinase 181 Asthma FLFKEGDRFLQHANA Bla g 9 arginine kinase 186 Asthma WCNEEDHLRIISMQM Bla g 9 arginine kinase 221 Asthma QVYRRLVTAVNDIEK Bla g 9 arginine kinase 241 Asthma RVPFSHDDRLGFLTF Bla g 9 arginine kinase 256 Asthma HDDRLGFLTFCPTNL Bla g 9 arginine kinase 261 Asthma CPTNLGTTVRASVRI Bla g 9 arginine kinase 271 Asthma SPYFVTNTEKMITEF GroEL-like chaperonin 201 Asthma KIGEYKNMIAEGIID GroEL-like chaperonin 481 Asthma RHNSAYKLHFNAFEY NBGA1 226 Asthma STSLVKAHSMRNSAS NBGA1 326 Asthma AVRLSKDIAADLQGE NBGA1 461 Asthma LVRLLKQLKVSQIME NBGA1 491 Asthma KQLKVSQIMEAARKL NBGA1 496 Asthma QQFISSEMVEPKEAS NBGA1 546 Asthma KNMTYVNTSLVLAFS NBGA1 591 Asthma QKGYMVSSMTDLWEA NBGA1 841 Asthma NTTFSNASAVIQEFL NBGA1 896 Asthma PAYFKMNSPSLWKYN NBGA1 941 Asthma MNITGSINLMFSQMY NBGA1 976 Asthma SINLMFSQMYHAQLA NBGA1 981 Asthma FSQMYHAQLAFSTAF NBGA1 986 Asthma FQINLDFKNHNGFIR NBGA1 1021 Asthma DVLQWQTIPYTTIHN NBGA1 1046 Asthma VPIMNIYSAFEFDPN NBGA1 1296 Asthma LRLSEHLDYVKNLTV NBGA1 1336 Asthma AKRFAKWALPLYNKP NBGA1 1476 Asthma HIVFPSYEIEMFYDG NBGA1 1606 Asthma SYEIEMFYDGSRIMI NBGA1 1611 Asthma RILLRLHRCFQVLGR NBGA13 11 Asthma IRHAILAAGDLYSRR NBGA13 101 Asthma QSYETKLLFDLFYYA NBGA2 101 Asthma KLLFDLFYYANDYDT NBGA2 106 Asthma HINEGQFLYALSSAL NBGA2 131 Asthma QFLYALSSALFQRED NBGA2 136 Asthma LNDYILPAPYEIYPW NBGA2 151 Asthma EIYPWLFVDSDVIQR NBGA2 161 Asthma LNTYYSYYYFNYPTF NBGA2 216 Asthma SYYYFNYPTFFNSTE NBGA2 221 Asthma DRRGEMFYYTRQQLY NBGA2 241 Asthma MFYYTRQQLYARYFL NBGA2 246 Asthma RQQLYARYFLERLSN NBGA2 251 Asthma ARYFLERLSNDLPDV NBGA2 256 Asthma QATDAYVRVFLGPKY NBGA2 541 Asthma KELVEKYGKGKAIFI NBGA3 51 Asthma EDAFKKAYNAFKSLD NBGA3 76 Asthma AKGMMHMIKKGANGS NBGA3 226 Asthma VYEVAIPDRLTLRVE NBGA3 250 Asthma QTLFLLLLLLAAVSA NBGA4 31 Asthma SLLLNGGCKVSNYDE NBGA4 481 Asthma EVKIVATLKALQNAH NBGA4 496 Asthma ISLEVLKNYQLDSEL NBGA4 551 Asthma LKNYQLDSELRIKAF NBGA4 556 Asthma QVGSFIVSYLRNLRA NBGA4 596 Asthma THQFNVAGSVTVDKT NBGA4 1156 Asthma LNQEAHYQFDSIHKF NBGA4 1281 Asthma HYQFDSIHKFEFASK NBGA4 1286 Asthma KAAVHLLVAVKASKE NBGA5 511 Asthma WVPSKKCHLTNIACL NBGA7 51 Asthma KCHLTNIACLLHNKY NBGA7 56 Asthma DVLDIGGLKVQKQTF NBGA7 101 Asthma DRKMYWQFKMDKIQI NBGA7 201 Asthma GHSHFVSDVVLSSDG RACK1 61 Asthma HGRTFSSLFQVANQY NBGA1 56 CNT LLMKADPSIHVLKMV NBGA1 721 CNT QVLSASQSAIKSAAN NBGA1 746 CNT SKVHAIMNIGKECEN NBGA1 1311 CNT FKRRVYKVYDFVRTH NBGA1 1396 CNT EYFKVAFKPTSPVPN NBGA1 1531 CNT TFEIDANGILQVSAE NBGA11 36 CNT NNFEFSYLLGGANVG NBGA4 641 CNT KLDSGLVYNPQLFDA NBGA4 1426 CNT DLHVKGSQHVATVEL NBGA4 1511 CNT LDSKNVLSILNYKTE NBGA4 1546 CNT VLSILNYKTEVNVKG NBGA4 1551 CNT QTLFAGYFDNTIRVW RACK1 296 CNT VVFQQTKAIADKIKD TPI 141 CNT WSKVVIAYEPVWAIG TPI 156 CNT YWTIDFDIAVARVST trypsin 111 CNT

Example 13

Embodiments

[0308] A1. A protein or peptide having an amino acid sequence comprising, consisting of, or consisting essentially of an amino acid sequence set forth in Tables 5 to 8, or a subsequence, portion, homologue, variant or derivative thereof, for use in modulating immune activity of a cell against a Cockroach allergen. [0309] A2. The protein or peptide of embodiment A1, wherein modulating the immune activity of a cell comprises inducing immunological tolerance to the Cockroach allergen. [0310] A3. A protein or peptide having an amino acid sequence comprising, consisting of, or consisting essentially of an amino acid sequence set forth in Tables 5 to 8, or a subsequence, portion, homologue, variant or derivative thereof, for use in modulating an immune response against a Cockroach allergen in a subject. [0311] A4. The protein or peptide of embodiment of A3, wherein the modulating of the immune response in the subject comprises administering to the subject an amount of the protein or peptide sufficient to modulate the immune response against the Cockroach allergen in the subject. [0312] A5. A protein or peptide having an amino acid sequence comprising, consisting of, or consisting essentially of an amino acid sequence set forth in Tables 5 to 8, or a subsequence, portion, homologue, variant or derivative thereof, for use in preventing an allergic response, allergic disorder or allergic disease in a subject, or for use in preventing one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications in a subject, wherein the allergic response, allergic disorder, allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications is caused by or associated with a Cockroach allergen. [0313] A6. A protein or peptide having an amino acid sequence comprising, consisting of, or consisting essentially of an amino acid sequence set forth in Tables 5 to 8, or a subsequence, portion, homologue, variant or derivative thereof, for use in treating a subject for an allergic response, allergic disorder or allergic disease, or one or more physiological conditions, disorders, illnesses, diseases, symptoms or complications caused by or associated with a Cockroach allergen. [0314] A7. The protein or peptide of embodiment A6, wherein treating comprises inducing in the subject immunological tolerance to the allergen. [0315] A8. The protein or peptide of embodiment A6 or A7, comprising the use of two or more proteins, peptides, subsequences, portions, homologues, variants or derivatives thereof set forth in Tables 5-8. [0316] A9. The protein or peptide of any one of embodiment A6 or A7, comprising the use of one protein, peptide, subsequence, portion, homologue, variant or derivative thereof as set forth in Tables 5-8. [0317] A10. The protein or peptide of any one of embodiments A6 to A9, comprising the use of a peptide comprising an amino acid sequence of any of (SEQ ID NOs.: 1-23): TIPYYTKKFDEVVKA, ISDFRAAIANYHYDA, YFVAILDYLNHMAKE, VAISRYLGKQFGLSG, MIVDTISDFRAAIAN, DLVANQPNLKALREK, HDDRLGFLTFCPTNL, KNRTTIRGRTKFEGN, DRKMYWQFKMDKIQI, ALREKVLGLPAIKAW, IRGRTKFEGNKFTID, NDIEKRVPFSHDDRL, HMAKEDLVANQPNLK, VLEKLEAGFAKLAAS, NYAIVEGCPAAANGH, GIRIYVDVVLNQMSG, RWRQIFNMVGFRNAV, NIACLLHNKYDSTKS, NGGYLAAGKLTWADF, LNIFTNNLGRINTHV, KTPVLEIDGKQTHQS, PAYFKMNSPSLWKYN, PKSMLLNIFTNNLGR, or a subsequence, portion, homologue, variant or derivative thereof, or a combination thereof. [0318] A11. The protein or peptide of any one of embodiments A6 to A9, comprising the use of a peptide comprising an amino acid sequence of any of (SEQ ID NOs.: 1-23): TIPYYTKKFDEVVKA, ISDFRAAIANYHYDA, YFVAILDYLNHMAKE, VAISRYLGKQFGLSG, MIVDTISDFRAAIAN, DLVANQPNLKALREK, HDDRLGFLTFCPTNL, KNRTTIRGRTKFEGN, DRKMYWQFKMDKIQI, ALREKVLGLPAIKAW, IRGRTKFEGNKFTID, NDIEKRVPFSHDDRL, HMAKEDLVANQPNLK, VLEKLEAGFAKLAAS, NYAIVEGCPAAANGH, GIRIYVDVVLNQMSG, RWRQIFNMVGFRNAV, NIACLLHNKYDSTKS, NGGYLAAGKLTWADF, LNIFTNNLGRINTHV, KTPVLEIDGKQTHQS, PAYFKMNSPSLWKYN, PKSMLLNIFTNNLGR, or a combination thereof. [0319] A12. The protein or peptide of any one of embodiments A6 to A9, comprising the use of a peptide comprising an amino acid sequence of any of (SEQ ID NOs.: 234-45): FETIVVTVDSLPEFK, LIDDVLAILPLDDLK, FAVATITHAAELQRV, PLYKLVHVFINTQYA, GNQNFLTVFDSTSCN, ISSQYYIQQNGNLC, HFFIGDFFVDHYYSE, GEPIRFLLSYGEKDF, FLLSYGEKDFEDYRF, SMPFGKTPVLEIDGK, VAISRYLGKQFGLSG, ISDFRAAIANYHYDA, YFVAILDYLNHMAKE, HMAKEDLVANQPNLK, DLVANQPNLKALREK, ALREKVLGLPAIKAW, VLGLPAIKAWVAKRP, EQISVLRKAFDAFDR, LRKAFDAFDREKSGS, EFVTLAAKFIIEEDS, EAMEKELREAFRLYD, or SGTVDFDEFMEMMTG. [0320] A13. A protein or peptide having an amino acid sequence comprising, consisting of, or consisting essentially of an amino acid sequence set forth in Tables 5 to 8, or a subsequence, portion, homologue, variant or derivative thereof, for use in diagnosing and treating a Cockroach allergy in a subject. [0321] A14. The protein or peptide of embodiment A13, wherein the diagnosing comprises contacting a cell from the subject with the protein or peptide, determining if the protein or peptide modulates immune activity from the contacted cell, wherein a determination that the protein or peptide modulates immune activity from the contacted cell indicates that the subject has a Cockroach allergy. [0322] A15. A protein or peptide having an amino acid sequence comprising, consisting of, or consisting essentially of an amino acid sequence set forth in Tables 5 to 8, or a subsequence, portion, homologue, variant or derivative thereof, for use in detecting an allergic response to a Cockroach protein or peptide in a subject. [0323] A16. The protein or peptide of embodiment A15, comprising: [0324] i. contacting a cell from the subject with the protein or peptide; and [0325] ii. determining if the protein or peptide modulates immune activity from the contacted cell; wherein a determination that the protein or peptide modulates immune activity from the contacted cell thereby detects an allergic response to the Cockroach allergen in the subject. [0326] A17. The protein or peptide of any one of embodiments A1 to A16, wherein the protein or peptide comprises, consists of, or consists essentially of an amino acid sequence set forth in Table 8. [0327] A16. The protein or peptide of any one of embodiments A1 to A17, wherein the subject is a human.

REFERENCES

[0328] 1. Kanchongkittiphon W, Mendell M J, Gaffin J M, Wang G, Phipatanakul W. Indoor Environmental Exposures and Exacerbation of Asthma: An Update to the 2000 Review by the Institute of Medicine. Environ Health Perspect 2014; [0329] 2. Camelo-Nunes I C, Sol D. Cockroach allergy: risk factor for asthma severity. J Pediatr (Rio J) 2006; 82:398-9-authorreply399-400. [0330] 3. Yi M-H, Jeong K Y, Kim C-R, Yong T-S. IgE-binding reactivity of peptide fragments of Bla g 1.02, a major German cockroach allergen. Asian Pac J Allergy Immunol 2009; 27:121-9. [0331] 4. Jeong K Y, Lee J, Lee I-Y, Ree H-I, Hong C-S, Yong T-S. Allergenicity of recombinant Bla g 7, German cockroach tropomyosin. Allergy 2003; 58:1059-63. [0332] 5. Pomes A, Vailes L D, Helm R M, Chapman M D. IgE reactivity of tandem repeats derived from cockroach allergen, Bla g 1. Eur J Biochem 2002; 269:3086-92. [0333] 6. Shin K H, Jeong K Y, Hong C-S, Yong T-S. IgE binding reactivity of peptide fragments of Bla g 4, a major German cockroach allergen. Korean J Parasitol 2009; 47:31-6. [0334] 7. Jeong K-J, Jeong K Y, Kim C-R, Yong T-S. IgE-binding epitope analysis of Bla g 5, the German cockroach allergen. Protein Pept Lett 2010; 17:573-7. [0335] 8. Khurana T, Collison M, Chew F T, Slater J E. Bla g 3: a novel allergen of German cockroach identified using cockroach-specific avian single-chain variable fragment antibody. Ann Allergy Asthma Immunol 2014; 112:140-1. [0336] 9. Un S, Jeong K Y, Yi M-H, Kim C-R, Yong T-S. IgE binding epitopes of Bla g 6 from German cockroach. Protein Pept Lett 2010; 17:1170-6. [0337] 10. Lee H, Jeong K Y, Shin K H, Yi M-H, Gantulaga D, Hong C-S, et al. Reactivity of German cockroach allergen, Bla g 2, peptide fragments to IgE antibodies in patients' sera. Korean J Parasitol 2008; 46:243-6. [0338] 11. Jeong K Y, Kim C-R, Park J, Han I-S, Park J-W, Yong T-S. Identification of novel allergenic components from German cockroach fecal extract by a proteomic approach. Int Arch Allergy Immunol 2013; 161:315-24. [0339] 12. Arruda L K, Barbosa M C R, Santos A B R, Moreno A S, Chapman M D, Poms A. Recombinant allergens for diagnosis of cockroach allergy. Curr Allergy Asthma Rep 2014; 14:428. [0340] 13. Arruda L K, Vailes L D, Ferriani V P, Santos A B, Pomes A, Chapman M D. Cockroach allergens and asthma. Journal of Allergy and Clinical Immunology 2001; 107:419-28. [0341] 14. Chen H, Yang H-W, Wei J-F, Tao A-L. In silico prediction of the T-cell and IgE-binding epitopes of Per a 6 and Bla g 6 allergens in cockroaches. Mol Med Rep 2014; 10:2130-6. [0342] 15. Oseroff C, Sidney J, Tripple V, Grey H, Wood R, Broide D H, et al. Analysis of T cell responses to the major allergens from German cockroach: epitope specificity and relationship to IgE production. The Journal of Immunology 2012; 189:679-88. [0343] 16. Schulten V, Greenbaum J A, Hauser M, McKinney D M, Sidney J, Kolla R, et al. Previously undescribed grass pollen antigens are the major inducers of T helper 2 cytokine-producing T cells in allergic individuals. Proc Natl Acad Sci USA 2013; 110:3459-64. [0344] 17. Chuang J-G, Su S-N, Chiang B-L, Lee H-J, Chow L-P. Proteome mining for novel IgE-binding proteins from the German cockroach (Blattella germanica) and allergen profiling of patients. Proteomics [Internet] 2010; 10:3854-67. Available from: http://onlinelibrary.wiley.com/doi/10.1002/pmic.201000348/abstract;jsessionid=9718A2AA03D4059 1B9C468E16B09A498.f02t04 [0345] 18. Oseroff C, Sidney J, Kotturi M F, Kolla R, Alam R, Broide D H, et al. Molecular Determinants of T Cell Epitope Recognition to the Common Timothy Grass Allergen. The Journal of Immunology 2010; 185:943-55. [0346] 19. Wambre E, Bonvalet M, Bodo V B, Maillre B, Leclert G, Moussu H, et al. Distinct characteristics of seasonal (Bet v 1) vs. perennial (Der p 1/Der p 2) allergen-specific CD4(+) T cell responses. Clin Exp Allergy 2011; 41:192-203. [0347] 20. Lindestam Arlehamn C S, Sidney J, Henderson R, Greenbaum J A, James E A, Moutaftsi M, et al. Dissecting Mechanisms of Immunodominance to the Common Tuberculosis Antigens ESAT-6, CFP10, Rv2031c (hspX), Rv2654c (TB7.7), and Rv1038c (EsxJ). The Journal of Immunology 2012; 188:5020-31. [0348] 21. Scadding G. Cytokine profiles in allergic rhinitis. Curr Allergy Asthma Rep 2014; 14:435. [0349] 22. Maes T, Joos G F, Brusselle G G. Targeting interleukin-4 in asthma: lost in translation? Am J Respir Cell Mol Biol 2012; 47:261-70. [0350] 23. Cosmi L, Liotta F, Maggi E, Romagnani S, Annunziato F. Th17 cells: new players in asthma pathogenesis. Allergy 2011; 66:989-98. [0351] 24. Ota K, Kawaguchi M, Matsukura S, Kurokawa M, Kokubu F, Fujita J, et al. Review Article. Journal of Immunology Research 2014; 1-8. [0352] 25. Zhang H, Kong H, Zeng X, Guo L, Sun X, He S. Subsets of regulatory T cells and their roles in allergy. Journal of Translational Medicine 2014; 12:125. [0353] 26. Schulten V, Oseroff C, Alam R, Broide D, Vijayanand P, Peters B, et al. The identification of potentially pathogenic and therapeutic epitopes from common human allergens. Ann Allergy Asthma Immunol 2013; 110:7-10. [0354] 27. Crotty S. Follicular helper CD4 T cells (TFH). Annu Rev Immunol 2011; 29:621-63. [0355] 28. Bassirpour G, Zoratti E. Cockroach allergy and allergen-specific immunotherapy in asthma. Current Opinion in Allergy and Clinical Immunology 2014; 1. [0356] 29. Poms A, Arruda L K. Investigating cockroach allergens: aiming to improve diagnosis and treatment of cockroach allergic patients. Methods 2014; 66:75-85. [0357] 30. Mukherjee S, Berger M F, Jona G, Wang X S, Muzzey D, Snyder M, et al. Rapid analysis of the DNA-binding specificities of transcription factors with DNA microarrays. Nat Genet 2004; 36:1331-9. [0358] 31. Kumar S, Blaxter M L. Comparing de novo assemblers for 454 transcriptome data. BMC Genomics 2010; 11:571. [0359] 32. The use of standardized allergen extracts. American Academy of Allergy, Asthma and Immunology (AAAAI). J. Allergy Clin. Immunol.1997; 99:583-6. [0360] 33. Lopes M I L, Miranda P J, Sarinho E. Use of the skin prick test and specific immunoglobulin E for the diagnosis of cockroach allergy. J Pediatr (Rio J) 2006; 82:204-9. [0361] 34. Schulten V, Tripple V, Sidney J, Greenbaum J, Frazier A, Alam R, et al. Association between specific timothy grass antigens and changes in TH1- and TH2-cell responses following specific immunotherapy. J Allergy Clin Immunol 2014; 134:1076-83.