Factors for the production and accumulation of polyunsaturated fatty acids (PUFAS) derived from PUFA synthases

10087430 ยท 2018-10-02

Assignee

Inventors

Cpc classification

International classification

Abstract

Disclosed are novel enhancing factor proteins of the PUFA synthase systems, nucleic acid molecules encoding the same, recombinant nucleic acid molecules and recombinant host cells comprising such nucleic acid molecules, genetically modified microorganisms comprising the same, and methods of making and using the same. Also disclosed are genetically modified microorganisms that have been genetically modified to express a PUFA synthase system for the production of PUFAs, wherein the microorganisms have been modified to express the novel enhancing factor proteins of the PUFA synthase system.

Claims

1. A heterologous nucleic acid molecule comprising a nucleic acid sequence encoding a polypeptide that is at least 90% identical to the amino acid sequence of SEQ ID NO: 1, wherein the polypeptide enhances polyunsaturated fatty acids (PUFA) production in a host cell compared to the PUFA production without the polypeptide.

2. The heterologous nucleic acid molecule of claim 1, wherein the polypeptide is at least 95% identical to the amino acid sequence of SEQ ID NO:1.

3. The heterologous nucleic acid molecule of claim 1, wherein the polypeptide enhances the enzymatic activity of a polyunsaturated fatty acids (PUFA) synthase.

4. The heterologous nucleic acid molecule of claim 3, wherein said heterologous nucleic acid molecule comprises a nucleic acid sequence which is an enzymatically active fragment of SEQ ID NO: 1.

5. The heterologous nucleic acid molecule of claim 1, wherein the polypeptide is at least 99% identical to SEQ ID NO:1.

6. A heterologous nucleic acid molecule, comprising the nucleic acid molecule according to any one of claims 1 to 5, operatively linked to an expression control sequence.

7. A heterologous host cell comprising the heterologous nucleic acid molecule of claim 6.

8. The heterologous host cell of claim 7, wherein the host cell is a microorganism.

9. The heterologous host cell of claim 7, wherein the cell endogenously expresses a PUFA synthase system, a phosphopantetheinyl transferase (PPTase), and/or an acyl-CoA synthetase (ACS).

10. The heterologous host cell of claim 9, wherein the cell is a Thraustochytriales cell.

11. The heterologous host cell of claim 10, wherein the cell is a Schizochytrium cell.

12. The heterologous host cell of claim 7, wherein the cell is a bacterial cell.

13. The heterologous host cell of claim 7, wherein the PUFA synthase system comprises at least one functional domain from a PUFA synthase system from a Thraustochytriales microorganism.

14. The heterologous host cell of claim 13, wherein the PUFA synthase system comprises at least one functional domain from a PUFA synthase system from a Schizochytrium.

15. The heterologous host cell of claim 14, wherein the PUFA synthase comprises at least one functional domain from a PUFA synthase from a microorganism selected from the group consisting of Schizochytrium sp. American Type Culture Collection (ATCC) No. 20888, Schizochytrium sp. American Type Culture Collection (ATCC) No. PTA-9695, Thraustochytrium 23B American Type Culture Collection (ATCC) No. 20892, and a mutant of any of said microorganisms.

Description

BRIEF DESCRIPTION OF THE DRAWINGS OF THE INVENTION

(1) FIG. 1 is a diagram showing the result of an in vitro PUFA synthase activity enhancing assay using enhancing factor proteins Sz-TE2 (SEQ ID NO:1) and Sz-TE3 (SEQ ID NO:2) expressed in E. coli.

(2) FIG. 2 is a diagram showing the result of an in vitro PUFA synthase activity enhancing assay using extracts from the Schizochytrium 20888 Quad-KO strain or extracts from cells derived from that strain in which either Sz-TE2 (SEQ ID NO:1) or Sz-TE3 (SEQ ID NO:2) have been inactivated.

(3) FIG. 3A is a diagram showing the alignment between the amino acid sequence of enhancing factor proteins B-TE2 (SEQ ID NO:3) and Sz-TE2 (SEQ ID NO:1).

(4) FIG. 3B is a diagram showing the alignment between the amino acid sequence of enhancing factor proteins B-TE3 (SEQ ID NO:4) and Sz-TE3 (SEQ ID NO:2).

(5) FIG. 4 is a diagram showing an in vitro PUFA synthase activity enhancing assay using separately expressed B-TE2 (SEQ ID NO:3) and B-TE3 (SEQ ID NO:4).

SEQUENCE LISTING

(6) The nucleic acid sequences and deduced amino acid translation sequences listed in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases and amino acids, as defined in 37 C.F.R. ? 1.822. Only one strand of each nucleic acid sequence is shown, but the complementary strand is understood to be included by any reference to the displayed strand. In the accompanying sequence listing:

(7) SEQ ID NO:1 shows the amino acid of the TE2 protein from Schizochytrium sp. ATCC-20888 (Sz-TE2):

(8) TABLE-US-00001 1 MTAQGGYRSEMLMYYEDTDLTGAVYAGNYFKYFERARDEAVGIDVLKTLMDKEGLALYVR 61 KMGEMTFKGGAKHADTLVVESSVEAPSDFRLVFKQRASVKDRPETIIVETDVEVVCIDMK 121 TQRVAKIPTQIREALRI

(9) SEQ ID NO:2 shows the amino acid sequence of the TE3 protein from Schizochytrium sp. ATCC 20888 (Sz-TE3):

(10) TABLE-US-00002 1 MAAPSTAVCGELPKLDEAPLKVSRARGYDALDVKVYREDTDTVGIVFYRNFLTWFERGRE 61 NAISTDFLAGLFEYSGDSFVVTRSEQSFRKPAFYGDELEVRTIPFADGPFRLHFDQSIWR 121 KSDNTLLVAGFVEMVTVSRTFQLTKVPQPVHDLIYYFDDCKSNFTYCEKPGAKKRPLRRK 181 PGAPSSLGKTTELDLVIHLADTDFTGIAFHPNYYCWFERARSDFLSNEILARAKTEFHAV 241 PVVRSAKLAYKNGARPVEPLRITTTQDPKGEHSDFVVPILQKLTRVSNDQTLVEAVFEMC 301 FVHDKERHLVKVPSIVRDAIA

(11) SEQ ID NO:3 shows the amino acid sequence of the TE2 protein from Schizochytrium sp. ATCC PTA-9695 (B-TE2):

(12) TABLE-US-00003 1 MVMVAEEKRAHEVAVQLYYEDTDFSGFVHHANFLRYFERGRDEMIGLPVLKCLAQDDSSS 61 SSSATSIGGGEPPVSLFVHKVHELSFKGRARHGEMLVVRSRVVKESDFRLRFAHEAWVGN 121 TLVASGSMDVVFLCGSVDARLVKIPNSVDVALHGYY

(13) SEQ ID NO:4 shows the amino acid sequence of the TE3 protein from Schizochytrium sp. ATCC PTA-9695 (B-TE3):

(14) TABLE-US-00004 1 MRIDEEAIRVAAARGYDALPVTVYREFTDCLGIVFYRHYLAWFERGRENVISVQFLADLF 61 RETGESFVVTRSEQVFKRSARYGDQLEVRTIPFLDGDYRLGFDQSVWHGNEMLVHGFVEM 121 VCVSKSFQLAQQPALVRKLIGCFDECTRNFTYVGTKARMPQTIRRRRGTASLPQAQKPLV 181 FDGLHLHQADTDFTGITFHPNYYCYFERARSQALTPAVLANVAEFANAVPVIRQARMTFK 241 QGARAYETLRVLTSIALDDSGGSSSSSNKYVVPFEQVLVRREDDKVLVEARIEIVFVDQT 301 TKLPCPIPDAVAAKMQELFAV

(15) SEQ ID NO:5 shows the nucleotide sequence encoding the TE2 protein from Schizochytrium sp. ATCC 20888 (SEQ ID NO:1):

(16) TABLE-US-00005 1 atgacggcgcagggcggctacagatcggagatgctcatgtactatgaggacacggacctg 61 accggagccgtctatgcgggcaactacttcaagtactttgagcgcgcgcgcgacgaggct 121 gtgggcatcgatgtcctcaagacgctcatggacaaggagggcctggctttgtacgtgcgc 181 aaaatgggcgagatgacctttaaaggaggcgccaagcacgccgacacgctcgtcgtcgag 241 tcctctgtcgaggctccctcggactttcgccttgtgttcaagcagcgggcatccgtcaag 301 gaccgtcccgagacgatcattgtcgagaccgatgttgaggtcgtttgcatcgacatgaaa 361 acgcagcgtgtcgccaagatcccgacgcaaatccgggaagcacttcgtatc

(17) SEQ ID NO:6 shows the nucleotide sequence encoding the TE3 protein from Schizochytrium sp. ATCC 20888 (SEQ ID NO:2):

(18) TABLE-US-00006 1 atggctgcgccatcgactgcagtctgcggcgagctgccaaagctcgacgaggcgcctctc 61 aaggtgtctcgtgcacgtggctacgacgcgctcgacgtcaaggtgtacagagaggacaca 121 gacacagtagggatcgtgttctatcgtaactttttgacctggtttgagcgtggccgggaa 181 aacgcgatctccacagactttctcgcaggactgttcgagtacagtggtgactccttcgtg 241 gtcacgcggtccgagcagtcgtttcgcaagcctgcattttacggcgatgaactcgaagtc 301 cgaaccattccttttgcagatgggccctttcgcctgcactttgaccagagcatctggcga 361 aagagcgacaacacattgctagtcgctggctttgtagagatggtcacggtgagcagaact 421 tttcagctcaccaaggtacctcagccggtgcacgacctcatttattactttgacgattgc 481 aagtcgaacttcacctactgcgaaaagcccggcgccaagaaaaggccgcttcggcgtaag 541 cccggggcgccctcttcacttggcaaaaccacagagcttgacctggtcattcacttggcc 601 gacactgactttactggaatcgcattccaccccaactactactgttggttcgagcgtgcg 661 cgctcggattttctcagcaatgagattcttgcacgcgccaagaccgagtttcatgctgtt 721 cccgttgtgcgcagtgcaaaactcgcgtacaaaaacggcgcgaggcctgttgagccgctc 781 cgcattacaacgacgcaagatccgaagggcgagcactcggactttgtcgtaccgattctt 841 caaaagcttacgcgtgtctcgaacgaccagacgctcgtcgaagccgtctttgagatgtgc 901 tttgttcatgacaaggagcgccacctcgtcaaggtcccgtcgatcgttcgcgatgctatt 961 gcg

(19) SEQ ID NO:7 shows the nucleotide sequence encoding the TE2 protein from Schizochytrium sp. ATCC PTA-9695 (SEQ ID NO:3):

(20) TABLE-US-00007 1 atggtcatggtcgcggaggagaagagggcgcacgaggtggcagtacagttgtactatgag 61 gacacggacttctccggctttgtccatcatgccaacttcctgcgctactttgaacgcggc 121 cgggatgagatgattggcctgcccgttctcaaatgcttggcccaagacgatagctcttct 181 tcttcttctgcaacttcaattggtggtggcgagcctccagtatcattgttcgtgcataag 241 gtgcacgagttgtcgttcaaaggtcgcgctcggcacggtgagatgctcgtggtgcggtca 301 cgagtggtcaaggaatcggacttccgactgcgctttgcacacgaagcgtgggtggggaac 361 acgctcgtggcctctggatcaatggacgtggtgttcctgtgtggctcggtcgatgcgcga 421 ttagtgaagatccctaactcggtcgatgtggccttgcacggatactat

(21) SEQ ID NO:8 shows the nucleotide sequence encoding the TE3 protein from Schizochytrium sp. ATCC PTA-9695 (SEQ ID NO:4):

(22) TABLE-US-00008 1 atgagaatcgacgaggaggcgatacgcgtggcagcggcgcgcgggtacgacgccttgccc 61 gtgacagtgtatcgagagtttaccgactgcctgggcattgtgttctaccggcactaccta 121 gcgtggtttgagcgcgggcgcgagaacgtcatctcggtgcagttcttggcggatctgttt 181 cgcgaaacgggggagtcgttcgtggtgacgcgctccgagcaagtgtttaagcgctcagcg 241 cgctatggcgaccaactcgaagtgcgcaccattcctttcctggacggcgactaccgcctc 301 ggcttcgaccagagcgtgtggcacggcaatgagatgctcgtgcatggcttcgtggagatg 361 gtctgcgtaagcaagagcttccagctggcgcaacaaccggcgctcgtgcgcaagctgatc 421 ggctgctttgacgagtgcacgcgcaacttcacctacgtcggcaccaaggcccgcatgccc 481 caaaccattcgacgacgcagaggcacggccagtctaccacaagcacagaagcctctagtg 541 tttgacgggctgcacttgcaccaagcggacacagacttcacaggtatcacttttcacccc 601 aactactactgctactttgaacgcgcgcgctcgcaggcattgactcccgccgtattagcg 661 aacgtggctgagttcgccaacgctgtgccagtcatccgccaagcccgcatgaccttcaag 721 caaggcgcgagagcgtacgagacactccgcgtgctcacatcaattgctctggatgatagc 781 ggcggcagcagcagcagcagcaacaagtatgtcgtgccgtttgagcaggtgctcgtgcga 841 agagaagacgacaaggtgctggtggaggcgcgaatcgagattgtctttgtggaccagact 901 acgaagttgccctgcccgattcctgacgcagtggcagccaagatgcaggagttgtttgcg 961 gta

DETAILED DESCRIPTION OF THE INVENTION

ABBREVIATIONS:

(23) ACS acyl-CoA synthetase

(24) B-TE2 or B_TE2 PUFA synthase activity enhancing factor 2 protein from Schizochytrium 9695

(25) B-TE3 or B_TE3 PUFA synthase activity enhancing factor 3 protein from Schizochytrium 9695

(26) DHA docosahexaenoic acid

(27) DPAn-6 docosapentaenoic acid n-6

(28) EF-X PUFA synthase in vitro activity enhancing factor proteins

(29) EPA eicosapentaenoic acid

(30) FAME fatty acid methyl ester

(31) FAS fatty acid synthase

(32) HPLC high-performance liquid chromatography

(33) KO knock-out

(34) LCPUFA long chain polyunsaturated fatty acid

(35) PKS polyketide synthase

(36) PPTase phosphopantetheinyl transferase

(37) PUFA polyunsaturated fatty acid

(38) Sz-TE2 or SzTE2 PUFA synthase activity enhancing factor 2 protein from Schizochytrium 20888

(39) Sz-TE3 or SzTE3 PUFA synthase activity enhancing factor 3 protein from Schizochytrium 20888

(40) Schizochytrium 9695 Schizochytrium sp. strain ATCC PTA-9695

(41) Schizochytrium 20888 Schizochytrium sp. strain ATCC 20888

(42) The present invention generally relates to the provision of proteins (generally referred to herein as PUFA synthase in vitro activity enhancing factor proteins or EF-X), and nucleic acid molecules encoding such proteins, for the improvement of the production of polyunsaturated fatty acids (PUFAs) and particularly, long chain PUFAs (LCPUFAs), in a host organism that has been genetically modified to produce such PUFAs. The present invention also relates to the organisms that have been genetically modified to express certain of such proteins, and to methods of making and using such proteins and organisms.

(43) According to the present invention, an organism that has been genetically modified to express a PUFA synthase system, wherein the organism does not naturally (endogenously, without genetic modification) express such a system, can be referred to herein as a heterologous host organism with regard to the modification of the organism with the PUFA synthase system. The genetic modifications of the present invention may also be used to improve PUFA production in a host organism that endogenously expresses a PUFA synthase system, where the organism is not further modified with a different PUFA synthase system or a portion thereof, but is genetically modified to express the enhancing factor proteins described herein.

(44) More particularly, the present inventors have discovered and disclose for the first time a class of enhancing factor proteins which enhance the activity of PUFA synthases. The present inventors have determined that an endogenous producer of PUFA by the PUFA synthase system, i.e., Schizochytrium 20888, possesses one or more enhancing factor proteins that may be capable to enhance the production of PUFAs. This is evident by the fact that the expression of these factors, especially co-expression of the two of such enhancing factor proteins in heterologous host organisms that are also expressing an active PUFA synthase system from Schizochytrium 20888 results in increased accumulation of PUFAs and increased ratio of DHA:DPAn-6 in the cells of those organisms. Disruption of the endogenous genes encoding these proteins in Schizochytrium 20888 leads to a decrease in accumulation of PUFAs in those cells.

(45) The present inventors have identified from Schizochytrium 20888 two enhancing factor proteins: SEQ ID NO:1 and SEQ ID NO:2. They are not part of the PUFA synthase system itself but were found to enhance the in vitro activity of PUFA synthases. Both of the enhancing factor proteins have homology to a class of thioesterases called 4-hydroxybenzoyl-CoA-like thioesterases. However, the enhancing factor proteins may or may not have thioesterase activity. SEQ ID NO:1 (referred to herein as the enhancing factor 2 protein from Schizochytrium 20888, or Sz-TE2 protein) has one thioesterase domain, while SEQ ID NO:2 (referred to herein as the enhancing factor 3 protein from Schizochytrium 20888, or Sz-TE3 protein) has two thioesterase domains. The Sz-TE2 protein and the Sz-TE3 protein function most efficiently when they are expressed together. See, for example, Example 4.

(46) Homologs of these two proteins have also been identified in another ThraustochytridSchizochytrium sp. strain ATCC PTA-9695 which is referred to here as Schizochytrium 9695. SEQ ID NO:3 is referred to herein as the enhancing factor 2 protein from Schizochytrium 9695 (referred to herein as B-TE2 protein). SEQ ID NO:4 is referred to herein as the enhancing factor 3 protein from Schizochytrium 9695 (referred to herein as B-TE3 protein). These homologs were shown in the present invention to have in vitro PUFA synthase enhancing activity that is similar to the homolog proteins from Schizochytrium 20888. See, for example, Examples 9 and 10.

(47) Sz-TE2 and B-TE2 are referred to herein in general as TE2 enhancing factor proteins. Sz-TE3 and B-TE3 are referred to herein in general as TE3 enhancing factor proteins. It was discovered in the present invention that TE2, TE3, and in particular, the combination of TE2 and TE3, enhance the enzymatic activity of PUFA synthase in a host cell where TE2 and TE3 are exogenously expressed.

(48) Thioesterases are a class of enzymes which have been extensively studied in the past. A polypeptide or a domain of a polypeptide having thioesterase activity has been previously shown to be capable of catalyzing the hydrolysis of the thioester bond of fatty acids bound to CoA or acyl carrier proteins. Members of thioesterase enzymes have been classified into families by primary structure and into clans and superfamilies by tertiary structure (see Cantu el al., 2010, Protein Science, 19:1281-1295). More than eighty crystal structures of thioesterases or their domains are available, which provide a wealth of information on the tertiary structures, catalytic residues, and mechanisms of the enzymes, ibid. Some thioesterases have the feature of a hot dog fold (see Pidugu et al., 2009, BMC Structural Biology, 9:37 pp1-16). The hotdog fold was first identified in the crystal structure of ?-hydroxydecanoyl thioester dehydratase (Fab A) from E. coli (see Leesong et al., 1996, Structure 4(3):253-264). According to Leesong et al., at least eight types of hotdog fold thioesterases have been identified and their crystal structures were made available, including 4-hydroxybenzoyl-CoA thioesterase. Among the subfamilies of thioesterase, the subfamily of 4-hydroxybenzoyl-CoA thioesterases shares the closest protein sequence homology to the TE2 and TE3 proteins identified in the present invention.

(49) The present inventors believe that the enhancing factor proteins discovered by the present inventors are useful for modifying PUFA accumulation in hosts expressing a PUFA synthase, i.e., increasing or decreasing the amount of the PUFA accumulation and/or changing the ratio of the PUFA products. Indeed, the Examples presented herein demonstrate that the enhancing factor proteins from Schizochytrium 20888 increase the accumulation of PUFAs in those E. coli and yeast strains which have been genetically modified with a Schizochytrium 20888 PUFA synthase system. In addition, the enhancing factor proteins alter the ratio of the PUFA products of the PUFA synthase system. Each of these enhancing factor proteins and the nucleic acids encoding the same are encompassed by the present invention, as well as homologies and biologically active fragments thereof. These proteins and nucleic acid molecules will be discussed in detail below and in the Examples.

(50) One embodiment of the present invention relates to isolated enhancing factor proteins that enhance the amount and alter the ratio of the products of a PUFA synthase system. In one aspect of the invention, the isolated enhancing factor protcin(s) is (are) derived from an organism that endogenously expresses a PUFA synthase system. Such organisms include, but are not limited to, members of the Thraustochytriales. In one aspect, the isolated proteins are derived from the genus Schizochytrium. In another aspect, the isolated enhancing factor protein is derived from Schizochytrium 20888 or from Schizochytrium 9695. In another aspect, any protein that is a homolog of the enhancing factor proteins identified in the present invention and that functions in conjunction with any PUFA synthase system to modify the production and or accumulation of PUFAs in a host cell or organism can be used in the present invention. The invention is not limited to those specific examples described herein.

(51) In another aspect, the isolated enhancing factor protein is encoded by a nucleotide sequence selected from any one of SEQ ID NOs: 5, 6, 7, or 8. In another aspect, the isolated enhancing factor protein is encoded by a degenerate nucleic acid sequence encoding a protein that is encoded by a nucleotide sequence selected from anyone of SEQ ID NOs: 5, 6, 7, or 8. SEQ ID NO:5 is the nucleotide sequence encoding the TE2 protein from Schizochytrium 20888. SEQ ID NO:6 is the nucleotide sequence encoding the TE3 protein from Schizochytrium 20888. SEQ ID NO:7 is the nucleotide sequence encoding the TE2 protein from Schizochytrium 9695. SEQ ID NO:8 is the nucleotide sequence encoding the TE3 protein from Schizochytrium 9695.

(52) In yet another aspect, the isolated enhancing factor protein comprises an amino acid sequence selected from any one of SEQ ID NOs:1, 2, 3, 4, or a homologue of any of such amino acid sequences, including any biologically active fragments or domains of such sequences.

(53) In some embodiment, an enhancing factor protein of the present invention includes, for example and without limitation, at least one protein comprising an amino acid sequence having at least 50% (e.g., at least 55%; at least 60%; at least 65%; at least 70%; at least 75%; at least 80%; at least 81%; at least 82%; at least 83%; at least 84%; at least 85%; at least 86%; at least 87%; at least 88%; at least 89%; at least 90%; at least 91%; at least 92%; at least 93%; at least 94%; at least 95%; at least 96%; at least 97%; at least 98%; at least 99%) identity to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:3.

(54) In some embodiment, an enhancing factor protein includes, for example and without limitation, at least one protein comprising an amino acid sequence having at least 50% (e.g., at least 55%; at least 60%; at least 65%; at least 70%; at least 75%; at least 80%; at feast 81%; at least 82%; at least 83%; at least 84%; at least 85%; at least 86%; at least 87%; at least 88%; at least 89%; at least 90%; at least 91%; at least 92%; at least 93%; at least 94%; at least 95%; at least 96%; at least 97%; at least 98%; at least 99%) identity to the amino acid sequence of SEQ ID NO:2 or SEQ ID NO:4.

(55) One embodiment of the invention relates to an isolated nucleic acid molecule comprising a nucleic acid sequence encoding a polypeptide that is at least 50% (e.g., at least 55%; at least 60%; at least 65%; at least 70%; at least 75%; at least 80%; at least 81%; at least 82%; at least 83%; at least 84%; at least 85%; at least 86%; at least 87%; at least 88%; at least 89%; at least 90%; at least 91%; at least 92%; at least 93%; at least 94%; at least 95%; at least 96%; at least 97%; at least 98%; at least 99%) identity to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:3. In one aspect, the polypeptide enhances the enzymatic activity of a PUFA synthase. In one aspect, the isolated nucleic acid molecule comprising a nucleic acid sequence encodes a polypeptide having an amino acid sequence of SEQ ID NO:1 or SEQ ID NO:3. In one aspect, the isolated nucleic acid molecule comprises a nucleic acid sequence which is SEQ ID NO:5 or SEQ ID NO:7.

(56) One embodiment of the invention relates to an isolated nucleic acid molecule comprising a nucleic acid sequence encoding a polypeptide that is at least 50% (e.g., at least 55%; at least 60%; at least 65%; at least 70%; at least 75%; at least 80%; at least 81%; at least 82%; at least 83%; at least 84%; at least 85%; at least 86%; at least 87%; at least 88%; at least 89%; at least 90%; at least 91%; at least 92%; at feast 93%; at least 94%; at least 95%; at least 96%; at least 97%; at least 98%; at least 99%) identity to the amino acid sequence of SEQ ID NO:2 or SEQ ID NO:4. In one aspect, the polypeptide enhances the enzymatic activity of a PUFA synthase. In one aspect, the isolated nucleic acid molecule comprising a nucleic acid sequence encodes a polypeptide having an amino acid sequence of SEQ ID NO:2 or SEQ ID NO:4. In one aspect, the isolated nucleic acid molecule comprises a nucleic acid sequence which is SEQ ID NO:6 or SEQ ID NO:8.

(57) The invention includes the expression of one or more enhancing factor proteins as described and exemplified herein with a PUFA synthase system as described herein and with an exogenous PPTase and/or acyl-CoA synthetase (ACS) to increase PUFA production and/or accumulation in a heterologous host.

(58) PUFA Synthase Systems (PUFA PKS Systems)

(59) Accordingly, the present invention is directed to the enhancing factor proteins for use in connection with a PUFA synthase systems. As used herein, a PUFA synthase system (which may also be referred to as a PUFA PKS system, PUFA synthase PKS-like system, PUFA synthase, or PUFA synthase enzyme) generally has the following identifying features: (1) it produces PUFAs, and particularly, long chain PUFAs, as a natural product of the system; and (2) it produces those PUFAs de novo using malonyl-CoA as the carbon source. In addition, the ACP domains present in the PUFA synthase enzymes require activation by attachment of a cofactor (4-phosphopantetheine). Attachment of this cofactor is carried out by phosphopantetheinyl transferases (PPTase). If the endogenous PPTases of the host organism are incapable of activating the PUFA synthase ACP domains, then it is necessary to provide a PPTase that is capable of carrying out that function. The HetI enzyme of Nostoc sp. is an exemplary and suitable PPTase for activating PUFA synthase ACP domains. Reference to a PUFA synthase system refers collectively to all of the genes and their encoded products that work together to produce PUFAs in an organism.

(60) More specifically, a PUFA synthase system as referenced herein produces polyunsaturated fatty acids (PUFAs) and particularly, long chain PUFAs (LCPUFAs), as products. For example, an organism that endogenously (naturally) contains a PUFA synthase system makes PUFAs using this system. According to the present invention, PUFAs are fatty acids with a carbon chain length of at least 16 carbons, and more preferably at least 18 carbons, and more preferably at least 20 carbons, and more preferably 22 or more carbons, with at least 3 or more double bonds, and preferably 4 or more, and more preferably 5 or more, and even more preferably 6 or more double bonds, wherein all double bonds are in the cis configuration. Reference to long chain polyunsaturated fatty acids (LCPUFAs) herein more particularly refers to fatty acids of 18 and more carbon chain length, and preferably 20 and more carbon chain length, containing 3 or more double bonds. LCPUFAs of the omega-6 series include: gamma-linolenic acid (C18:3), di-homo-gamma-linolenic acid (C20:3, n-6), arachidonic acid (C20:4, n-6), adrenic acid (also called docosatetraenoic acid or DTA) (C22:4, n-6), and docosapentaenoic acid (C22:5, n-6). The LCPUFAs of the omega-3 series include: alpha-linolenic acid (C18:3), eicosatrienoic acid (C20:5, n-3), eicosatetraenoic acid (C20:4, n-3), eicosapentaenoic acid (C20:5, n-3), docosapentaenoic acid (C22:5, n-3), and docosahexaenoic acid (C22:6, n-3). The LCPUFAs also include fatty acids with greater than 22 carbons and 4 or more double bonds including but not limited to C28:8, n-3.

(61) The enhancing factor proteins according to the present invention can be used in connection with a PUFA synthase system from either a prokaryotic organism or an eukaryotic organism. Description of the PUFA synthase systems of various organisms can be found, for example, in U.S. Pat. No. 6,140,486; U.S. Pat. No. 6,566,583; Metz et al., Science 293:290-293 (2001); U.S. Pat. No. 7,247,461; U.S. Pat. No. 7,211,418; U.S. Pat. No. 7,217,856, U.S. Patent Application Publication No. 2010-0266564, and PCT Publication No. WO 2006/135866.

(62) The domain architecture of various PUFA synthase systems from marine bacteria and members of Thraustochytrium, and the structural and functional characteristics of genes and proteins comprising such PUFA synthase systems, have been described in detail (see, e.g., U.S. Pat. No. 6,140,486; U.S. Pat. No. 6,566,583; Metz et al., Science 293:290-293 (2001); U.S. Pat. No. 7,247,461; U.S. Pat. No. 7,211,418; U.S. Pat. No. 7,217,856, U.S. Patent Application Publication No. 2010-0266564, and PCT Publication No. WO 2006/135866).

(63) The enzymatic activity of a PUFA synthase can be measured in the form of PUFA accumulation rate and PUFA composition profile. Two exemplary methods for measuring the activity of PUFA synthase are described in Example 1 of the present application. In those assays, radio labeled malonyl CoA is used as substrate and is converted into PUFAs by the PUFA synthase system. The amount and compositions of PUFAs produced are measured.

(64) Phosphopantetheinyl transferase (PPTase)

(65) As discussed under the general guidelines for the production of PUFAs in a heterologous host above, in order to produce PUFAs, a PUFA synthase system must work with an accessory protein that transfers a 4-phosphopantetheinyl moiety from coenzyme A to the acyl carrier protein (ACP) domain(s). Therefore, a PUFA synthase system can be considered to include at least one 4-phosphopantetheinyl transferase (PPTase) domain, or such a domain can be considered to be an accessory domain or protein to the PUFA synthase system. Structural and functional characteristics of PPTases have been described in detail, for example, in U.S. Pat. No. 7,247,461; U.S. Pat. No. 7,211,418; and U.S. Pat. No. 7,217,856.

(66) According to the present invention, a domain or protein having 4-phosphopantetheinyl transferase (PPTase) biological activity (function) is characterized as the enzyme that transfers a 4-phosphopantetheinyl moiety from Coenzyme A to the acyl carrier protein (ACP). This transfer to an invariant serine reside of the ACP activates the inactive apo-form to the holo-form. In both polyketide and fatty acid synthesis, the phosphopantetheine group forms thioesters with the growing acyl chains. The PPTases are a family of enzymes that have been well characterized in fatty acid synthesis, polyketide synthesis, and non-ribosomal peptide synthesis. The sequences of many PPTases are known, and crystal structures have been determined (e.g., Reuter et al., 1999, EMBO J. 18(23):6823-6831) as well as mutational analysis of amino acid residues important tor activity (Mofid et al., 2004, Biochemistry, 43(14):4128-4136).

(67) Accordingly, one embodiment of the invention relates to a genetically modified host cell or microorganism, wherein the host cell or microorganism has been genetically modified to express a core PUFA synthase system as described herein, and also a PPTase as described herein. Suitable PPTases are described above and are also described in the art. The PPTase may be expressed on the same or a different construct as one or more of the nucleic acid molecules encoding the core PUFA synthase protein or proteins. In one aspect, the PPTase is the Nostoc HetI.

(68) Acyl-CoA Synthetases

(69) Acyl-CoA synthetase (ACS) proteins catalyze the conversion of free fatty acids (FFAs), including long chain PUFA, to acyl-CoA. Numerous examples of polypeptides having ACS activity are known in the art and may be used in embodiments herein. For example, Schizochytrium sp. ATCC 20888 possesses one or more ACSs that are capable of converting the free fatty acid products of its PUFA synthase into acyl-CoA. See, e.g., U.S. Pat. No. 7,759,548.

(70) The ACS protein can be derived from an organism that endogenousiy expresses a PUFA synthase system. Such organisms include, but are not limited to, a Thraustochytrid. In one aspect, the isolated ACS is derived from organisms of the genera Schizochytrium, Thraustochytrium, or Ulkenia. In another aspect, the isolated ACS is derived from Schizochytrium ATCC 20888. In another aspect, any ACS that functions in conjunction with any PUFA synthase system to increase the production and/or accumulation of PUFAs in a host cell or organism can be used in the present invention.

(71) Genetically Modified Cells and Organisms

(72) To produce significantly high yields of one or more desired polyunsaturated fatty acids or other bioactive molecules, an organism, preferably a microorganism, can be genetically modified to alter the activity and particularly, the end product(s), of the PUFA synthase system in the microorganism, or to introduce a PUFA synthase system into the microorganism. The present invention relates to methods to improve or enhance the effectiveness of such genetic modification and particularly, to improve or enhance the production and/or accumulation of the end product of a PUFA synthase system, preferably PUFA(s).

(73) Therefore, one embodiment of the present invention relates to a genetically modified organism, wherein the organism expresses a PUFA synthase system, and wherein the organism has been genetically modified to express the enhancing factor protein(s) as described herein for the improvement of the production and/or accumulation of PUFAs (or other bioactive products of the PUFA synthase system) by the host. If the PUFA synthase system is heterologous to the host, then the organism is also preferably genetically modified to express a PPTase as a PUFA synthase accessory protein, which is described in detail above. In some embodiments, the organism has been genetically modified to express the one or more enhancing factor proteins described herein, and preferably a combination of TE2 and TE3 proteins or their homologues or enzymatically active fragments.

(74) In one embodiment, if the PUFA synthase system is endogenous to the host, the organism can be genetically modified to express heterologous enhancing factor protein(s) as described above which improves the production and/or accumulation of PUFAs (or another bioactive product of the PUFA synthase system) in the host organism.

(75) In another embodiment, the host organisms can be genetically modified to express a heterologous PUFA synthase system. The PUFA synthase system expressed by the organism can include any PUFA synthase system, for example. PUFA PKS systems that are entirely derived from a Schizochytrium 20888 PUFA synthase system, as well as PUFA synthase systems that are produced by mixing and matching nucleic acid sequences encoding proteins and/or domains from different PUFA synthase systems (e.g., by mixing Schizochytrium 20888 PUFA synthase proteins and/or domains with PUFA synthase proteins and/or domains from, e.g., Schizochytrium 9695, or those derived from the genera Thraustochytrium, Ulkenia, Shewanella, Moritella, and/or Photobacterium, etc.) and/or from different non-PUFA synthase systems (e.g., type I modular, type I iterative, type II or type III PKS systems), where the proteins and/or domains from different organisms are combined to form a complete, functional PUFA synthase system. PUFA synthase systems, including combining PUFA synthase genes or proteins from different organisms, are described in detail in U.S. Pat. No. 6,140,486; U.S. Pat. No. 6,566,583; Metz et al., Science 293:290-293 (2001); U.S. Pat. No. 7,247,461; U.S. Pat. No. 7,211,418; U.S. Pat. No. 7,217,856, U.S. Patent Application Publication No. 2010-0266564; and PCT Publication No. WO 2006/135866; supra). PUFA synthase genes and proteins are also disclosed in: U.S. Pat. No. 7,939,305; and U.S. Pat. No. 7,208,590. Each of the above-identified disclosures, and the genes and proteins described therein, is incorporated herein by reference.

(76) Accordingly, encompassed by the present invention are methods to genetically modify organisms by: expressing one or more exogenous enhancing factor proteins described herein, especially a combination of enhancing factor proteins TE2 and TE3, and/or by genetically modifying at least one nucleic acid sequence in the organism that encodes at least one functional domain or protein (or biologically active fragment or homologue thereof) of a PUFA synthase system, including, but not limited to, any PUFA synthase system specifically described herein. In one embodiment, any of the exogenously introduced nucleic acid sequences can be optimized for codon usage or improved expression in the host, in one embodiment, any of the introduced nucleic acid sequences can be targeted to one or more organelles in the organism. Various embodiments of such sequences, methods to genetically modify an organism, specific modifications, and combinations thereof have been described in detail above and are encompassed here. Typically, the method is used to produce a particular genetically modified organism that produces a particular bioactive molecule or molecules.

(77) Preferred genetically modified organisms include genetically modified microorganisms.

(78) Preferably, a genetically modified organism of the invention produces one or more polyunsaturated fatty acids including, but not limited to, DHA (C22:6, n-3), DPA (C22:5, n-6 or n-3), EPA (C20:5, n-3), ARA (C20:4, n-6), ALA (C18:3, n-6), ALA (C18:3, n-3), and/or SDA (C18:4, n-3)), and more preferably, one or more longer chain PUFAs, including, but not limited to, DHA (C22:6, n-3), DPA (C22:5, n-6 or n-3), EPA (C20:5, n-3), or DTA (C22:4, n-6), or any combination thereof. In a particularly preferred embodiment, a genetically modified microorganism of the invention produces one or more polyunsaturated fatty acids including, but not limited to, DHA (C22:6, n-3) and DPA (C22:5, n-6 or n-3), or any combination thereof.

(79) According to the present invention, a genetically modified organism includes an organism that has been modified using recombinant technology or by classical mutagenesis and screening techniques. As used herein, genetic modifications that result in a decrease in gene expression, in the function of the gene, or in the function of the gene product (i.e., the protein encoded by the gene) can be referred to as inactivation (complete or partial), deletion, interruption, blockage or down-regulation of a gene. For example, a genetic modification in a gene which results in a decrease in the function of the protein encoded by such gene, can be the result of a complete deletion of the gene (i.e., the gene does not exist, and therefore the protein does not exist), a mutation in the gene which results in incomplete or no translation of the protein (e.g., the protein is not expressed), or a mutation in the gene which decreases or abolishes the natural function of the protein (e.g., a protein is expressed which has decreased or no enzymatic activity or action). Genetic modifications that result in an increase in gene expression or function can be referred to as amplification, overproduction, overexpression, activation, enhancement, addition, or up-regulation of a gene.

(80) Genetically Modified Microorganisms

(81) As used herein, a genetically modified microorganism can include a genetically modified bacterium, protist, microalgae, algae, fungus, or other microbe. Such a genetically modified microorganism has a genome which is modified (i.e., mutated or changed) from its normal (i.e., wild-type or naturally occurring) form such that the desired result is achieved (i.e., increased or modified PUFA synthase activity and/or production and accumulation of a desired product using the PUFA PKS system). Genetic modification of a microorganism can be accomplished using classical strain development and/or molecular genetic techniques. Such techniques known in the art and are generally disclosed for microorganisms, for example, in Sam brook et al., 1989, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Labs Press. The reference Sambrook et at, ibid., is incorporated by reference herein in its entirety. A genetically modified microorganism can include a microorganism in which nucleic acid molecules have been inserted, deleted or modified (i.e., mutated; e.g., by insertion, deletion, substitution, and/or inversion of nucleotides), in such a manner that such modifications provide the desired effect within the microoreanism.

(82) Examples of suitable host microorganisms for genetic modification include, but are not limited to, yeast including Saccharomyces cerevisiae, Saccharomyces carlsbergensis, or other yeast such as Candida, Kluyveromyces, or other fungi, for example, filamentous fungi such as Aspergillus, Neurospora, Penicillium, etc. Bacterial cells also may be used as hosts. These include, but are not limited to, Escherichia coli, which can be useful in fermentation processes. Alternatively, and only by way of example, a host such as a Lactobacillus species or Bacillus species can be used as a host.

(83) Other hosts for use in the present invention include microorganisms from a genus including, but not limited to: Thraustochytrium, Japonochytrium, Aplanochytrium, Elina and Schizochytrium within the Thraustochytriaceae, and Labyrinthula, Labyrinthuloides, and Labyrinthomyxa within the Labyrinthulaceae. Preferred species within these genera include, but are not limited to: any species described below. Particularly preferred strains of Thraustochytriales include, but are not limited to: Schizochytrium sp. (S31)(ATCC 20888); Schizochytrium sp. (ATCC PTA-9695): Schizochytrium sp, (S8)(ATCC 20889); Schizochytrium sp. (LC-RM)(ATCC 18915); Schizochytrium sp. (SR21); Schizochytrium sp. N230D, Schizochytrium aggregatum (Goldstein et Belsky)(ATCC 28209); Schizochytrium limacinum (Honda et Yokochi)(IFO 32693): Thraustochytrium sp. (23B)(ATCC 20891 or ATCC 20892); Thraustochytrium striatum (Schneider)(ATCC 24473); Thraustochytrium aureum (Goldstein)(ATCC 34304); Thraustochytrium roseum (Goldstein)(ATCC 28210); and Japonochytrium sp. (L1)(ATCC 28207).

(84) In one embodiment of the present invention, the enhancing factor proteins of PUFA synthase (e.g., TE2 and TE3) of a microorganism are exogenously introduced into a host microorganism which has an endogenous PUFA synthase system to increase the amount of PUFAs produced. In another embodiment, the exogenous enhancing factor proteins and an exogenous PUFA synthase system of a microorganism are introduced into a host microorganism which does not have any PUFA synthase system to produce detectable amount of PUFAs. Examples of heterologous sequences that could be introduced into a host genome include sequences encoding at least one functional PUFA synthase domain or protein from another PKS synthase or even an entire PUFA synthase system (e.g., all genes associated with the PUFA synthase system). A heterologous sequence can also include a sequence encoding a modified functional domain (a homologue) of a natural domain from a PUFA synthase system. Other heterologous sequences that can be introduced into the host genome include PPTase and/or ACS.

(85) Therefore, it is an object of the present invention to produce, via the genetic manipulation of microorganisms as described herein, PUFAs and, by extension, oils obtained from such microorganisms comprising these PUFAs. Examples of PUFAs that can be produced by the present invention include, but are not limited to, DHA (docosahexaenoic acid (C22:6, n-3)), DPA (docosapentaenoic acid (C22:5, n-6 or n-3)), and EPA (eicosapentaenoic acid (C20:5, n-3)) and any combinations thereof. The present invention allows for the production of commercially valuable lipids enriched in one or more desired (primary) PUFAs by the present inventors' development of genetically modified microorganisms through the use of the PUFA synthase system that produces PUFAs.

(86) When using a PUFA synthase system as preferred in the present invention, a given PUFA synthase system derived from a particular organism will produce particular PUFA(s), such that selection of a PUFA synthase system from a particular organism will result in the production of specified PUFAs. For example, use of a PUFA synthase system from Schizochytrium 20888 will result in the production of DHA and DPAn-6 as the primary PUFAs.

(87) Schizochytrium 20888 can accumulate high levels of oil (>60% of the biomass) and DHA can comprise >40% of the fatty acids present in that biomass. In the native organism the DHA to DPAn-6 ratio typically ranges between 2.3 to 2.7. Expression of the PUFA synthase subunits of Schizochytrium 20888, along with an appropriate PPTase (e.g., HetI from Nostoc sp.) in heterologous host cells has resulted in production of DHA and DPAn-6 in those cells. Although DHA and DPAn-6 are produced in cells of E. coli, and in yeast and higher plants, the levels have not approached those observed in the native organism. Additionally, in both yeast and in plants, the DHA to DPAn-6 ratio is typically significantly lower than that observed in the native organism.

(88) According to the present invention, a microorganism can be genetically modified to introduce one or more genes encoding the enhancing factor proteins described herein to increase the production of PUFAs from the particular PUFA synthase present in that organism (e.g., DHA, DPAn-6 and/or EPA). In addition, introduction of the enhancing factor proteins described herein can result in an alteration of the relative amounts of the PUFAs produced by the particular PUFA synthase present in that organism (e.g., the ratio of DHA to DPAn-6 produced in the microorganism may be increased).

(89) Therefore, one embodiment of the present invention relates to a genetically modified microorganism (e.g., wherein the microorganism has been genetically modified to express a PUFA synthase system described herein), which includes the core PUFA synthase, a PPTase, and/or an ACS, as described herein, wherein the microorganism has been further genetically modified to express one or more enhancing factor proteins as described herein for the improvement of the production and/or accumulation of PUFAs (or other bioactive products of the PUFA synthase system) by the host. Preferably, such enhancing factor protein is a combination of TE2 and TE3 proteins. The enhancing factor proteins described here, such as TE2 and TE3, include homologues and biologically active fragments of such proteins.

(90) In some embodiments, the genetically modified microorganism which is genetically modified to express a heterologous PUFA synthase system and a combination of TE2 and TE3 proteins has an increased level of total PUFA accumulation relative to the microorganism without the expression of TE2 and TE3 proteins, in one embodiment, the total PUFA accumulation is increased more than 2-fold, more than 3-fold, more than 4-fold, more than 5-fold, more than 6-fold, more than 7-fold, more than 8-fold, more than 9-fold, or more than 10-fold. In one embodiment, the increased level of total PUFA accumulation is close or equal to the level produced by the native microorganism of the heterologous PUFA synthase system. In one embodiment, the increased level of total PUFA accumulation is between 90% and 110% of the amount of PUFA produced by the native microorganism of the heterologous PUFA synthase system.

(91) In some embodiments, the genetically modified microorganism which is genetically modified to express a heterologous PUFA synthase system and a combination of TE2 and TE3 proteins has an increased level of total DHA, DPA(n-6), and EPA accumulation when compared to the microorganism without the expression of TE2 and TE3 proteins. In one embodiment, the level of DHA and DPAn-6 accumulation is increased more than 2-fold, more than 3-fold, more than 4-fold, more than 5-fold, more than 6-fold, more than 7-fold, more than 8-fold, more than 9-fold, or more than 10-fold. In one embodiment, the increased level of DHA and DPAn-6 accumulation is close or equal to the level produced by the native microorganism of the heterologous PUFA synthase system. In one embodiment, the increased level of DHA and DPAn-6 accumulation is between 90% and 110% of the amount of PUFA produced by the native microorganism of the heterologous PUFA synthase system.

(92) In some embodiments, the genetically modified microorganism which is genetically modified to express a heterologous PUFA synthase system and a combination of TE2 and TE3 proteins has an enhanced ratio of DHA:DPAn-6 by weight of total fatty acids than the microorganism without such genetic modification. In one embodiment, the higher ratio of DHA:DPAn-6 is close or equal to the ratio in the microorganism where the PUFA synthase system is derived from. In one embodiment, the enhanced ratio of DHA:DPAn-6 is between 90% and 110% of the ratio of DHA:DPAn-6 of the microorganism where the PUFA synthase system is derived from.

(93) The genetic modification of a microorganism according to the present invention can be made either to positively affect the activity of the PUFA synthase system expressed by the microorganism, or to negatively affect the activity of the PUFA synthase system expressed by the microorganism. For example, the activity of the PUFA synthase system can be reduced or even blocked by a reduction or elimination of the expression of the endogenous enhancing factor proteins of the host microorganism. In some embodiments, the host microorganism is a Thraustochytriales microorganism. In one embodiment, the host microorganism is a Schizochytrium 20888. In another embodiment, the host microorganism is a Schizochytrium 9695.

(94) Uses for Genetically Modified Organisms of the Invention

(95) One embodiment of the present invention is a method to produce desired bioactive molecules (also referred to as produets or compounds) by growing a genetically modified microorganism of the present invention (described in detail above). Preferably, the bioactive molecule is a PUFA, and most preferably, an LCPUFA. Preferably, the genetically modified microorganism is a genetically modified microorganism. Such a method includes, for example, the step of culturing in a fermentation medium a microorganism as described previously herein and in accordance with the present invention. Preferred host cells and microorganisms for genetic modification related to the PUFA synthase system of the invention are described above.

(96) One embodiment of the present invention is a method to produce desired PUFAs by culturing a genetically modified microorganism of the present invention (described in detail above). Such a method includes the step of culturing in a fermentation medium and under conditions effective to produce the PUFA(s) a microorganism that has a genetic modification as described previously herein and in accordance with the present invention. An appropriate, or effective, medium refers to any medium in which a genetically modified microorganism of the present invention, when cultured, is capable of producing the desired PUFA product(s). Such a medium is typically an aqueous medium comprising assimilable carbon, nitrogen and phosphate sources. Such a medium can also include appropriate salts, minerals, metals and other nutrients. Any microorganisms of the present invention can be cultured in conventional fermentation bioreactors. The microorganisms can be cultural by any fermentation process which includes, but is not limited to, batch, fed-batch, cell recycle, and continuous fermentation. Preferred growth conditions for Thraustochytrid microorganisms according to the present invention are well known in the art and are described in detail, for example, in U.S. Pat. No. 5,130,242, U.S. Pat. No. 5,340,742, and U.S. Pat. No. 5,698,244, each of which is incorporated herein by reference in its entirety.

(97) The desired PUFA(s) and/or other bioactive molecules produced by the genetically modified microorganism can be recovered from the fermentation medium using conventional separation and purification techniques. For example, the fermentation medium can be filtered or centrifuged to remove microorganisms, cell debris and other particulate matter, and the product can be recovered from the cell-free supernatant by conventional methods, such as, for example, ion exchange, chromatography, extraction, solvent extraction, phase separation, membrane separation, electrodialysis, reverse osmosis, distillation, chemical derealization and crystallization. Alternatively, microorganisms producing the PUFA(s), or extracts and various fractions thereof, can be used without removal of the microorganism components from the product.

(98) The invention further includes any microorganisms described herein as well as any oils produced by the microorganisms described herein. The invention also includes any products produced using the microorganisms or oils described herein.

(99) One embodiment of the present invention relates to a method to modify a product containing at least one fatty acid, comprising adding to the product a microorganism or oil produced by a genetically modified microorganism according to the invention and as described herein (e.g., a microorganism that has been genetically modified with a PUFA synthase system, makes use of any of the strategies for improvement of production and/or accumulation of PUFAs described herein, and has a fatty acid profile described herein). Any products produced by this method or generally containing any microorganisms or oils from the microorganisms described herein are also encompassed by the invention.

(100) Preferably, the product is selected from the group consisting of a food, a dietary supplement, a pharmaceutical formulation, a feedstuff, a humanized animal milk, and an infant formula. Suitable pharmaceutical formulations include, but are not limited to, an anti-inflammatory formulation, a chemotherapeutic agent, an active excipient, an osteoporosis drug, an anti-depressant, an anti-convulsant, an anti-Heliobactor pylori drug, a drug for treatment of neurodegenerative disease, a drug for treatment of degenerative liver disease, an antibiotic, and a cholesterol lowering formulation. In one embodiment, the product is used to treat a condition selected from the group consisting of: chronic inflammation, acute inflammation, gastrointestinal disorder, cancer, cachexia, cardiac restenosis, neurodegenerative disorder, degenerative disorder of the liver, blood lipid disorder, osteoporosis, osteoarthritis, autoimmune disease, preeclampsia, preterm birth, age related maculopathy, pulmonary disorder, and peroxisomal disorder.

(101) In some embodiments of the invention, the PUFAs produced by the genetically modified organisms or the methods disclosed in the present invention can be incorporated into a component of food or feed (e.g., a food supplement). Types of food products into which the PUFAs can be incorporated according to the present invention are not particularly limited, and include food products such as fine bakery wares, bread and rolls, breakfast cereals, processed and unprocessed cheese, condiments (ketchup, mayonnaise, etc.), dairy products (milk, yogurt), puddings and gelatine desserts, carbonated drinks, teas, powdered beverage mixes, processed fish products, fruit-based drinks, chewing gum, hard confectionery, frozen dairy products, processed meat products, nut and nut-based spreads, pasta, processed poultry products, gravies and sauces, potato chips and other chips or crisps, chocolate and other confectionery, soups and soup mixes, soya based products (milks, drinks, creams, whiteners), vegetable oil-based spreads, and vegetable-based drinks.

(102) Examples of feedstuffs into which the PUFAs produced in accordance with the present invention maybe incorporated include, for instance, pet foods such as cat foods, dog foods and the like, feeds for aquarium fish, cultured fish or crustaceans, etc., feed for farm-raised animals (including livestock and further including fish or crustaceans raised in aquaculture). The PUFA containing genetically modified organisms produced in accordance with the present invention, such as the genetically modified microorganisms, may be incorporated directly into feed products.

(103) General Definitions and Guidance

(104) According to the present invention, an isolated protein or nucleic acid is a protein or nucleic acid that has been substantially separated, produced apart from or purified away from other biological components in the cell of the organism in which the protein or the nucleic acids naturally occurs. Isolated effects a chemical or functional change in the protein or nucleic acid (e.g., a nucleic acid may be isolated from a chromosome by breaking chemical bonds connecting the nucleic acid to the remaining DNA in the chromosome). Nucleic acid molecules and proteins that have been isolated include nucleic acid molecules and proteins purified by standard purification methods. Isolated does not reflect the extent to which the protein or nucleic acid has been purified. The term also embraces nucleic acids and proteins prepared by recombinant expression in a host cell, as well as chemically-synthesized nucleic acid molecules, proteins, and pqttides. As used herein, the term nucleic acid molecule may refer to a polymeric form of nucleotides, which may include both sense and anti-sense strands of RNA, cDNA, genomic DNA, and synthetic forms and mixed polymers of the above. A nucleotide may refer to a ribonucleotide, deoxyribonucleotide, or a modified form of either type of nucleotide. A nucleic acid molecule as used herein is synonymous with nucleic acid and polynucleotide. A nucleic acid molecule is usually at least 10 bases in length, unless otherwise specified. The term includes single- and double-stranded forms of DNA. A nucleic acid molecule can include either or both naturally occurring and modified nucleotides linked together by naturally occurring and/or non-naturally occurring nucleotide linkages.

(105) According to the present invention, a recombinant nucleic acid is a nucleic acid that is constructed by joining two or more nucleic acid molecules and that can replicate in a living cell. One embodiment of the present invention includes a recombinant nucleic acid molecule comprising a recombinant vector and a nucleic acid sequence described above. Such nucleic acid sequence encodes a protein or peptide having a biological activity of any of the EF-X proteins described above. According to the present invention, a recombinant vector is an engineered (i.e., artificially produced) nucleic acid molecule that is used as a tool for manipulating a nucleic acid sequence of choice and for introducing such a nucleic acid sequence into a host cell. The recombinant vector is therefore suitable for use in cloning, sequencing, and/or otherwise manipulating the nucleic acid sequence of choice, such as by expressing and/or delivering the nucleic acid sequence of choice into a host cell to form a recombinant cell. Such a vector typically contains heterologous nucleic acid sequences, that is nucleic acid sequences that are not naturally found adjacent to nucleic acid sequence to be cloned or delivered, although the vector can also contain regulatory nucleic acid sequences (e.g., promoters, untranslated regions) which are naturally found adjacent to nucleic acid molecules of the present invention or which are useful for expression of the nucleic acid molecules of the present invention (discussed in detail below). The vector can be either RNA or DNA, either prokaryotic or eukaryotic, and typically is a plasmid. The vector can be maintained as an extrachromosomal element (e.g., a plasmid) or it can be integrated into the chromosome of a recombinant organism (e.g., a microbe or a plant). The entire vector can remain in place within a host cell, or under certain conditions, the plasmid DNA can be deleted, leaving behind the nucleic acid molecule of the present invention. The integrated nucleic acid molecule can be under chromosomal promoter control, under native or plasmid promoter control, or under a combination of several promoter controls. Single or multiple copies of the nucleic acid molecule can be integrated into the chromosome. A recombinant vector of the present invention can contain at least one selectable marker.

(106) In one embodiment, a recombinant vector used in a recombinant nucleic acid molecule of the present invention is an expression vector. As used herein, the phrase expression vector is used to refer to a vector that is suitable for production of an encoded product (e.g., a protein of interest). In this embodiment, a nucleic acid sequence encoding the product to be produced (e.g., a PUFA PKS domain or protein) is inserted into the recombinant vector to produce a recombinant nucleic acid molecule. The nucleic acid sequence encoding the protein to be produced is inserted into the vector in a manner that operatively links the nucleic acid sequence to regulatory sequences in the vector that enable the transcription and translation of the nucleic acid sequence within the recombinant host cell.

(107) In another embodiment, a recombinant vector used in a recombinant nucleic acid molecule of the present invention is a targeting vector. As used herein, the phrase targeting vector is used to refer to a vector that is used to deliver a particular nucleic acid molecule into a recombinant host cell, wherein the nucleic acid molecule is used to delete, inactivate, or replace an endogenous gene or portion of a gene within the host cell or microorganism (i.e., used for targeted gene disruption or knock-out technology). Such a vector may also be known in the art as a knock-out vector. In one aspect of this embodiment, a portion of the vector, but more typically, the nucleic acid molecule inserted into the vector (i.e., the insert), has a nucleic acid sequence that is homologous to a nucleic acid sequence of a target gene in the host cell (i.e., a gene which is targeted to be deleted or inactivated). The nucleic acid sequence of the vector insert is designed to associate with the target gene such that the target gene and the insert may undergo homologous recombination, whereby the endogenous target gene is deleted, inactivated, attenuated (i.e., by at least a portion of the endogenous target gene being mutated or deleted), or replaced. The use of this type of recombinant vector to replace an endogenous Schizochytrium gene, for example, with a recombinant gene has been previously described by the present inventors, and the general technique for genetic transformation of Thraustochytrids is described in detail in U.S. Pat. No. 7,001,772.

(108) As used herein, the term lipid includes phospholipids; free fatty acids; esters of fatty acids; triacylglycerols; diacylglycerides; monoacylglycerides; lysophospholipids; soaps; phosphatides; waxes (esters of alcohols and fatty acids); sterols and sterol esters; carotcnoids; xanthophylls (e.g., oxycarotcnoids); hydrocarbons; and other lipids known to one of ordinary skill in the art.

(109) Reference to a particular protein from a specific organism or to a particular protein being derived from a specific organism, such as a TE2 derived from Schizochytrium sp. ATCC-20888 or Sz-TE2, by way of example, refers to a TE2 (including a homologue of the naturally occurring TE2) from a Schizochytrium sp. ATCC-20888 or a Sz-TE2 that has been otherwise produced from the knowledge of the structure (e.g., sequence) of a naturally occurring TE2 from Schizochytrium. In other words, a Sz-TE2 includes any TE2 that has the structure and function of a naturally occurring TE2 from Schizochytrium or that has a structure and function that is sufficiently similar to a TE2 from Schizochytrium such that the TE2 is a biologically active (i.e., has biological activity) homoiogue of a naturally occurring TE2 from Schizochytrium sp. As such, a Sz-TE2 can include purified, partially purified, recombinant mutated/modified and synthetic proteins.

(110) According to the present invention, the terms modification and mutation can be used interchangeably, particularly with regard to the modifications/mutations to the primary amino acid sequences of a protein or peptide (or nucleic acid sequences) described herein. The term modification can also be used to describe post-translational modifications to a protein or peptide including, but not limited to, methylation, farnesylation, carboxymethylation, geranyl geranylation, glycosylation, phosphorylation, acetylation, myristoylation, prenylation, palmitation, and/or amidation. Modifications can also include, for example, complexing a protein or peptide with another compound. Such modifications can be considered to be mutations, for example, if the modification is different than the post-translational modification that occurs in the natural, wild-type protein or peptide.

(111) As used herein, the term homologue is used to refer to a protein or peptide which differs from a naturally occurring protein or peptide (i.e., the prototype or wild-type protein) by one or more minor modifications or mutations to the naturally occurring protein or peptide, but which maintains the overall basic protein and side chain structure of the naturally occurring form (i.e., such that the homologue is identifiable as being related to the wild-type protein). Such changes include, but are not limited to: changes in one or a few (e.g., 1% or less) amino acid side chains; changes in one or a few (e.g., 1% or less) amino acids, including deletions (e.g., a truncated version of the protein or peptide) insertions and/or substitutions; changes in stereochemistry of one or a few (e.g., 1% or less) atoms; and/or minor derivatizations, including but not limited to: methylation, farnesylation, geranyl geranylation, glycosylation, carboxymethylation, phosphorylation, acetylation, myristoylation, prenylation, palmitation, and/or amidation. A homologue can have either enhanced, decreased, or substantially similar properties as compared to the naturally occurring protein or peptide. Preferred homologues of a protein are described in detail below. It is noted that homologues can include synthetically produced homologues, naturally occurring allelic variants of a given protein or domain thereof, or homologous sequences from organisms other than the organism from which the reference sequence was derived.

(112) Conservative substitutions typically include substitutions within the following groups: glycine and alanine; valine, isoleucine and leucine; aspartic acid, glutamic acid, asparagine, and glutamine; serine and threonine; lysine and arginine; and phenylalanine and tyrosine. Substitutions may also be made on the basis of conserved hydrophobicity or hydrophilicity (Kyte and Doolittle, J. Mol. Biol. 157:105 (1982)), or on the basis of the ability to assume similar polypeptide secondary structure (Chou and Fasman, Adv. Enzymol. 47: 45 (1978)).

(113) Homologues can be the result of natural allelic variation or natural mutation. A naturally occurring allelic variant of a nucleic acid encoding a protein is a gene that occurs at essentially the same locus (or loci) in the genome as the gene which encodes such protein, but which, due to natural variations caused by, for example, mutation or recombination, has a similar but not identical sequence. Allelic variants typically encode proteins having similar activity to that of the protein encoded by the gene to which they are being compared. One class of allelic variants can encode the same protein but have different nucleic acid sequences due to the degeneracy of the genetic code. Allelic variants can also comprise alterations in the 5 or 3 untranslated regions of the gene (e.g., in regulatory control regions). Allelic variants are well known to those skilled in the art.

(114) Homologues can be produced using techniques known in the art for the production of proteins including, but not limited to, direct modifications to the isolated, naturally occurring protein, direct protein synthesis, or modifications to the nucleic acid sequence encoding the protein using, for example, classic or recombinant DNA techniques to effect random or targeted mutagenesis.

(115) Modifications or mutations in protein homologues, as compared to the wild-type protein, either increase, decrease, or do not substantially change, the basic biological activity of the homologue as compared to the naturally occurring (wild-type) protein. In general, the biological activity or biological action of a protein refers to any function(s) exhibited or performed by the protein that is ascribed to the naturally occurring form of the protein as measured or observed in vivo (i.e., in the natural physiological environment of the protein) or in vitro (i.e., under laboratory conditions). Biological activities of PUFA PKS systems and the individual proteins/domains that make up a PUFA synthase system have been described in detail elsewhere herein and in the referenced patents and applications.

(116) Modifications of a protein, such as in a homologue, may result in proteins having the same biological activity as the naturally occurring protein, or in proteins having decreased or increased biological activity as compared to the naturally occurring protein. Modifications which result in a decrease in protein expression or a decrease in the activity of the protein, can be referred to as inactivation (complete or partial), down-regulation, or decreased action (or activity) of a protein. Similarly, modifications which result in an increase in protein expression or an increase in the activity of the protein, can be referred to as amplification, overproduction, activation, enhancement, up-regulation or increased action (or activity) of a protein. It is noted that general reference to a homologue having the biological activity of the wild-type protein does not necessarily mean that the homologue has identical biological activity as the wild-type protein, particularly with regard to the level of biological activity. Rather, a homologue can perform the same biological activity as the wild-type protein, but at a reduced or increased level of activity as compared to the wild-type protein. A functional domain of a protein is a domain (i.e., a domain can be a portion of a protein) that is capable of performing a biological function (i.e., has biological activity).

(117) As used herein, the term biologically active fragment refers to a portion of a protein which such fragment maintains at least part of the biological activity of the protein. For example, the biological active fragment of TE2 is a portion of TE2 and it maintains at least part of the biological activity of TE2 which enhances the enzymatic activity of PUFA synthase in the host cell where TE2 is exogenously expressed.

(118) The term PUFA synthase as used herein refers to an enzyme that produces PUFAs (e.g., LCPUFAs), as well as a domain of such an enzyme. Some specific PUFA synthases are designated herein by an additional notation (e.g., Schizochytrium 20888 PUFA synthase). The term PUFA synthase system refers to one or more PUFA synthase(s) and any accessory enzyme that can affect the function of the PUFA synthase (e.g., a PPTase). For example, the PUFA synthase system in Schizochytrium 20888 consists of the native PUFA synthase subunits and the native PPTase.

(119) As used herein, the term transformation or transduction refers to the transfer of one or more nucleic acid molecule(s) into a cell. A cell is transformed by a nucleic acid molecule transduced into the cell when the nucleic acid molecule becomes stably replicated by the cell, either by incorporation of the nucleic acid molecule into the cellular genome, or by episomal replication. As used herein, the term transformation encompasses all techniques by which a nucleic acid molecule can be introduced into such a cell.

(120) The term sequence identity or identity, as used herein in the context of two nucleic acid or polypeptide sequences, may refer to the residues in the two sequences that are the same when aligned for maximum correspondence over a specified comparison window.

(121) As used herein, the term percentage of sequence identity may refer to the value determined by comparing two optimally aligned sequences (e.g., nucleic acid sequences, and amino acid sequences) over a comparison window, wherein the portion of the sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleotide or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the comparison window, and multiplying the result by 100 to yield the percentage of sequence identity.

(122) Methods tor aligning sequences for comparison are well-known in the art. Various programs and alignment algorithms are described in, for example: Smith and Waterman (1981) Adv. Appl. Math. 2:482; Needleman and Wunsch (1970) J. Mol. Biol. 48:443; Pearson and Lipman (1988) Proc. Natl. Acad. Set. U.S.A. 85:2444; Higgins and Sharp (1988) Gene 73:237-44; Higgins and Sharp (1989) CABIOS 5:151-3; Corpet et al. (1988) Nucleic Acids Res. 16:10881-90; Huang et al. (1992) Comp. Appl. Biosci. 8:155-65; Pearson et al. (1994) Methods Mol. Biol. 24:307-31; Tatiana et al. (1999) FEMS Microbiol. Lett. 174:247-50. A detailed consideration of sequence alignment methods and homology calculations can be found in, e.g., Altschul et al. (1990) J. Mol. Biol. 215:403-10.

(123) The National Center for Biotechnology Information (NCBI) Basic Local Alignment Search Tool (BLAST?; Altschul et al. (1990)) is available from several sources, including the National Center for Biotechnology Information (Bethesda, Md.), and on the internet, for use in connection with several sequence analysis programs. A description of how to determine sequence identity using this program is available on the internet under the help section for BLAST?. For comparisons of nucleic acid sequences, the Align two or more sequences function of the BLAST? (blastn) program may be employed using the default parameters. For comparisons of protein sequences, the Align two or more sequences function of the BLAST? (blastp) program may be employed using the default parameters. As used herein, hybridization conditions refer to standard hybridization conditions under which nucleic acid molecules are used to identify similar nucleic acid molecules. Such standard conditions are disclosed, for example, in Sam brook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Labs Press (1989). Sambrook et al., ibid., is incorporated by reference herein in its entirety (see specifically, pages 9.31-9.62). In addition, formulae to calculate the appropriate hybridization and wash conditions to achieve hybridization permitting varying degrees of mismatch of nucleotides are disclosed, for example, in Metnkoth et al., Anal. Biochem. 138, 267 (1984); Meinkoth et al., ibid., incorporated by reference herein in its entirety.

(124) More particularly, moderate stringency hybridization and washing conditions, as referred to herein, refer to conditions which permit isolation of nucleic acid molecules having at least about 70% nucleic acid sequence identity with the nucleic acid molecule being used to probe in the hybridization reaction (i.e., conditions permitting about 30% or less mismatch of nucleotides). High stringency hybridization and washing conditions, as referred to herein, refer to conditions which permit isolation of nucleic acid molecules having at least about 80% nucleic acid sequence identity with the nucleic acid molecule being used to probe in the hybridization reaction (i.e., conditions permitting about 20% or less mismatch of nucleotides). Very high stringency hybridization and washing conditions, as referred to herein, refer to conditions which permit isolation of nucleic acid molecules having at feast about 90% nucleic acid sequence identity with the nucleic acid molecule being used to probe in the hybridization reaction (i.e., conditions permiuing about 10% or less mismatch of nucleotides). As discussed above, one of skill in the art can use the formulae in Meinkoth et al., ibid, to calculate the appropriate hybridization and wash conditions to achieve these particular levels of nucleotide mismatch. Such conditions will vary, depending on whether DNA:RNA or DNA:DNA hybrids are being formed. Calculated melting temperatures for DNA:DNA hybrids are 10? C. less than for DKArRNA hybrids. In particular embodiments, stringent hybridization conditions for DNA:DNA hybrids include hybridization at an ionic strength of 6? SSC (0.9 M Na.sup.+) at a temperature of between about 20? C. and about 35? C. (lower stringency), more preferably, between about 28? C. and about 40? C. (more stringent), and even more preferably, between about 35? C. and about 45? C. (even more stringent), with appropriate wash conditions. In particular embodiments, stringent hybridization conditions for DNA:RNA hybrids include hybridization at an ionic strength of 6? SSC (0.9 M Na.sup.+) at a temperature of between about 30? C. and about 45? C., more preferably, between about 38? C. and about 50? C., and even more preferably, between about 45? C. and about 55? C., with similarly stringent wash conditions. These values are based on calculations of a melting temperature for molecules larger than about 100 nucleotides, 0% formamide and a G+C content of about 40%. Alternatively, T.sub.m can be calculated empirically as set forth in Sambrook et al., supra, pages 9.31 to 9.62. In general, the wash conditions should be as stringent as possible, and should be appropriate for the chosen hybridization conditions. For example, hybridization conditions can include a combination of salt and temperature conditions that are approximately 20-25? C. below the calculated T.sub.m of a particular hybrid, and wash conditions typically includes combination of salt and temperature conditions that are approximately 12-20? C. below the calculated T.sub.m of the particular hybrid. One example of hybridization conditions suitable for use with DNA:DNA hybrids includes a 2-24 hour hybridization in 6? SSC (50% formamide) at about 42? C., followed by washing steps that include one or more washes at room temperature in about 2? SSC, followed by additional washes at higher temperatures and lower ionic strength (e.g., at least one wash as about 37? C. in about 0.1?-0.5? SSC, followed by at least one wash at about 68? C. in about 0.1?-0.5? SSC).

(125) Each publication, patent or patent application referenced herein is incorporated herein by reference in its entirety.

(126) The following examples are provided for the purpose of illustration and are not intended to limit the scope of the present invention.

EXAMPLES

Example 1

(127) The following example describes the development of an assay used to identify factors which may enhance the enzymatic activity of PUFA synthases.

(128) This in vitro assay was developed to identify any factors present in homogenates of cells of Schizochytrium 20888, which could facilitate the activity of a PUFA synthase system. The assay was based on an observation that addition of an extract derived from a strain of Schizochytrium 20888 to a homogenate of E. coli expressing the Schizochytrium 20888 PUFA synthase (plus HetI) resulted in an increase in the in vitro activity of that PUFA synthase system (see the left two samples of FIG. 2, i.e., BUFF K and Q-KO). The general features of this assay are described below.

(129) Preparation of homogenates of an E. coli strain expressing the Schizochytrium 20888 PUFA synthase for use in the PUFA synthase enhancement assay: the Schizochytrium 20888 PUFA synthase subunits and HetI (from Nostoc sp.) were expressed in E. coli strain JK824 as described in Hauvermale et al., 2008, Lipids, 41:739-747 and Metz et al., US Patent Application Publication No. 2013-0150599. The PUFA synthase subunit genes were expressed as a synthetic operon under control of the T7 promoter system while HetI was expressed constitutively on a separate plasmid. For biochemical assays, strain JK824 was typically grown in Luria Broth supplemented with 10% glycerol at 30? C. to an CD. (600 nm) of ?1 and then Isopropyl ?-D-1-thiogalactopyranoside (IPTG) was added (to a final concentration of 1 mM) to induce the production of the T7 polymerase. Approximately 4 hrs after induction, the cells were harvested, washed and resuspended in Buffer KE (Buffer K ?50 mM NaPO.sub.4, pH 6.8 with 10% glycerolwhich also contained 1 mM EDTA and 2 mM dithioerytheitol). The cells were ruptured by passage through a French Pressure Cell (16,000 psi) and the homogenate separated into aliquots and stored at ?80? C. for use in the PUFA synthase activity enhancement assay.

(130) In vitro PUFA synthase activity enhancement assays: The in vitro PUFA synthase assay involves measurement of radioactivity, from .sup.14C labeled malonyl-CoA, incorporated into DHA and DPAn-6. The general characteristics of a PUFA synthase assay are described in Metz et al. 2009, Plant Physiology and Biochemistry 47:472-478. The typical enhancement assay had a final volume of 100 ?Lconsisting of 40 ?L of the homogenate derived from E. coli strain JK824 (described above), 40 uL of a sample to be evaluated (e.g., homogenates of Schizochytrium strains, or chromatographic fractions) and 10 ?L of reaction cocktail (containing a mixture of cold and [2.sup.14C]-malonyl-CoA and NADPH). The JK824 homogenate and the sample to be evaluated were mixed just prior to addition of the reaction cocktail The components of the reaction cocktail were adjusted so that the final concentrations of malonyl-CoA and NADPH in the assay were 50 ?M and 2 mM, respectively. Buffer K served as the negative control for the enhancement, of activity and was also used to adjust the volume of the samples being evaluated to 40 ?L when less than that amount was being tested. The assay reactions were carried out in glass tubes in a room temperature (?21? C.) water bath. The time of incubation was dependent on the experimental requirements.

(131) The in vitro assay products of the Schizochytrium 20888 PUFA synthase are free fatty acids (Metz et al., 2009, Plant Physiology and Biochemistry 47:472 478). The incorporation of radioactivity into these free fatty acids was routinely measured by extraction with organic solvents and lipid class separation on TLC plates. Occasionally the extracted lipids were converted to FAMEs prior to separation on TLC plates to confirm that DHA and DPAn-6 were the primary fatty acids being labeled in the assay. The in vitro assay reactions were stopped by one of two methods depending on the work-up protocol. For conversion of fatty acids to fatty acid methyl-esters (FAMEs) using an acidic method, the reaction was stopped by adding the FAME reagent (see below). For extraction of lipids without derivatization, the reaction was stopped by addition of 125 ?L of isopropanol:acetic acid (4:1 v/v) (see below).

(132) Acidic FAME protocol: the reaction was stopped by adding 2.0 mL of 4% HCl in methanol plus 50 ?L toluene, the glass tubes were sealed with Teflon lined caps and heated at 100? C. for 1 hr. The reaction was cooled to room temperature, then 1.0 mL of hexane and 0.5 mL water was added, further vortexed then left to separate. If desired, a portion can be removed for liquid scintillation counting (LSC). An aliquot of ?600 ?L of organic phase was transferred to a new tube and the solvent was removed under N.sub.2. The residue was dissolve in 50 ?L hexane and spotted onto either Silica gel 60 A TLC plates (develop with hexane:diethyl-ether:acetic acid70:30:2) or Silica Gel G plates soaked in 10% AgNO.sub.3/90% acetonitrile (activated for 30 min at 100? C. prior to use) (developed w/ hexane:diethyl-ether/acetic acid70:20:2). The plates were left to air dry and radioactive areas were detected using phosphorimaging technology.

(133) HIP protocolextraction of underivatized lipids: As indicated above, the reaction was stopped by adding 125 ?L of isopropanohicetic acid (4:1 v/v) then adding 2 mL of hexane:isopropanol (3:2, v/v), further vortexed then 1 mL of 6.7% (w/v) sodium sulfate was added and vortexed again. The phases were left to separate. If desired, a portion of the organic (upper) phase was transferred for LSC then the rest (?1.0 mL) was transferred to a new tube. The solvent was remove with N.sub.2 gas and the residue was dissolved in 50 ?L of hexane. The sample was spotted on a silica gel 60 A TLC plate and developed with hexane:diethyl-ether:acetic acid (70:30:2). The plates were let air dry and radioactive areas were detected using phosphorimaging technology.

(134) Assay for identifying PUFA synthase enhancing factor proteins: for the PUFA synthase enhancement assay, extracts derived from one of several Schizochytrium strains were combined with the above mentioned E. coli extract prior to addition of the .sup.14C labeled malonyl-CoA and NADPH. Reactions in which the extraction buffer solution was combined with the E. coli material instead of the cell extracts served as negative controls. Several strains were used for these experiments.

Example 2

(135) The following example describes the strains, derived from Schizochytrium 20888, that were utilized to develop the in vitro PUFA synthase enhancement assay and to identify the enhancing factors.

(136) Quad K-O: Quad-KO is a Schizochytrium 20888 strain in which the three PUFA synthase summit open reading frames (Orfs) and the FAS Orf were deleted and replaced with antibiotic resistance gene cassettes. This strain was created using the methods described in Hauvermale et al., 2008, Lipids, 41: 739-747, Metz et al., 2009, Plant Physiology and Biochemistry 47:472-478, and Roessler et al., 2006, U.S. Pat. No. 7,001,772. The Quad-KO strain requires supplementation of the media with both saturated and long chain polyunsaturated fatty acids for growth. Homogenates of this strain do not have the ability to incorporate radioactivity from .sup.14C malonyl-CoA into fatty acids that are readily extracted by organic solvents. Extracts from this strain were used to establish the initial parameters for chromatographic enrichment of factors responsible for enhancement of PUFA synthase activity in the in vitro assays.

(137) AC66: The cell wall of Schizochytrium 20888 is difficult to disrupt thus making preparation of cell-free homogenates challenging. AC66 is a strain of Schizochytrium 20888 that was selected after chemical mutagenesis based on colony morphology and was subsequently found to be easily disrupted by sonication. The fatty acid profile and oil accumulation properties of strain AC66 are very similar to those of its parent. The ease of cell disruption by sonication greatly simplifies preparation of cell-free homogenates for biochemical work.

(138) AC66/DGAT KO: AC66/DGAT KO is a strain derived from AC66 in which a gene encoding a particular diacyl glycerol acyltransferase in Schizochytrium 20888 has been inactivated (described in Metz et al., 2013, US Patent Application Publication No. 2013-0150599, referred to in that patent as DAGAT-1). This strain, while prototrophic, does not accumulate significant amounts of oil. The lack of oil simplifies biochemical analysis and the initial steps of chromatographic enrichments of the PUFA synthase enhancing factors.

Example 3

(139) The following example describes a procedure for chromatographic enrichment of the PUFA synthase in vitro activity enhancing factor(s) (EF-X) from extracts derived from strains of Schizochytrium 20888. It was determined subsequently by the experiments described in Example 4 that EF-X from extracts derived from strains of Schizochytrium 20888 actually contains two enhancing factors: Sz-TE2 and Sz-TE3.

(140) Several chromatographic matrixes were tested for utility in enrichment of the EF-X. Initial testing was done using extracts from the Quad-KO strain since it lacks the FAS and PUFA synthase activities that could confound the enhancement assay. It was subsequently discovered that, by use of appropriate conditions, the EF-X activity present in cell free extracts of Schizochytrium 20888 could be cleanly separated from both the FAS and PUFA synthase activities by use of a Mimetic Blue A SA column. The starting material used for the example described below was derived from the AC66/DGAT-KO strain of Schizochytrium 20888.

(141) Cell free homogenate preparation: Cells of the AC66/DGAT-KO strain were grown to mid-log phase, harvested by centrifugation, resuspended in Buffer K (50 mM NaPO.sub.4, pH 6.8 with 10% glycerol) and lysed by sonication. The homogenate was centriruged (100,000?g?1 hr) and the supernatant collected and passed through a 0.2 ?M filter to yield the starting material (S100F) used for chromatography.

(142) Mimetic Blue SA chromatography: A Mimetic Blue SA matrix (Blue SA) was used for the initial chromatographic step. Approximately 50 mL of S100F was loaded onto a 10 mL column which had been equilibrated with Buffer K. The column was washed with Buffer K and then with Buffer K containing 0.24 M NaCl. Bound EF-X activity was eluted by a linear salt gradient (from 0.24 M to 2 M NaCl over 40 mL). Fractions (5 mL) were collected and assayed. Those with the highest EF-X activity (in the middle portion of the gradient) were pooled and taken to the next step.

(143) Hydrophobic Interaction Chromatography (HIC): A portion (10 mL) of the pooled material from the Blue SA column was loaded directly on to a 1 mL HiTrap Phenyl-FF cartridge (GE HealthCare) which had been equilibrated with Buffer K containing 2 M NaCl. After washing with equilibration buffer, the bound EF-X activity was eluted using a 10 column volume reverse salt gradient (2 M to 0 M NaCl in Buffer K). Active fractions from multiple runs were pooled for the next step. The column was cleaned with 0.5 M NaOH between the runs.

(144) Cation exchange chromatography: Pooled fractions from the HIC step were concentrated and desalted using ultrafiltration spin columns. A portion (2 mL) of the desalted material was loaded onto a 1 mL UNO-S cation exchange column (Bio-Rad) which had been equilibrated with Buffer K. After washing with Buffer K, the bound EF-X activity was eluted using a 10 column volume salt gradient (0 M to 1 M NaCl in Buffer K). Fractions (0.5 mL) were collected and EF-X activity assayed.

(145) Size exclusion chromatography: Two fractions from the cation exchange column with the highest EF-X activity were combined then concentrated and desalted using ultrafiltration spin columns. A portion (500 ?L) of this material was loaded on to a SuperDex 200 column (GE Health Care) which had been equilibrated with Buffer K. The EF-X activity was retained by the matrix and eluted as a single peak with an apparent molecular mass, estimated by comparison to protein standards of from 40 to 80 kDa. SDS-PAGE analysis (with silver staining of the gel) revealed only a few distinct polypeptide bands in the fractions with EF-X activityand only three bands whose staining intensity appeared to correlate with the activity detected in those same fractions. The molecular masses of these proteins were estimated to be ?80 kDa, ?37 kDa and ?17 kDa, by comparison to protein standards separated on the same gel Portions of the relevant fractions from the SuperDex 200 column were used for peptide generation and sequencing procedures. Peptide sequencing in conjunction with a Schizochytrium 20888 genome database was performed and EF-X candidates were identified.

Example 4

(146) The following example describes the procedure utilized to identify two candidate proteins for association with the enhancement of in vitro PIJFA synthase activity and the molecular characterization of those candidates.

(147) LC-MSMS (liquid chromatographytandem mass spectrometry) analysis was performed on tryptic peptides generated from fractions derived from the final chromatographic step (SuperDex 200 column separation) of Example 2. Candidate proteins for association with the Schizochytrium 20888 EF-X were identified. The method involves LC-MSMS sequencing (with a Schizochytrium 20888 genome sequence derived predicted protein database as a reference) in combination with correlation of relative peptide abundance determined by spectral counting of the LC-MSMS data with the EF-X activity assay results for each fraction. A list of 17 candidate proteins was generated. The top two candidates were identified as likely thiocsterases by BLAST analysis. Both candidates showed homology to 4-hydroxybenzoyl-CoA-like thioesterases. The predicted nucleotide sequences and the deduced amino acid translations of the two candidate Orfs are provided in the Sequence Listing and described below. The candidate proteins were termed Sz-TE2 and Sz-TE3. The Sz-TE2 protein is likely to be associated with the ?17 kDa band identified in the silver stained gel mentioned in the previous example while Sz-TE3 is likely to be associated with the ?37 kDa band. The third highest hit in the Spectral Counting list appeared to be correctly annotated in the genome database and showed very high homology to a bi-functional enzyme of the fatty acid degradation pathway. This protein is likely to be associated with the ?80 kDa identified in the silver stained gel. Follow up work was carried out with the Sz-TE2 and Sz-TE3 candidates. The molecular characteristics of the open reading frames and predicted encoded proteins are described here:

(148) Sz-TE2: The nucleotide sequence of the predicted Sz-TE2 Orf contained 411 bps (without the stop codon) and the translation encoded a 15.6 kDa protein with 137 amino acids. A BLAST analysis of the nucleotide sequence against a proprietary Schizochytrium 20888 EST database identified three matches that confirmed the entire Orf from the ATG to a TGA stop codon. The Orf nucleotide sequence is show in SEQ ID NO:5 and the translation is shown in SEQ ID NO:1. As indicated, BLAST analysis of the Sz-TE2 protein sequence reveals homology to 4-hydroxybenzoyl-CoA-like thiocsterases.

(149) Sz-TE3: The Sz-TE3 Orf annotated in the proprietary genome sequence database was predicted to encode 881 amino acids and the coding region to contain 3 introns within the overall length of the gene (start to stop) of 6,800 bp. A query of the proprietary Schizochytrium 20888 EST database with that entire sequence revealed that only the 3 portion had matches. The eight ESTs identified in the BLAST search formed a contig that included an Orf (from ATG to a TGA stop) whose sequence matched that of the genomic data. The Orf for the region confirmed by the ESTs contained 963 nucleotides (without the stop codon) which encoded a 36.6 kDa protein with 321 amino acids. The Sz-TE3 Orf nucleotide sequence is show in SEQ ID NO:6 and the translation is shown in SEQ ID NO:2. BLAST analysis of the Sz-TE3 protein sequence also reveals homology to 4-hydroxybenzoyl-CoA-like thioesterasesbut in this case there are two similar regions: i.e., two adjacent regions, both with homology to the 4-hydroxybenzoyl-CoA-like thioesterases.

Example 5

(150) The following example describes the verification that candidate proteins, Sz-TE2 and Sz-TE3, are indeed associated with enhancement of in vitro Schizochytrium 20888 PUFA synthase activity and suggest that they have optimal activity when expressed together.

(151) Construction of E. coli expression plasmids containing Sz-TE2 and Sz-TE3: The Orfs encoding Sz-TE2 and Sz-TE3 were cloned separately and together into two Novagen Duet vectors: pETDuet? (carrying the Amp resistance marker) and pCOLADuet? (carrying the Kan resistance marker). In both cases, the Sz-TE2 Orf was cloned into the MCS-2 and the Sz-TE3 was cloned into the MCS-1. The final nucleotide sequences Orfs for both Orfs in the constructs were identical to the native sequences. The Novagen Duet plasmids utilize the T7 expression system and require host cell lines containing an inducible T7 polymerase, e.g., BLR(DE3) or BL21(DE3). IPTG (0.5 mM) was used to induce expression of the genes.

(152) Expression of Sz-TE2 and Sz-TE3 in E. colitesting for protein solubility: A test of solubility of the Sz-TE2 and Sz-TE3 proteins in E. coli was carried out by expressing the proteins, either separately or together, collecting the induced cells and using the Novagen BugBuster? reagent and centrifugation protocol to separate soluble proteins from cell debris and non-soluble proteins. Samples of the whole cells and the soluble and non-soluble fractions were treated with SDS and analyzed by SDS-PAGE. A Coomassie Blue stained gel in which the proteins present in whole cells and the soluble and non-soluble fractions from the several E. coli strains had been separated was examined. This revealed that a well stained protein hand associated with Sz-TE2 was present in the soluble fractions both when expressed by itself and when co-expressed with Sz-TE3. In contrast, when Sz-TE3 was expressed by itself, very little protein was detected in the soluble fraction while a prominent band was present in the non-soluble fraction. When Sz-TE3 was co-expressed with Sz-TE2, the majority of the Sz-TE3 protein was now detected in the soluble fraction. These data suggest an interaction between Sz-TE3 and Sz-TE2 which increases the solubility of Sz-TE3. They also indicate that determination of the activity of Sz-TE3 when expressed by itself in this particular E. coli system may be compromised by its lack of solubility.

(153) Use of E. coli expressed Sz-TE2 and Sz-TE3 in the PUFA synthase activity enhancement assay: The Orfs encoding Schizochytrium 20888 EF-X candidates Sz-TE2 and Sz-TE3 were cloned separately and together into Novagen Duet vectors as described above. E. coli strains containing the TE constructs were grown in LB medium at 32? C. Expression was induced by addition of IPTG and the incubation continued tor 3 to 5 hours. Cells were collected by centrifugation and resuspended in Buffer K (50 mM NaPO.sub.4 pH 6.8, 10% glycerol) and lysed using a French Pressure cell (16,000 psitwo passes). Aliquots of the homogenates were either stored directly, or centrifuged (20,000?g?20 mm) to yield a supernatant fraction (S20) before being aliquoted and stored at ?80? C. The homogenates and supernatant fractions were diluted 6? in Buffer K prior to being combined with the separatciy prepared homogenate of JK824 (expressing the Schizochytrium 20888 PUFA synthase genes and HetI) for the enhancement assay. In some assays, equal volumes of extracts from strains expressing Sz-TE2 or Sz-TE3 were combinedif tested alone. Buffer K was used to equalize the volumes. The reactions are started by addition of .sup.14C-malonyl CoA plus NADPH and run for 20 to 30 min at room temperature (?21? C.) then stopped by addition of isopropanol/acetic acid. Neutral lipids were extracted using a hexane/isopropanol solution and separated by normal phase TLC (Metz et al., 2009, Plant Physiology and Biochemistry, 47:472-478). FIG. 1 shows the results of the activity assays when the extracts (homogenates or supernatant fractions) from these strains, or Buffer K, were combined with extracts from JK824. 2H and 3H refer to Sz-TE2 and Sz-TE3, respectively, in homogenates fractions. 2S and 3S refer to Sz-TE2 and Sz-TE3, respectively, in supernatant fractions. The data in the figure indicate that while the addition of Sz-TE2 or Sz-TE3 alone did not enhance the PUFA synthase activity, significant enhancement (6 to 9 fold) was obtained when they were combined. Additionally, the enhancing effect was observed with both the homogenate and the supernatant fractions. These results confirm that the candidates. Sz-TE2 and Sz-TE3, are indeed associated with the EF-X activity and that both are likely to be required for that activity.

Example 6

(154) The following example describes the effects of inactivation of the Sz-TE2 or Sz-TE3 genes in the Quad-KO strain of Schizochytrium 20888 on the EF-X activity in extracts derived from those strains. The results indicate that the Sz-TE2 and Sz-TE3 genes encode the primary factors associated with the in vitro PUFA synthase enhancing activity in extracts of Schizochytrium 20888.

(155) Construction of Sz-TE2 and Sz-TE3 KO plasmid cassettes: The in vitro PUFA synthase enhancing activity was originally characterized by combining extracts from E. coli with extracts prepared from the Quad-KO strain of Schizochytrium 20888. In this strain, the genes encoding the FAS protein and the three subunits of the PUFA synthase were inactivated by replacement of the coding regions with antibiotic resistance cassettes. For inactivation of the SzTE genes in the Quad-KO strain, plasmids were constructed in which the coding regions of either the Sz-TE2 or Sz-TE3 were replaced with another antibiotic resistance cassette (paromomycin). Transformation of the Quad-KO strain was carried out using the Biolistic system (Roessler et al., 2006 U.S. Pat. No. 7,001,772) and paromomycin resistant colonies were selected on plates supplemented with both short chain saturated fatty acids and with DHA. The structures of the Sz-TE2 and Sz-TE3 loci in the putative KO strains were verified by sequencing of cloned PCR fragments generated by using primers targeted to regions outside of the DNA flanking used in the transformation cassettes. Two independent transformants for each of the Sz-TE2 and Sz-TE3 KOs were grown in liquid medium, the cells collected by centrifugation and resuspended in Buffer K. Cell homogenates were prepared by shaking with glass beads which were then separated from the homogenates by filtration. The homogenates were then centrifuged (20,000?g?10 min) to yield a fraction (S20) that was used in the in vitro PUFA synthase activity enhancement assay. FIG. 2 shows the results of the those assays along with the activity of the E. coli extract itself (combined with Buffer K) and a sample in which a S20 fraction from the parent Quad-KO strain has been added. The addition of the Quad-KO extract resulted in an ?8-fold increase in PUFA synthase activity in the assay (a typical enhancement of activity observed with this type of extract). Use of the extracts from strains in which either the Sz-TE2 or the Sz-TE3 gene have been disrupted resulted in only a minor increase in the E. coli expressed PUFA synthase activity. These data demonstrate that Sz-TE2 and Sz-TE3 are responsible for the majority of the enhancing activities observed in extracts of Schizochytrium 20888 cells and that expression of both Sz-TE2 and Sz-TE3 genes arc needed for the appearance of the enhancing activity.

Example 7

(156) The following example describes the effects of inactivation of Sz-TE2 and Sz-TE3 and both genes in Schizochytrium 20888. The results reveal the in vivo roles of Sz-TE2 and Sz-TE3: although DHA and DPAn-6 still accumulate in the KO strain, their levels are significantly reduced.

(157) The Sz-TE2 and Sz-TE3 proteins were identified using an in vitro PUFA synthase enhancement assay. The potential role of these proteins in PUFA production and accumulation in cells of Schizochytrium 20888 was investigated by inactivation of the corresponding genes in the wild type Schizochytrium 20888 background. Sz-TE2 and S2-TE3 KO constructs were made using the methods described above. For this experiment, the Sz-TE2 coding region was replaced with a paromomycin resistance cassette and the Sz-TE3 with a Zeocin resistance cassette. Sz-TE2 and Sz-TE3 were inactivated separately in that background to generate Sz-TE2 and Sz-TE3 KO strains. Double Sz-TE KO strains were then created bv transformation with the second KO construct. Antibiotic resistant transformants that grew on plates that were not supplemented with DHA were obtained for both the single and double KO genes. Insertional replacements of the TE genes with the antibiotic resistance cassettes for several of the KOs were confirmed by cloning and sequencing of PCR product using primers targeted to DNA regions located outside of the flanking DNA used for the KO constructs. Cells of the wild type strain as well as examples of the single and double TE KO strains were grown, collected and their fatty acid profiles determined. Table I-A shows typical fatty acid profiles, shown as the % of total FAMEs, obtained for these strains while Table I-B shows those profiles expressed as the mg of the individual FAMEs per gram of dried biomass. It can be seen that all three versions of the Sz-TE KO strains (Sz-TE2 KO, Sz-TE3 KO and the double KO) have fairly similar fatty acid profiles. Although all of the strains accumulate DHA, the amounts of that fatty acid have been significantly reduced relative to the wild type. In the example shown, DHA decreased from ?40% of total FAME in the wild type to ?34% in the TE2 KO and to ?30% in the TE3 and double KOs. The higher amount of DHA detected in the Sz-TE2 KO strain, relative to those in which Sz-TE3 has been inactivated, suggests that Sz-TE3 may have some activity on its own. Additionally, the ratio of DHA to DPAn-6 in all of the strains has been lowered, from ?2.3 in the parental strain to <2 in all of the TE KO strains. Although the DPAn-6 level, as a % of total FAME, has not been significantly altered in the KO strains, the amount producedwhen calculated as mg of DPAn-6 FAME per gram of biomass has been reduced. Although the reduction in DHA and DPAn-6 in the KO strains has been partially compensated by an increase in other fatty acids (derived from the FAS), the total mg FAME is still reduced (Table I-B). These data indicate that while the products of the PUFA synthase (DHA and DPAn-6) still accumulate in Schizochytrium 20888 strains in which the Sz-TE2 and or Sz-TE3 genes have been inactivated, the levels of those two PUFAs are higher when both genes are intact. The data provide a rationale for why DHA and DPAn-6 are observed to accumulate when the Schizochytrium 20888 PUFA synthase (along with an appropriate PPTase) is expressed in heterologous organisms and suggest that co-expression of Sz-TE2 plus Sz-TE3 may be a means to increase the accumulation in those cells.

(158) TABLE-US-00009 TABLE I-A X024-2 X024-4 20888 X022-1 X023-17 SzTE2 + SzTE2 + Fatty acid WT SzTE2 KO SzTE3 KO 3 KO 3 KO C14:0* 4.9 3.2 4.3 6.0 5.4 C16:0* 29.6 30.3 34.6 40.1 35.8 C16:1* 0.9 2.4 3.4 2.5 2.5 C18:0* 0.9 1.6 1.8 1.6 1.5 C18:1 N7 0.6 2.8 3.8 2.4 2.8 C20:5 N3* 1.0 1.5 1.1 0.9 0.9 C22:4 N9 0.7 1.4 1.3 1.0 1.1 C22:5 N6* 17.7 18.5 16.3 14.3 16.7 C22:6 N3* 40.4 34.3 29.8 27.9 29.2 DHA:DPAn6 2.3 1.9 1.8 1.9 1.7 DHA + DPAn6 58.1 52.8 46.1 42.2 45.8

(159) Table I-A shows fatty acid profilesas % of total FAMEof wild type Schizochytrium 20888 and strains in which the following genes have been inactivated by insertional mutagenesis: Sz-TE2 (X022-1) or Sz-TE3 (X023-17) or both Sz-TE2 and Sz-TE3 (X024-2 and X024-4). Only those thity acids with levels >1% of the total FAMEs are shown.

(160) TABLE-US-00010 TABLE I-B X024-2 X024-4 20888 X022-1 X023-17 SzTE2 + SzTE2 + Fatty Acid WT SzTE2 KO SzTE3 KO 3 KO 3 KO C14:0* 14.1 7.2 10.1 15.4 13.5 C16:0* 85.7 67.3 81.3 103.0 88.8 C16:1* 2.5 5.3 7.9 6.5 6.1 C18:0* 2.6 3.6 4.2 4.2 3.8 C18:1 N7 1.7 6.2 9.0 6.2 7.0 C20:5 N3* 2.9 3.3 2.7 2.4 2.3 C22:4 N9 2.0 3.2 3.0 2.6 2.6 C22:5 N6* 51.1 41.1 38.3 36.9 41.3 C22:6 N3* 116.9 76.1 70.0 71.7 72.2 Sum FAME 289.4 222.0 235.3 257.0 247.8

(161) Table I-B shows fatty acid profilesmg FAME per grain of dried biomassof wild type Schizochytrium 20888 and strains in which the following genes have been inactivated by insertional mutagenesis: Sz-TE2 (X022-1) or Sz-TE3 (X023-17) or both Sz-TE2 and Sz-TE3 (X024-2 and X024-4). Only those fatty acids listed in Table I-A are shown.

Example 8

(162) The following example describes ihe effect on fatty acid profiles of co-expression of Sz-TE2 and Sz-TE3 in E. coli expressing the Schizochytrium 20888 PUFA synthase and HetI. The data indicate that accumulation of the products or the PUFA synthase (DHA and DPAn-6) can be increased by co-expression of Sz-TE2 plus Sz-TE3.

(163) Expression of the Schizochytrium 20888 PUFA synthase subunits along with HetI in E. coli results in accumulation of DHA and DPAn-6 (see Hauvermale et al., 2008, Lipids, 41:739-747 for details). Additionally, it was determined that all of the PUFAs in those cells were in the free fatty acid form, as opposed to being esterified (e.g., as components of phospholipids). This observation was consistent with the results of in vitro activity assays of extracts from these cells; i.e., the products of the Schizochytrium 20888 PUFA synthase reactions were detected as free fatty acids. The enhancement of the free fatty acid products of the in vitro PUFA synthase activity formed the basis of the assay developed for identification of the EF-X factors. The fatty acid profiles of E. coli strains in which the Sz-TE2 and Sz-TE3 proteins were co-expressed, either separately or together, along with the Schizochytrium 20888 PUFA synthase system were also determined. E. coli strain JK824 (expressing the Schizochytrium 20888 PUFA synthase subunits and HetI) were transformed with the pCOLA? duet vector containing either Sz-TE2 (TE2) or Sz-TE3 (TE3) or both Sz-TE2+Sz-TE3 (TE2+TE3). Verified transformants were grown at 32? C. in 765 medium supplemented with 10% (wt/vol) glycerol (Hauvermale et al., 2008, Lipids, 41:739-747). The cells were harvested 20 hrs after induction with IPTG, washed with 50 mM Tris pH 7.5, freeze dried and the fatty acids converted to FAMES and analyzed by GC. The results are shown in the following Tables.

(164) TABLE-US-00011 TABLE II-A TE2 TE2 TE3 TE3 TE2 + 3 TE2 + 3 Fatty Acid JK824 JK1350 JK1351 JK1346 JK1347 JK1349 JK1348 C12:0* 5.6 5.4 5.4 5.0 5.8 4.5 5.2 C14:0* 3.6 3.8 4.1 3.3 4.2 3.1 3.8 C16:0* 17.8 18.2 20.5 17.1 19.5 15.6 17.5 C16:1* 8.1 9.4 6.2 7.5 7.3 7.5 6.2 Unknown 1 6.0 6.1 6.9 6.2 6.8 5.3 6.3 C18:1 N7 26.6 26.8 23.6 26.1 24.2 23.2 20.9 Unknown 3 5.1 4.3 7.3 6.6 5.2 5.0 5.3 Unknown 4 7.8 7.2 8.0 7.6 8.0 7.0 7.5 C22:5 N6* 4.6 5.0 3.4 4.9 4.0 6.4 5.7 C22:6 N3* 9.0 8.7 8.4 9.6 8.8 17.4 15.9 DHA + DPAn6 13.6 13.7 11.8 14.5 12.8 23.9 21.5 DHA/DPAn6 2.0 1.7 2.5 2.0 2.2 2.7 2.8

(165) Table II-A shows fatty acid profilesas % of total FAMEof E. coli strain JK824 (expressing the Schizochytrium 20888 PUFA synthase subunits and HetI) and of strains expressing either Sz-TE2 (TE2) or Sz-TE3 (TE3) or both (TE2+3) in the JK824 background. Only those fatty acids with levels >1% of the total FAMEs are shown.

(166) TABLE-US-00012 TABLE II-B TE2 TE2 TE3 TE3 TE2 + 3 TE2 + 3 Fatty Acid JK824 JK1350 JK1351 JK1346 JK1347 JK1349 JK1348 C12:0* 3.0 3.0 2.7 2.8 3.1 2.7 3.2 C14:0* 1.9 2.1 2.1 1.9 2.3 1.9 2.3 C16:0* 9.5 10.0 10.4 9.6 10.6 9.4 10.7 C16:1* 4.3 5.2 3.1 4.2 3.9 4.5 3.8 Unknown 1 3.2 3.4 3.5 3.5 3.7 3.1 3.8 C18:1 N7 14.2 14.7 11.9 14.7 13.0 13.9 12.7 Unknown 3 2.7 2.4 3.7 3.7 2.8 3.0 3.2 Unknown 4 4.2 4.0 4.0 4.2 4.3 4.2 4.6 C22:5 N6* 2.5 2.8 1.7 2.8 2.2 3.9 3.5 C22:6 N3* 4.8 4.8 4.2 5.4 4.7 10.5 9.7 Sum FAME 53.2 55.0 50.4 56.1 53.9 60.0 60.9 DHA + DPAn6 7.3 7.5 5.9 8.2 6.9 14.4 13.1

(167) Table II-B shows fatty acid profilesas mg of FAME/gram dried biomassof the E. coli strains shown in Table II-A. Only those fatty acids included in Table II-A are shown.

(168) The data in Table II-A indicate that co-expression of either Sz-TE2 or Sz-TE3 alone with the Schizochytrium 20888 PUFA synthase system in E. coli does not significantly alter the fatty acid profiles (as % of total FAME) relative to the parental strain (JK824). In contrast, expression of Sz-TE2 and Sz-TE3 together results in an approximately two-fold increase in the amount of DHA in those cells. Interestingly, there is also an increase in the amount of DPAn-6, but it is less than for DHA. resulting in an increase in the ratio of DHA to DPAn-6from ?2.0:1 to ?2.7:1. This higher ratio is closer to what is typically observed in oil from Schizochytrium 20888 itself.

(169) The data shown in Table II-B indicate that the increase in % PUFA observed when Sz-TE2 and Sz-TE3 are both expressed is accompanied by an increase in accumulation of the total mg of FAME per gram of biomass. Furthermore that increase is specifically associated with an increase in mg of DHA and DPAn-6 while the amounts of other fatty acids are relatively unchanged. Previous analysis indicated that, the products of the PUFA synthase accumulate as free fatty acids in E. coli, and it is likely that additional PUFAs in these cells are also present as free fatty acids rather than being incorporated into cellular membranes.

Example 9

(170) The following example describes the effect on fatty acid profiles of co-expression of Sz-TE2 and Sz-TE3 in yeast expressing the Schizochytrium 20888 PUFA synthase and HetI. The data indicate that accumulation of the products of the Schizochytrium 20888 PUFA synthase (DHA and DPAn-6) can be increased by co-expression of Sz-TE2 plus Sz-TE3. They also indicate that Sz-TE3 has some activity when expressed without Sz-TE2.

(171) Cloning of Sz-TE2 and Sz-TE3 Orfs into yeast expression vectors: Expression of the Schizochytrium 20888 PUFA synthase (PFA 1, 2 and 3) along with HetI in yeast results in accumulation of DHA and DPAn-6 in those cells (Metz et al., US Patent Application Publication No. 2013-0150599). One of the strains created for expressing this system contained the genes in the following vectors: PFA1 in a pYES-Leu vector (the Orf codons were modified for yeast expression), PFA2 in a pYES3-Tryp vector (the Orf codons were modified for yeast expression) and PFA3 and HetI in a pESC-Ura vector (the native Orf sequences were used for both genes). To test the effects of co-expression of the enhancing factor candidates with the Schizochytrium 20888 PUFA synthase Sz-TE2 and Sz-TE3 coding regions were cloned into a pESC-His vector, either separately or together. Sz-TE2 was cloned behind the Gal 1 promoter (as a BamHIXhoI fragment) while Sz-TE3 was cloned behind the Gal 10 promoter (as a EcoRINotI fragment). Both DNA fragments retained the native Orf nucleotide sequences.

(172) FAME profiles of yeast strains expressing the Schizochytrium 20888 PUFA synthase system and Sz-TE2 and Sz-TE3: Yeast strains expressing either the active Schizochytrium 20888 PUFA synthase (subunit genes plus HetI) alone or also containing either Sz-TE2 or Sz-TE3, alone or together, were grown on appropriate media. Expression of the transgenes was induced by resuspension of washed cells in media containing galactose. The cells were grown for 20 hrs at 30? C. after induction then collected by centrifugation, freeze dried and their fatty acids converted to FAMES using acidic methanol and analyzed by GC. The FAME profiles of the various strains are shown in Table III (as % of total FAME). The control strain (with just the PUFA synthase genes plus HetI) produced DHA and DPAn-6 at levels consistent with previous observations (Metz et al., US Patent Application Publication No. 2013-0150599), i.e., 2.9% DHA and 1.8 or 1.9% DPAn-6. Co-expression of Sz-TE2 alone did not increase the PUFA levels. Co-expression of Sz-TE3 alone resulted in an ?1.5? increase in PUFA accumulation but did not alter the DHA to DPAn-6 ratio. Co-expression of Sz-TE2 and Sz-TE3 together resulted in an ?1.6? increase in PUFA accumulation with an ?1.9? increase in DHA level Additionally, the DHA to DPAn-6 ratio in the cells co-expressing the Sz-TE2 plus Sz-TE3 increased from ?1.5 to ?2.7. As in the case of expression in E. coli, the Sz-TE2 by itself did not result in an increase in PUFA accumulation. In contrast to the E. coli result, Sz-TE3 by itself did increase the accumulation both DHA and DPAn-6 in yeast. The apparent lack of solubility of Sz-TE3 (when expressed without Sz-TE2) in E. coli may account for the different result in obtained yeast, it is apparent that the outcome can be affected by the heterologous host utilized for expression. The increase in the DHA:DPAn-6 ratio is again observed when Sz-TE2 and Sz-TE3 are both expressed (from ?1.5 to ?2.7).

(173) TABLE-US-00013 TABLE III % FAME 24 hrs TE2 TE2 TE3 TE3 TE2 + 3 TE2 + 3 Fatty Acid BRY4.11-3 BRY4.11-4 YMR1-3 YMR1-4 YMR2-3 YMR2-4 YMR3-3 YMR3-4 C12:0* 1.7 1.6 2.1 2.3 1.8 1.9 2.1 2.1 C14:0* 1.4 1.3 1.7 1.8 1.3 1.3 1.6 1.6 C14:1* 0.4 0.4 0.5 0.6 0.4 0.4 0.4 0.5 C16:0* 17.5 17.1 19.0 18.9 18.3 18.5 18.5 18.3 C16:1* 41.5 41.4 43.5 45.7 39.7 40.4 40.8 41.8 C18:0* 6.1 6.1 5.8 5.2 6.1 6.0 5.6 5.2 C18:1 N9* 25.1 25.5 22.8 21.9 23.2 22.9 21.9 21.4 C18:1 N7* 1.0 1.0 0.9 0.8 0.9 0.8 0.7 0.7 C22:5 N6* 1.9 1.8 1.2 0.9 2.6 2.7 2.0 2.1 C22:6 N3* 2.9 2.9 1.9 1.6 4.8 4.1 5.5 5.6 DHA + DPAn6 4.7 4.7 3.1 2.5 7.4 6.8 7.5 7.7 DHA/DPAn6 1.5 1.6 1.6 1.8 1.8 1.5 2.7 2.7

(174) Table III shows fatty acid profilesas % of total FAMEof control yeast strains (BRY4.11expressing the Schizochytrium 20888 PUFA synthase, PFA 1, 2, and 3, and HetI) and strains expressing either Sz-TE2 or Sz-TE3 or both in the parental (BRY4.11) background. Only those fatty acids with levels >1% of the total FAMEs are shown.

Example 10

(175) This example demonstrates that homologs of Sz-TE2 and Sz-TE3 can be readily identified in another Thraustochytrid that utilizes a PUFA synthase.

(176) Schizochytrium 9695 contains a PUFA synthase homologous to that found in Schizochytrium 20888 (Apt et al., U.S. Patent Application Publication No. 2010-0266564). A draft whole genome sequence of this organism was generated and assembled into contigs. A translated BLAST (tblastn) search was carried out against a database set containing all of the assembled contigs using the Sz-TE2 and Sz-TE3 amino acid sequences as queries. In both cases only 2 contigs were identified with significant homology to the query sequencesand they were the same contigs in both cases (in reverse order). The appropriate open reading frames were identified and the nucleotide sequences and their predicted translations are listed. The amino acid homolog to Sz-TE2 has been designated B-TE2, the amino acid homolog to Sz-TE3 has been designated B-TE3. The nucleotide sequences of these two Orfs along with the predicted translations are shown in the Sequence Listing and are described below.

(177) The nucleotide sequence encoding B-TE2 and the predicted translation: The nucleotide sequence of the predicted Orf contained 468 bps (without the stop codon) and the translation encoded a 17.36 kDa protein with 156 amino acids.

(178) The nucleotide sequence encoding B-TE3 and the predicted translation: The nucleotide sequence of the predicted Orf contained 963 bps (without the stop codon) and the translation encoded a 36.5 kDa protein with 321 amino acids.

(179) Alignment of Sz-TE2 and Sz-TE3 amino acid sequences with the B-TE homologs: FIG. 3A shows the alignment of Sz-TE2 with B-TE2. The identical residues in this alignment are shown in light grey and the conservative changes in darker grey, respectively. Using Sz-TE2 as the reference, 52 in 137 amino acids are identical (38.0%) and there are 78 in 137 positives (identical plus conservative changes) (56.9%). The B-TE2 sequence has an additional region rich in serines and glycines in the middle of the protein (shown as a gap in the alignment).

(180) FIG. 3B shows the alignment of Sz-TE3 with B-TE3. Both Sz-TE3 and B-TE3 contain 321 amino acids. In this alignment, 155 in 321 amino acids are identical (48.3%) and there are 192 in 321 positives (59.8%). As in the case of B-TE2, the B-TE3 sequence has an additional region rich in serine and glycines in the middle of the protein (shown as a gap in the alignment).

Example 11

(181) This example demonstrates that B-TE2 and B-TE3 can enhance the activity of the Schizochytrium 20888 PUFA synthase in an in vitro assay. It suggests that the EF-Xs may play a general role of enhancing PUFA synthase activities.

(182) Construction of E. coli expression plasmids containing B-TE2 and B-TE3 Orfs: The same basic strategy used for cloning Sz-TE2 and Sz-TE3 was employed for the B-TE homologs. Orfs encoding B-TE2 and B-TE3 were cloned separately and together into the two Novagen Duet vectors: pETDuer? (carrying the Amp resistance marker) and pCOLADuet? (carrying the Kan resistance marker). In both cases, the B-TE2 Orf was cloned into the MCS-1 and B-TE3 was cloned into the MCS-2. The final Orfs for both genes in the constructs were identical to the native Orfs listed above.

(183) Expression of B-TE2 and B-TE3 in E. colitesting for protein solubility: The same strategy used for assessing the solubility of the Sz-TE2 and Sz-TE3 proteins in E. coli was employed for the B-TE homologs. Cells containing plasmids with B-TE2 and B-TE3, either separately or together, were grown on LB medium at 32? C. Synthesis of the proteins was induced by addition of IPTG (0.5 mM) and incubation was continued for 3 to 5 hrs. The cells were collected by centrifugation and the Novagen BugBuster? reagent (and centrifugation protocol) was used to separate soluble proteins from cell debris and non-soluble proteins (presumably sequestered in inclusion bodies). Samples of the whole cells and the soluble and non-soluble fractions were treated with SDS and analyzed by SDS-PAGE. Bands associated with B-TE2 and B-TE3 were readily detected in the whole cell extracts, with the B-TE3 being very highly expressed. Comparison of the proteins in the soluble and the non-soluble fractions reveals that B-TE2, when expressed by itself, primarily partitions to the soluble fraction. In contrast, B-TE3 remains primarily in the insoluble fractions. When B-TE2 and B-TE3 are co-expressed in the same strain, most of both proteins are in the insoluble tractions, but a minor amount of both can be detected in the soluble fractions. These results are similar to what was observed for Sz-TE2 and Sz-TE3but the insolubility of B-TE3 is more pronounced. As in the case of Sz-TE2 and Sz-TE3, these data suggest an interaction between B-TE2 and B-TE3 proteins which may increase the solubility of B-TE3 in the E. coli system.

(184) In vitro activity enhancement assays: addition of separately expressed B-TE2 and B-TE3 to the Schizochytrium 20888 PUFA synthase system: Aliquots of the cell homogenates and supernatant fractions from the E. coli strains described above were tested in the PUFA synthase in vitro activity assay. The extracts were mixed with a homogenate of E. coli strain JK824 (expressing the Schizochytrium 20888 Pfa 1, 2 and 3 plus HetI), and the assay run as described above. As for the assays of Sz-TE2 and Sz-TE3, the homogenates and supernatant fractions were diluted 6? in Buffer K prior to being combined with the separately prepared homogenate of JK824 in the enhancement assay (see Example 5, above, for additional details). FIG. 4 shows the results of these activity assays along with control assays (addition of buffer alone and addition of E. coli expressed Sz-TE2 and Sz-TE3). In FIG. 4, B refers to Schizochytrium 9695. Sz refers to Schizochytrium 20888. 2 refers to TE2. 3 refers to TE3. S refers to supernatant fraction. H refers to homogenate fraction. The data in the figure show that B-TE2 and B-TE3, when expressed together in E. coli, can significantly enhance the in vitro activity of the Schizochytrium 20888 PUFA synthase. This effect is most evident when the homogenate was used in the assaythe supernatant fraction from that strain was much less active. Additionally, the Schizochytrium 20888 and Schizochytrium 9695 derived B-TEs can be mixedi.e., the B-TE2 can substitute for Sz-TE2 and B-TE3 can substitute for Sz-TE3. These data validate the selection of B-TE2 and B-TE3 as enhancing factor proteins.

(185) While various embodiments of the present invention have been described in detail, it is apparent that modifications and adaptations of those embodiments will occur to those skilled in the art. It is to be expressly understood, however, that such modifications and adaptations are within the scope of the present invention.