MODIFIED SERPINS FOR THE TREATMENT OF BLEEDING DISORDERS
20180273610 ยท 2018-09-27
Inventors
- James Andrew Huntington (Cambridge, GB)
- St?phanie Polderdijk (Cambridge, GB)
- Trevor Baglin (Cambridge, GB)
Cpc classification
A61P43/00
HUMAN NECESSITIES
A61P7/04
HUMAN NECESSITIES
A61L2300/418
HUMAN NECESSITIES
A61L26/0047
HUMAN NECESSITIES
A61P7/02
HUMAN NECESSITIES
A61L2300/258
HUMAN NECESSITIES
A61L2300/252
HUMAN NECESSITIES
International classification
Abstract
This invention relates pro-coagulant serpin molecules engineered by modification of the P4, P2, P1 and/or P1 residues within the reactive center loop (RCL) to display increased specificity for anticoagulant proteases. These modified serpin molecules may be useful in therapy, for example as pro-coagulants for the treatment of bleeding.
Claims
1. A modified serpin having mutations at residues P1 and P2 and optionally P1 and/or P4 in the reactive center loop (RCL) thereof, wherein the P1 residue is mutated to Q, H, K or R; and the P2 residue is mutated to H, K or R, and; wherein said mutations increase the inhibition of one or more anticoagulant proteases selected from activated Protein C and thrombin:thrombomodulin complex relative to the inhibition of one or more procoagulant proteases selected from thrombin, fVIIa, fXa, fIXa and fXIa.
2. A modified serpin according to claim 1 wherein the P1 residue is mutated to K or Q.
3. A modified serpin according to claim 1 wherein the P2 residue is mutated to K.
4. A modified serpin according to claim 1 wherein the P2 and the P1 residues respectively in the modified serpin are KK, RK, RH, KH, RQ or KQ.
5. A modified serpin according to claim 1 wherein the modified serpin comprises a mutation at P4, optionally wherein the P4 residue is mutated to F, S, R, V, C, W, K, G, L, H, T, Q or A.
6. A modified serpin according to claim 1 wherein the modified serpin comprises a mutation at P1, optionally wherein the P1 residue is mutated to R.
7. A modified serpin according to claim 1 wherein the modified serpin has an R residue at the P1 position.
8. A modified serpin according to claim 1 wherein the mutations in the RCL of the modified serpin consist of mutations at positions P1 and P2; positions P1, P2 and P1; positions P1, P2 and P4; or positions P1, P2, P4 and P1.
9. A modified serpin according to claim 1 wherein; the P4 residue in the RCL of the modified serpin is A, the P2 residue is K, and the P1 residue is K; the P4 residue in the RCL of the modified serpin is A, the P2 residue is R, and the P1 residue is H; the P4 residue in the RCL of the modified serpin is A, the P2 residue is K, and the P1 residue is H; the P4 residue in the RCL of the modified serpin is A, the P2 residue is R, and the P1 residue is Q; the P4 residue in the RCL of the modified serpin is A, the P2 residue is K, and the P1 residue is Q; the P4 residue in the RCL of the modified serpin is A, the P2 residue is K, the P1 residue is R and the P1 residue is K; the P4 residue in the RCL of the modified serpin is A, the P2 residue is K, the P1 residue is R and the P1 residue is Q; or the P4 residue in the RCL of the modified serpin is A, the P2 residue is R, the P1 residue is R and the P1 residue is Q; the P4 residue in the RCL of the modified serpin is K, the P2 residue is R and the P1 residue is H; the P4 residue in the RCL of the modified serpin is F, the P2 residue is K and the P1 residue is K; the P4 residue in the RCL of the modified serpin is F, the P2 residue is R and the P1 residue is K; or the P4 residue in the RCL of the modified serpin is S, the P2 residue is H and the P1 residue is R.
10. A modified serpin according to claim 1 that comprises an amino acid sequence that has at least 70% sequence identity to the sequence of a wild-type serpin.
11. A modified serpin according to claim 10 wherein the wild-type serpin is selected from the group consisting of ?.sub.1-antichymotrypsin (SERPINA3), C1-esterase inhibitor, ?.sub.2-antiplasmin (SERPINF2) antithrombin (ATIII) (SERPINC1), heparin cofactor II (HCII) (SERPIND1), protein C inhibitor (PCI) (SERPINA5) or ?.sub.1-antitrypsin (?.sub.1AT) (SERPINA1), Kallistatin (SERPINA4), Plasminogen activator inhibitor (SERPINE1), Protease nexin 1 (SERPINE2) and Protein Z-dependent protease inhibitor (SERPINA10).
12. A modified serpin according to claim 1 comprising an amino acid sequence having at least 70% sequence identity to residues 25-418 of SEQ ID NO: 12, wherein the P4 residue in the RCL of the modified serpin is A, the P2 residue is K, P1 residue is R and the P10 residue is K.
13. A modified serpin according to claim 12 comprising; (i) the amino acid sequence of residues 25-418 of SEQ ID NO: 12; (ii) the amino acid sequence of residues 25-418 of SEQ ID NO: 12 with a C to S mutation at residue 256; (iii) the amino acid sequence of residues 25-418 of SEQ ID NO: 12 with a E to S mutation at residue 25; or (iv) the amino acid sequence of residues 25-418 of SEQ ID NO: 12 with a E to S mutation at residue 25 and a C to S mutation at residue 256.
14. A nucleic acid encoding a modified serpin according to claim 1, a vector comprising a nucleic acid encoding a modified serpin according to claim 1 or a recombinant cell comprising a vector which expresses a modified serpin according to claim 1.
15. A pharmaceutical composition comprising a modified serpin according to claim 1 and a pharmaceutically acceptable excipient.
16. A method of treating of a human or animal subject in need thereof, the method comprising administering to the subject a modified serpin according to claim 1.
17. A method of treating or preventing bleeding, or promoting hemostasis, in an individual, the method comprising administering to the individual a modified serpin according to claim 1.
18. The method of claim 17, wherein the individual has a bleeding disorder.
19. The method of claim 18, wherein the bleeding disorder is haemophilia.
20. The method of claim 17, wherein the individual is a trauma patient.
Description
BRIEF DESCRIPTION OF FIGURES
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
DETAILED DESCRIPTION
[0031] This invention relates to the modification of serpins to increase their specificity for APC relative to other coagulation proteases. Modified serpin variants specific for APC may be useful, for example as procoagulants.
[0032] Since they are specific to APC, the modified serpins described herein are expected to have few or no off-target effects and are specific to pathways that are activated on injury. This allows the modified serpins to be applied therapeutically and prophylactically, as well as in emergency situations, i.e. trauma. The dosing of modified serpins is predictable since they are suicide inhibitors, meaning that one molecule of serpin cannot inhibit more than one molecule of protease. In addition, because efficient natural clearance mechanisms are specific for serpin: protease complexes over serpins alone, the plasma half-lives of modified serpins are likely to exceed those of current bypassing agents. For example, the half-life of a modified serpin as described herein may be about 5 days.
[0033] Protein C (Gene ID 5624) is a vitamin K-dependent plasma glycoprotein that is cleaved to its activated form (activated Protein C, APC) by the thrombin-thrombomodulin complex. Human Protein C has the reference amino acid sequence of NP 000303.1 GI: 4506115 and may be encoded by the reference nucleotide sequence of NM 000312.3 GI: 270483720. APC is an anticoagulant protease that proteolytically cleaves fVa and fVIIIa (
[0034] A modified serpin as described herein may have one or more mutations in its reactive center loop (RCL). For example, the modified serpin may have one, two, three, four, or more than four mutations in its RCL. The residues at one, two, three or all four of positions P4, P2, P1 and P1 may be mutated. For example, the residues at one or both of positions P1 and P2 and optionally P1 and/or P4 may be mutated.
[0035] RCL residues are numbered herein according to the Schechter-Berger nomenclature for substrates and inhibitors of serine proteases (Schechter & Berger, 1967). This standard nomenclature allows the residue at specific positions in the RCL, such as positions P1, P1, P2 and/or P4, to be easily identified in any serpin sequence.
[0036] Preferably, the one or more mutations are the only mutations in the RCL of the modified serpin. For example, the RCL may consist of the sequence of the RCL of the wild-type serpin with mutations at one or both of positions P1 and P2 and optionally P1 and/or P4.
[0037] The RCL of the modified serpin may have mutations at the P1 and P2 positions; mutations at the P1, P2 and P1 positions; mutations at the P1, P2 and P4 positions or mutations at the P1, P2, P1 and P4 positions; a mutation at the P1 position; mutations at the P1 and P1 positions; mutations at the P1 and P4 positions or mutations at the P1, P1 and P4 positions; a mutation at the P2 position; mutations at the P2 and P1 positions; mutations at the P2 and P4 positions, mutations at the P2, P1 and P4 positions, a mutation at the P1 position, a mutation at the P4 position; or mutations at the P1 and P4 positions. The residues at other positions in the RCL may be unmutated wild-type residues.
[0038] Preferably, the residues at position P1; positions P1 and P2; positions P1, P1 and P2; positions P2 and P1; positions P1 and P1; positions P1, P2 and P4 or positions P1, P1, P2 and P4 of the RCL are mutated. In some preferred embodiments, the residues at positions P1, P1 and P2 are mutated.
[0039] The reactive center loop (RCL) of a serpin is typically about 20 residues in length and contains the scissile P1-P1 bond that is cleaved by the target protease. The RCL extends from strand 5 of beta sheet A to strand 1 of beta sheet C of the serpin. Residues P17 Glu, P15 Gly and P14 Thr are conserved in serpins. For example, the RCL of a serpin may comprise the consensus sequence P17 E, P16 E/K/R, P15 G, P14 T/S, P12-P9 (A/G/S).sub.4 (Hopkins et al. 1993; Irving et al. 2000). The RCL starts at residue P17 and usually ends at residue P3. RCLs may be extended in some serpins, such as PCI, by additional residues on the P side. For example, the RCL of ?.sub.1-antitrypsin consists of residues P17-P3 and the RCL of PCI consists of residues P17-P6. Examples of serpins with residues P1, P1, P2 and P4 highlighted are shown in SEQ ID NOS: 1 to 11 below. The residues that constitute the mature serpin sequences are also indicated.
[0040] The residues in the other positions of the RCL in the serpin may be unmodified i.e. they may be the native residues of the wild-type serpin sequence. The modified serpin may therefore comprise an RCL having a wild-type sequence with mutations at positions P1, P1, P2 and/or P4 as described above.
[0041] The one or more mutations in the reactive center loop (RCL) of the modified serpin may comprise or consist of a mutation at the P1 position. Preferably, the mutation is a substitution. The native P1 residue in the RCL of the wild-type serpin may be replaced with a non-native residue in the modified serpin. For example, the native S residue at the P1 position in the wild-type sequence of ?.sub.1AT or PCI may be replaced with a residue other than S in the modified serpin.
[0042] The native P1 residue in the RCL of the wild-type serpin may be replaced with a large polar residue, such as Q, N, Y; a large hydrophobic residue, such as I, M and V; a positively charged residue such as R, H or K; or another residue such as C, A, S and E.
[0043] In some preferred embodiments, the P1 residue may be modified to a large polar residue, such as Q, N, Y; a large hydrophobic residue, such as V; or a positively charged residue such as R, H or K; more preferably, a positively charged or large polar residue, such as H, K, R, or Q; most preferably K.
[0044] In other embodiments, the P1 residue may be unmodified in the modified serpin. For example, the residue at the P1 position in the RCL of the modified serpin may be the residue that is present at the P1 residue in the wild-type serpin sequence.
[0045] The one or more mutations in the reactive center loop (RCL) of the modified serpin may comprise or consist of a mutation at the P2 residue. Preferably, the mutation is a substitution. For example, the native P2 residue in the RCL of the wild-type serpin may be replaced with a non-native residue in the modified serpin.
[0046] The native P2 residue in the RCL of the wild-type serpin may be replaced with a large polar residue, such as D, Q, N, Y, a large hydrophobic residue such as W, L, I, V and F, a positively charged residue, such as R, H or K or another residue, such as C, A, T, S or P.
[0047] In some embodiments the P2 residue in the modified serpin may be other than P.
[0048] In some preferred embodiments, the P2 residue may be modified to a large polar residue, such as Q, N, Y, a large hydrophobic residue such as W or a positively charged residue such as R, H or K, most preferably a positive residue, such as H, K or R, preferably K.
[0049] In some embodiments, the P2 residue may be unmodified in the modified serpin. For example, the residue at the P2 position in the RCL of the modified serpin may be the residue that is present at the P2 residue in the wild-type serpin sequence.
[0050] The one or more mutations in the RCL of the modified serpin may comprise or consist of substitutions at the P1 and/or P2 residues i.e. the residues located at the P1 and/or P2 positions in the RCL of the wild-type serpin sequence may be replaced by other residues in the modified serpin.
[0051] In preferred embodiments, the modified serpin has mutations at both the P2 and the P1 positions of the RCL.
[0052] Suitable residues at the P2 and P1 positions of the modified serpin are described above.
[0053] In some modified serpins described herein, at least one of the P1 and P2 residue may be a positively charged residue, such as R, H or K or a large polar residue, such as D, Y, Q or N; a large hydrophobic residue, such as W, L, F, V, M or I; or another residue, such as L, C, A, E, T, S or P. Preferably, at least one of the P1 and P2 residue is a positively charged residue, such as R, H or K; a large polar residue, such as Y, Q or N; or a large hydrophobic residue, such as W, L, F, V or I.
[0054] Examples of P2 and the P1 residues respectively in a modified serpin as described herein include KK, FK, RK, VK, LK, QK, CK, PK, FR, HR, IR, SR, TR, VR, YR, AR, PR, RS, KS, QV, RV, RI, RH, KH, TH, RC, RA, LY, QY, TY, DM, TM, WN, RN, HN, TN, KN, NN, PE, RQ, KQ and TQ.
[0055] In some preferred embodiments, both the P1 and the P2 residue may be modified to positively charged residues, such as K, H or R, most preferably K.
[0056] In some embodiments, the P2 and the P1 residues respectively in a modified serpin as described herein may be other than PN, FS, QS, AS, TS, HS, TA, PT, CC, PS, PT, PM, PH, PA or PC. For example, the P2 and P1 residues may be other than PN, FS, QS, AS, TS, HS, TA, PT, CC or PC in a PCI scaffold or other than PS, PT, PM, PH or PA in an ?.sub.1AT scaffold,
[0057] In some embodiments, the P1 residue may be unmodified in the modified serpin. For example, the residue at the P1 position in the RCL of the modified serpin may be the residue that is present at the P1 residue in the wild-type serpin sequence. For example, the P1 residue in a modified PCI may be an R residue.
[0058] In other embodiments, the P1 residue may be mutated in the modified serpin. For example, the one or more mutations in the reactive center loop (RCL) of the modified serpin further comprise a mutation at the P1 residue. Preferably, the mutation is a substitution. The native P1 residue in the RCL of the wild-type serpin may be replaced with a non-native residue in the modified serpin.
[0059] In some embodiments, the P1 residue may be mutated or modified to a positively charged residue such as H, K or R, preferably R.
[0060] Preferably, a native residue that is non-positively charged at the P1 position of a wild-type serpin may be replaced by a positively charged residue in the modified serpin. For example, M at the P1 position of wild-type ?.sub.1AT may be replaced by a positively charged residue, such as R, in a modified ?.sub.1AT. The Pittsburgh (Pitts) variant of ?.sub.1AT has a mutation at residue 358 which replaces the M residue at the P1 position with an R residue.
[0061] In some embodiments, the P4 residue may be unmodified in the modified serpin. For example, the residue at the P4 position in the RCL of the modified serpin may be the residue that is present at the P4 residue in the wild-type serpin sequence. For example, the P4 residue in a PCI scaffold may be F and the P4 residue in an ?.sub.1AT scaffold may be A.
[0062] In other embodiments, the P4 residue may be mutated in the modified serpin. For example, the one or more mutations in the reactive center loop (RCL) of the modified serpin further comprise a mutation at the P4 residue.
[0063] Preferably, the mutation is a substitution. The residue at the P4 residue in the RCL of the wild-type serpin may be replaced with a different residue in the modified serpin. For example, the P4 residue in a modified PCI may be mutated or modified to a residue other F and the P4 residue in a modified ?.sub.1AT may be mutated or modified to a residue other than A.
[0064] Suitable residues in the P4 position of the RCL of the modified serpin include S, R, V, C, W, K, G, L, H, F, T, Q and A.
[0065] In examples of modified procoagulant serpins as described herein,
[0066] (1) the P4 residue is Q, the P2 residue is R, the P1 residue is R and the P1 residue is N;
[0067] (2) the P4 residue is K, the P2 residue is R, the P1 residue is R and the P1 residue is H;
[0068] (3) the P4 residue is S, the P2 residue is L, the P1 residue is R and the P1 residue is K;
[0069] (4) the P4 residue is H, the P2 residue is R, the P1 residue is R and the P1 residue is V;
[0070] (5) the P4 residue is F, the P2 residue is K, the P1 residue is R and the P1 residue is K;
[0071] (6) the P4 residue is F, the P2 residue is R, the P1 residue is R and the P1 residue is K;
[0072] (7) the P4 residue is F, the P2 residue is V, the P1 residue is R and the P1 residue is K;
[0073] (8) the P4 residue is C, the P2 residue is L, the P1 residue is R and the P1 residue is K;
[0074] (9) the P4 residue is F, the P2 residue is F, the P1 residue is R and the P1 residue is R;
[0075] (10) the P4 residue is S, the P2 residue is H, the P1 residue is R and the P1 residue is R;
[0076] (11) the P4 residue is G, the P2 residue is I, the P1 residue is R and the P1 residue is R;
[0077] (12) the P4 residue is R, the P2 residue is Q, the P1 residue is R and the P1 residue is V;
[0078] (13) the P4 residue is T, the P2 residue is R, the P1 residue is R and the P1 residue is V
[0079] (14) the P4 residue is R, the P2 residue is R, the P1 residue is R and the P1 residue is I;
[0080] (15) the P4 residue is V, the P2 residue is R, the P1 residue is R and the P1 residue is I;
[0081] (16) the P4 residue is L, the P2 residue is R, the P1 residue is R and the P1 residue is I;
[0082] (17) the P4 residue is T, the P2 residue is L, the P1 residue is R and the P1 residue is Y;
[0083] (18) the P4 residue is A, the P2 residue is Q, the P1 residue is R and the P1 residue is Y;
[0084] (19) the P4 residue is K, the P2 residue is D, the P1 residue is R and the P1 residue is M;
[0085] (20) the P4 residue is W, the P2 residue is W, the P1 residue is R and the P1 residue is N;
[0086] (21) the P4 residue is A, the P2 residue is K, the P1 residue is R, and the P1 residue is S;
[0087] (22) the P4 residue is A, the P2 residue is R, the P1 residue is R, and the P1 residue is S;
[0088] (23) the P4 residue is A, the P2 residue is P, the P1 residue is R, and the P1 residue is E;
[0089] (24) the P4 residue is A, the P2 residue is P, the P1 residue is R, and the P1 residue is R;
[0090] (25) the P4 residue is A, the P2 residue is P, the P1 residue is R, and the P1 residue is K;
[0091] (26) the P4 residue is A, the P2 residue is T, the P1 residue is R, and the P1 residue is M;
[0092] (27) the P4 residue is A, the P2 residue is T, the P1 residue is R, and the P1 residue is H;
[0093] (28) the P4 residue is A, the P2 residue is T, the P1 residue is R, and the P1 residue is Q;
[0094] (29) the P4 residue is A, the P2 residue is T, the P1 residue is R, and the P1 residue is N;
[0095] (30) the P4 residue is A, the P2 residue is T, the P1 residue is R, and the P1 residue is Y;
[0096] (32) the P4 residue is A, the P2 residue is T, the P1 residue is R, and the P1 residue is R;
[0097] (33) the P4 residue is A, the P2 residue is R, the P1 residue is R, and the P1 residue is A;
[0098] (34) the P4 residue is A, the P2 residue is R, the P1 residue is R, and the P1 residue is H;
[0099] (35) the P4 residue is A, the P2 residue is R, the P1 residue is R, and the P1 residue is C;
[0100] (36) the P4 residue is A, the P2 residue is R, the P1 residue is R, and the P1 residue is N;
[0101] (37) the P4 residue is A, the P2 residue is S, the P1 residue is R, and the P1 residue is R;
[0102] (38) the P4 residue is A, the P2 residue is K, the P1 residue is R, and the P1 residue is N;
[0103] (39) the P4 residue is A, the P2 residue is K, the P1 residue is R, and the P1 residue is H;
[0104] (40) the P4 residue is A, the P2 residue is K, the P1 residue is R, and the P1 residue is K;
[0105] (41) the P4 residue is A, the P2 residue is V, the P1 residue is R, and the P1 residue is R;
[0106] (42) the P4 residue is A, the P2 residue is Y, the P1 residue is R, and the P1 residue is R;
[0107] (43) the P4 residue is A, the P2 residue is A, the P1 residue is R, and the P1 residue is R;
[0108] (44) the P4 residue is A, the P2 residue is C, the P1 residue is R, and the P1 residue is K;
[0109] (45) the P4 residue is A, the P2 residue is W, the P1 residue is R, and the P1 residue is N;
[0110] (46) the P4 residue is A, the P2 residue is H, the P1 residue is R, and the P1 residue is N;
[0111] (47) the P4 residue is A, the P2 residue is Q, the P1 residue is R, and the P1 residue is K; or,
[0112] (48) the P4 residue is A, the P2 residue is N, the P1 residue is R, and the P1 residue is N.
[0113] (49) the P4 residue is F, the P2 residue is F, the P1 residue is R, and the P1 residue is K.
[0114] (50) the P4 residue is A, the P2 residue is K, the P1 residue is R, and the P1 residue is Q,
[0115] (51) the P4 residue is A, the P2 residue is R, the P1 residue is R, and the P1 residue is Q.
[0116] In some preferred modified serpins, the P4 residue is A, the P2 residue is K, the P1 residue is R, and the P1 residue is K.
[0117] In some embodiments, the residues at the P4, P2 and the P1 positions in a modified procoagulant serpin as described herein may be other than HPN, DKN, HPE, FFS, LQS, HAS, YTS, AHS, ATA, LPT, ACC, APT, APA, APM, APH, APS and VPC, respectively. For example, a modified PCI may have residues other than HPN, DKN, HPE, FFS, LQS, HAS, YTS, AHS, ATA, LPT, ACC and VPC at the P4, P2 and the P1 positions and a modified ?.sub.1AT may have residues other than APT, APA, APM or APH at the P4, P2 and the P1 positions. In some embodiments, the combination of residues at the P4, P2 and the P1 positions in a modified procoagulant serpin as described herein may be non-naturally occurring i.e. the combination of residues at the P4, P2 and the P1 positions is not found in the parent wild-type (i.e. unmodified) serpin or in other wild-type serpins.
[0118] A modified serpin as described herein may comprise the sequence of a wild-type (i.e. unmodified) serpin, preferably a mature wild-type serpin, with one or more mutations in the RCL thereof as described above, and optionally one or more additional mutations outside the RCL.
[0119] The sequences of wild-type serpins are well-known in the art, and may include SEQ ID NOS: 1 to 11 as set out herein. The sequences of wild-type serpins may include the sequence of mature wild-type proteins.
[0120] The mature protein C inhibitor (PCI) sequence including its propeptide corresponds to residues 20 to 406 of SEQ ID NO: 1. The mature ?.sub.1-antichymotrypsin corresponds to residues 26 to 423 of SEQ ID NO: 2. The mature C1-esterase inhibitor sequence corresponds to residues 23-500 of SEQ ID NO: 3. The mature ?.sub.2-antiplasmin sequence corresponds to residues 28-491 of SEQ ID NO: 4. The mature antithrombin (ATIII) sequence corresponds to residues 33-464 of SEQ ID NO: 5. The mature heparin cofactor II sequence corresponds to residues 20-499 of SEQ ID NO: 6. The mature ?.sub.1-antitrypsin (?.sub.1AT) sequence corresponds to residues 25-418 of SEQ ID NO: 7. The mature kallistatin sequence corresponds to residues 21-427 of SEQ ID NO: 8. The mature plasminogen activator inhibitor sequence corresponds to residues 24-402 of SEQ ID NO: 9. The mature protein Z dependent inhibitor sequence corresponds to residues 22-444 of SEQ ID NO: 10. The mature protease nexin 1 isoform a sequence corresponds to residues 20-398 of SEQ ID NO: 11.
[0121] Other than mutations of residues in the RCL as described above, a modified serpin may have 50 or fewer amino acid residues altered relative to a wild-type serpin amino acid sequence (for example the mature serpin sequence of one of SEQ ID NOS 1 to 11, preferably SEQ ID NO: 1 or 7), preferably 45 or fewer, 40 or fewer, 30 or fewer, 20 or fewer, 15 or fewer, 10 or fewer, 5 or fewer or 3 or fewer. For example, a modified serpin may comprise the sequence of a wild-type serpin with 50 or fewer, 45 or fewer, 40 or fewer, 30 or fewer, 20 or fewer, 15 or fewer, 10 or fewer, 5 or fewer or 3 or fewer amino acid residues mutated or altered, in addition to the one, two, three or four amino acid residues in the RCL of the serpin that are mutated or altered as described above (i.e. the residues at positions P1 and/or P2 and optionally P1 and/or P4).
[0122] An amino acid residue in the wild-type amino acid sequence may be altered or mutated by insertion, deletion or substitution, preferably substitution for a different amino acid residue. Such alterations may be caused by one or more of addition, insertion, deletion or substitution of one or more nucleotides in the encoding nucleic acid.
[0123] For example, a modified serpin may comprise the amino acid sequence of residues 25-418 of SEQ ID NO: 12 having 50 or fewer mutations, wherein said mutations are at positions other than P4, P2, P1 and P1 i.e. the P4 residue at in the RCL of the modified serpin is A, the P2 residue is K, P1 residue is R and the P1 residue is K.
[0124] The P4 residue in the modified serpin of SEQ ID NO: 12 is located at position 379 (355 of the mature protein), the P2 residue is located at position 381 (357 of the mature protein), the P1 residue is located at position 382 (358 of the mature protein), and the P1 residue is located at position 383 (359 of the mature protein).
[0125] The modified serpin may share at least 50% sequence identity with the wild-type amino acid sequence of a wild-type serpin, for example the mature serpin sequence of any one of SEQ ID NOS: 1 to 11, preferably SEQ ID NO: 1 or 7, at least 55%, at least 60%, at least 65%, at least 70%, at least about 80%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity.
[0126] For example, a modified serpin may comprise an amino acid sequence having at least 50% sequence identity to residues 25-418 of SEQ ID NO: 12, wherein the P4 residue in the RCL of the modified serpin is A, the P2 residue is K, P1 residue is R and the P1 residue is K.
[0127] Sequence identity is commonly defined with reference to the algorithm GAP (Wisconsin GCG package, Accelerys Inc, San Diego USA). GAP uses the Needleman and Wunsch algorithm to align two complete sequences that maximizes the number of matches and minimizes the number of gaps. Generally, default parameters are used, with a gap creation penalty=12 and gap extension penalty=4. Use of GAP may be preferred but other algorithms may be used, e.g. BLAST (which uses the method of Altschul et al. (1990) J. Mol. Biol. 215: 405-410), FASTA (which uses the method of Pearson and Lipman (1988) PNAS USA 85: 2444-2448), or the Smith-Waterman algorithm (Smith and Waterman (1981) J. Mol Biol. 147: 195-197), or the TBLASTN program, of Altschul et al. (1990) supra, generally employing default parameters. In particular, the psi-Blast algorithm may be used (Nucl. Acids Res. (1997) 25 3389-3402). Sequence identity and similarity may also be determined using Genomequest? software (Gene-IT, Worcester Mass. USA).
[0128] Sequence comparisons are preferably made over the full-length of the relevant sequence described herein.
[0129] Preferably, a modified procoagulant serpin as described herein comprises the RCL consensus P17 E, P16 S/E/K/R, P15 G, P14 T/S, P12-P9 (A/G/S).sub.4.
[0130] A modified serpin may further comprise one or more residues that are conserved in wild-type serpin sequences. For example, a modified serpin may comprise some or all of the following residues (numbered according to their position in ?1AT): 33F, 49N, 53S, 54P, 56S, 61L, 67G, 72T, 80L, 130F, 147F, 1571, 158N, 161V, 165T, 167G, 1691, 180T, 184L, 186N, 190F, 191K, 192G, 194W, 198F, 203T, 208F, 218V, 220M, 221M, 277Y, 254L, 255P, 289P, 290K, 299L, 303L, 307G, 312F, 316A, 327L, 334H, 342E, 344G, 347A, 369P, 370F, 383L, 384F, 386G, and 391P (Irving et al 2008). The corresponding conserved residues in other serpin sequences may be readily determined using routine sequence analysis.
[0131] Mutations or variations outside the RCL of the modified serpin may include replacement of one or more Cys residues in the modified serpin, such as the C232 (numbering according to the mature sequence) residue of ?.sub.1AT, to abolish disulfide bridge formation or other modifications; deletion or substitution of residues at the N terminus of the wild-type sequence, for example to facilitate expression; or mutation or modification of residues in the heparin binding sites of the modified serpins (i.e. helix D or helix H) in order to alter the heparin binding activity of the modified serpin.
[0132] In some embodiments, the modified serpin may have an N terminal truncation relative to the wild-type serpin. For example, the modified serpin may have a 10 to 30 residue truncation at the N terminus, preferably about 20 residues.
[0133] One or more residues in the modified serpin may be non-natural amino acids, modified amino acids or D-amino acids. The use of such amino acids is well-known to those of skill in the art
[0134] A modified serpin as described herein may display the secondary structure of the wild-type serpin, for example a modified serpin may display a structure comprising 3 beta sheets, 8-9 alpha helices and a flexible RCL of about 20 residues.
[0135] In some preferred embodiments, the modified serpin may consist of the amino acid sequence of a wild-type serpin with one or more mutations in the reactive center loop (RCL) thereof as described herein.
[0136] Preferably, the modified serpin is non-immunogenic in a human. For example, the wild-type serpin may be a human serpin, preferably a human plasma serpin.
[0137] The wild-type serpin may be ?.sub.1-antichymotrypsin (SERPINA3), ?.sub.2-antiplasmin (SERPINF2) antithrombin (ATIII) (SERPINC1), heparin cofactor II (HCII) (SERPIND1), protein C inhibitor (PCI) (SERPINA5), ?.sub.1-antitrypsin (?.sub.1AT) (SERPINA1), Kallistatin (SERPINA4), Plasminogen activator inhibitor-1 (SERPINE1), C1-esterase inhibitor (SERPING1), protease nexin 1 (SERPINE2) or Protein Z-dependent inhibitor (SERPINA10) (Whisstock et al JBC. 285 32 24307-24312, Rau et al Journal of Thrombosis and Hemostasis, 5 (Suppl. 1): 102-115, Huntington, Journal of Thrombosis and Hemostasis, 9 (Suppl. 1): 26-34).
[0138] Preferably, the wild-type serpin is ATIII, HCII, PCI or ?.sub.1AT, most preferably PCI or ?.sub.1AT (Huntington et al Cell. Mol. Life Sci. 66 (2009) 113-121; Li et al JBC. 283 51 36039-36045; and Li et al PNAS 2008 105 4661-4666).
[0139] ?.sub.1-antichymotrypsin (SERPINA3; Gene ID 12) may have the reference amino acid sequence of NP_001076.2 GI:50659080 (SEQ ID NO: 2) and may be encoded by the reference nucleotide sequence of NM_001085.4 GI:73858562.
[0140] C1-esterase inhibitor (SERPING1; Gene ID 710) may have the reference amino acid sequence of NP_000053.2 GI: 73858568 (SEQ ID NO: 3) and may be encoded by the reference nucleotide sequence of NM_000062.2 GI:73858567.
[0141] ?.sub.2-antiplasmin (SERPINF2 Gene ID 5345) may have the reference amino acid sequence of NP_000925.2 GI:115583663 (SEQ ID NO: 4) and may be encoded by the reference nucleotide sequence of NM_001165920.1 GI:260064047
[0142] Antithrombin (ATIII) (SERPINC1 Gene ID 462) may have the reference amino acid sequence of NP_000479.1 GI: 4502261 (SEQ ID NO: 5) and may be encoded by the reference nucleotide sequence of NM_000488.3 GI:254588059
[0143] Heparin cofactor II (HCII) (SERPIND1 Gene ID3053) may have the reference amino acid sequence of NP_000176.2 GI: 73858566 (SEQ ID NO: 6) and may be encoded by the reference nucleotide sequence of NM_000185.3 GI:73858565
[0144] Protein C inhibitor (PCI) (SERPINA5 Gene ID 5104) may have the reference amino acid sequence of NP_000615.3 GI: 194018472 and may be encoded by the reference nucleotide sequence of NM_000624.5 GI:401782581. In some preferred embodiments, the protein C inhibitor (PCI) may be an allelic variant resulting from a substitution at SNP rs6115, VAR 013081 (the S45N variant, numbering according to mature protein including the propeptide) and having the sequence shown in SEQ ID NO: 1. Residues 1-19 of SEQ ID NO: 1 correspond to the signal sequence. In plasma, PCI may exist in a full-length form which includes the propeptide of residues 20-25 of SEQ ID NO: 1 (i.e. residues 20-406 of SEQ ID NO: 1) or N terminally cleaved form which lacks the propeptide (i.e. residues 26-406 of SEQ ID NO: 1).
[0145] ?.sub.1-antitrypsin (?.sub.1AT) (SERPINA1 Gene ID 5265) may have the reference amino acid sequence of NP_000286.3 GI:50363217 (SEQ ID NO: 7) and may be encoded by the reference nucleotide sequence of NM_000295.4 GI:189163524.
[0146] Kallistatin (SERPINA4 Gene ID 5267) may have the reference amino acid sequence of NP_006206.2 GI: 21361302 (SEQ ID NO: 8) and may be encoded by the reference nucleotide sequence of NM_006215.2 GI: 21361301.
[0147] Plasminogen activator inhibitor-1 (SERPINE1 Gene ID 5054) may have the reference amino acid sequence of NP_000593.1 GI: 10835159 (SEQ ID NO: 9) and may be encoded by the reference nucleotide sequence of NM_000602.4 GI: 383286745.
[0148] Protein Z-dependent inhibitor (PZI) (SerpinA10; Gene ID 51156) may have the reference amino acid sequence of NP_057270.1 GI: 7705879 (SEQ ID NO: 10) and may be encoded by the reference nucleotide sequence of NM_016186.2 GI: 154759289.
[0149] Protease nexin 1 (PN1) (SerpinE2; Gene ID 5270) may have the reference amino acid sequence of NP_001130000.1 GI: 24307907, NP_001130002.1 GI: 211904152 or NP_006207.1 GI: 211904156 (SEQ ID NO: 11) and may be encoded by the reference nucleotide sequence of NM_001136528.1 GI: 211904151, NM_001136530.1 GI: 211904155 or NM_006216.3 GI: 211904150.
[0150] The P1, P1, P2 and P4 residues that may be mutated as described above are highlighted in bold in SEQ ID NOS: 1 to 11.
[0151] The one or more mutations in the RCL alter the specificity of the modified serpin relative to the unmodified wild-type serpin. The modified serpin displays increased selectively for anticoagulant proteases over procoagulant proteases compared to the wild-type serpin.
[0152] Preferably, the one or more mutations within the RCL increase the inhibition of APC by the modified serpin relative to the inhibition of other coagulation proteases, in particular one or more procoagulant proteases out of thrombin, fXa, fVIIa, fIXa and fXIa.
[0153] For example, the one or more mutations in the RCL of the modified serpin may increase the inhibition of APC by the modified serpin relative to the inhibition of thrombin. The selective inhibition of APC relative to thrombin may be increased in the presence or absence of heparin.
[0154] In addition, the one or more mutations in the RCL of the modified serpin may increase the inhibition of APC by the modified serpin relative to the inhibition of 1, 2, 3 or all 4 of the procoagulant proteases fXa, fVIIa, fIXa and fXIa.
[0155] A serpin modified as described herein displays greater inhibition of APC relative to thrombin and other procoagulant proteases than the unmodified wild-type serpin.
[0156] The modified serpin may show greater inhibition of APC than inhibition of thrombin. For example, inhibition of APC by the modified serpin may be at least 5 fold more, at least 10 fold more at least 100 or at least 1000 fold more than inhibition of thrombin by the modified serpin. In some embodiments, the modified serpin may inhibit APC with a second-order rate constant (k.sub.2) that is at least 5 fold more, at least 10 fold more at least 100 or at least 1000 fold more than the second-order rate constant for the inhibition of thrombin. Preferably the stoichiometry of inhibition of the modified serpin for APC is 1.
[0157] Preferably, a modified serpin as described herein may bind and inhibit APC but display no binding or inhibition or substantially no binding or inhibition of thrombin.
[0158] The one or more mutations in the RCL may also increase the inhibition of APC relative to the inhibition of 1, 2, 3, or all 4 of fVIIa, fIXa, fXa and fXIa. Inhibition of APC relative to fVIIa, fIXa, fXa and/or fXIa may be increased in the presence or absence of heparin.
[0159] For example, the modified serpin may display greater inhibition of APC relative to 1, 2, 3, or all 4 of fVIIa, fIXa, fXa and fXIa than the wild-type serpin.
[0160] The modified serpin may inhibit APC more than it inhibits fVIIa. For example, inhibition of APC by the modified serpin may be at least 2 fold more, at least 10 fold more, at least 100 more, or at least 1000 fold more than the inhibition of fVIIa by the modified serpin. The modified serpin inhibits APC with a second-order rate constant (k.sub.2) that is at least 2 fold more, at least 10 fold more, at least 100 more, or at least 1000 fold more than the second-order rate constant for the inhibition of fVIIa.
[0161] The modified serpin may inhibit APC more than it inhibits fIXa. For example, inhibition of APC by the modified serpin may be at least 2 fold more, at least 10 fold more, at least 100 more or at least 1000 fold more than the inhibition of fIXa by the modified serpin. The modified serpin inhibits APC with a second-order rate constant (k.sub.2) that is at least 2 fold more, at least 10 fold more, at least 100 more, or at least 1000 fold more than the second-order rate constant for the inhibition of fIXa.
[0162] The modified serpin may inhibit APC more than it inhibits fXa. For example, inhibition of APC by the modified serpin may be at least 1.5 fold more, at least 2 fold more, at least 10 fold more at least 100 or at least 1000 fold more than the inhibition of fXa by the modified serpin. The modified serpin inhibits APC with a second-order rate constant (k.sub.2) that is at least 1.5 fold more, at least 2 fold more, at least 10 fold more, at least 100 more, or at least 1000 fold more than the second-order rate constant for the inhibition of fXa.
[0163] The modified serpin may inhibit APC more than it inhibits fXIa. For example, inhibition of APC by the modified serpin may be at least 2 fold more, at least 10 fold more at least 100 or at least 1000 fold more than the inhibition of fXIa by the modified serpin. The modified serpin inhibits APC with a second-order rate constant (k.sub.2) that is at least 2 fold more, at least 10 fold more, at least 100 more, or at least 1000 fold more than the second-order rate constant for the inhibition of fXIa.
[0164] A modified serpin as described herein may be part of a fusion protein which contains one or more heterologous amino acid sequences additional to the modified serpin sequence. For example, the fusion protein comprising the modified serpin may further comprise one or more additional domains which improve the stability, pharmacokinetic, targeting, affinity, purification and production properties of the modified serpin.
[0165] Suitable additional domains include immunoglobulin Fc domains. Immunoglobulin Fc domains are well-known in the art and include the human IgG1 Fc domain. A human immunoglobulin Fc domain may be located at the N-terminal or C-terminal end of the modified serpin.
[0166] Modified serpins as described herein may be provided using synthetic or recombinant techniques which are standard in the art.
[0167] In some embodiments, the modified serpin may be produced as a fusion protein further comprising an affinity tag, which may, for example, be useful for purification. An affinity tag is a heterologous peptide sequence which forms one member of a specific binding pair.
[0168] Polypeptides containing the tag may be purified by the binding of the other member of the specific binding pair to the polypeptide, for example in an affinity column. For example, the tag sequence may form an epitope which is bound by an antibody molecule.
[0169] Suitable affinity tags include for example, glutathione-S-transferase, (GST), maltose binding domain (MBD), MRGS(H).sub.6 (SEQ ID NO: 13), DYKDDDDK (FLAG?) (SEQ ID NO: 14), T7-, S-(KETAAAKFERQHMDS; SEQ ID NO: 15), poly-Arg (R.sub.5-6) (SEQ ID NOS: 16 and 17), poly-His (H.sub.2-10) (SEQ ID NOS: 18 to 24), poly-Cys (C.sub.4; SEQ ID NO: 25) poly-Phe (F.sub.11) (SEQ ID NO: 26), poly-Asp (D.sub.5-16) (SEQ ID NOS: 27 to 38), SUMO tag (Invitrogen Champion pET SUMO expression system), Strept-tag II (WSHPQFEK; SEQ ID NO: 39), c-myc (EQKLISEEDL; SEQ ID NO: 40), Influenza-HA tag (Murray, P. J. et al (1995) Anal Biochem 229, 170-9), Glu-Glu-Phe tag (Stammers, D. K. et al (1991) FEBS Lett 283, 298-302), Tag.100 (Qiagen; 12 aa tag derived from mammalian MAP kinase 2), Cruz tag 09? (MKAEFRRQESDR (SEQ ID NO: 41), Santa Cruz Biotechnology Inc.) and Cruz tag 22? (MRDALDRLDRLA (SEQ ID NO: 42), Santa Cruz Biotechnology Inc.). Known tag sequences are reviewed in Terpe (2003) Appl. Microbiol. Biotechnol. 60 523-533. In preferred embodiments, a poly-His tag such as (H).sub.6 (SEQ ID NO: 20), His-SUMO tag (Invitrogen Champion pET SUMO expression system), or MRGS(H).sub.6 (SEQ ID NO: 13) may be used.
[0170] The affinity tag sequence may be separated from the modified serpin after purification, for example, using site-specific proteases.
[0171] In some embodiments, the modified serpin may be coupled to an appropriate signal leader peptide to direct secretion of the fusion polypeptide from cell into the culture medium. A range of suitable signal leader peptides are known in the art. The signal leader peptide may be a serpin signal sequence or may be heterologous to the modified serpin i.e. it may be a non-serpin signal sequence. For example, an ?-factor secretion signal or BiP signal sequence may be employed. Preferably, the signal peptide is removed by post-translational processing after expression of the polypeptide.
[0172] Modified serpins as described herein may be isolated, in the sense of being free from contaminants, such as unmodified serpins and other polypeptides and/or serum components.
[0173] Modified serpins as described herein may inhibit one or more activities of activated protein C (APC). For example, modified serpins as described herein may inhibit the proteolytic cleavage of one or more APC substrates, such as fVa or fVIIIa. For example, binding of the modified serpin to APC may result in an at least 5-fold, at least 10-fold, or at least 15-fold decrease in the proteolytic cleavage of fVa, fVIIIa and/or another APC substrate. In some embodiments, binding of APC by the modified serpin may result in no detectable cleavage of fVa or fVIIIa substrate by APC.
[0174] Techniques for measuring APC activity, for example by measuring the proteolytic cleavage of APC substrates in vitro are standard in the art and are described herein. Suitable assays for use in determining APC activity include standard kinetic assays, for example to measure rate constants, and coagulation assays, including thrombin generation assays (TGA).
[0175] Techniques for measuring the activity of procoagulant proteases, for example by measuring the proteolytic cleavage of chromogenic substrates in vitro are standard in the art and are described herein. Suitable assays for use in determining protease activity include standard kinetic assays, for example to measure rate constants, and coagulation assays, including thrombin generation assays (TGA), prothrombin time assays (PT) and activated partial thromboplastin time assays (aPTT).
[0176] In some embodiments, modified serpins as described herein may be further modified by chemical modification, for example by PEGylation, or by incorporation in a liposome, to improve their pharmaceutical properties, for example by increasing in vivo half-life.
[0177] A modified serpin as described herein may be attached to one or more polyethylene glycol (PEG) or other moieties to increase the in vivo half-life of the modified serpin (Cantin et al. 2002, Am. J. Respir. Cell Mol. Biol. 27; 659-665). For example, a modified serpin may be mono-pegylated or poly-pegylated (for example, with 2-6 PEG moieties). Suitable pegylation methods are well known in the art.
[0178] The effect of a modified serpin on coagulation and bleeding may be determined. Suitable techniques are standard in the art. For example, the effect of a modified serpin on thrombin generation may be determined using a thrombin generation assay (TGA) or an activated partial thromboplastin time assay or a prothrombin time assay described herein. Suitable in vivo models include cremaster arteriole laser injury models, FeCl.sub.3 carotid artery models and tail clip assays as described herein. Other suitable coagulation models are well known in the art.
[0179] Other aspects of the invention provide a nucleic acid encoding a modified serpin as described above and a vector comprising such a nucleic acid.
[0180] Suitable vectors can be chosen or constructed, containing appropriate regulatory sequences, including promoter sequences, terminator fragments, polyadenylation sequences, enhancer sequences, marker genes and other sequences as appropriate. Preferably, the vector contains appropriate regulatory sequences to drive the expression of the nucleic acid in mammalian cells. A vector may also comprise sequences, such as origins of replication, promoter regions and selectable markers, which allow for its selection, expression and replication in bacterial hosts such as E. coli.
[0181] Vectors may be plasmids, viral e.g. phage, or phagemid, as appropriate. For further details see, for example, Molecular Cloning: a Laboratory Manual: 3rd edition, Russell et al., 2001, Cold Spring Harbor Laboratory Press. Many known techniques and protocols for manipulation of nucleic acid, for example in preparation of nucleic acid constructs, mutagenesis, sequencing, introduction of DNA into cells and gene expression, are described in detail in Current Protocols in Molecular Biology, Ausubel et al. eds. John Wiley & Sons, 1992.
[0182] A nucleic acid or vector as described herein may be introduced into a host cell.
[0183] Another aspect of the invention provides a recombinant cell comprising a nucleic acid or vector that expresses a polypeptide comprising or consisting of a modified serpin as described above.
[0184] A range of host cells suitable for the production of recombinant modified serpins are known in the art. Suitable host cells may include prokaryotic cells, in particular bacteria such as Escherichia coli and Lactococcus lactis and eukaryotic cells, including mammalian cells such as CHO and CHO-derived cell lines (Lec cells), HeLa, COS, HEK293 and HEK-EBNA cells, amphibian cells such as Xenopus oocytes, insect cells such as Trichoplusia ni, Sf9 and Sf21 and yeast cells, such as Pichia pastoris.
[0185] Techniques for the introduction of nucleic acid into cells are well established in the art and any suitable technique may be employed, in accordance with the particular circumstances. For eukaryotic cells, suitable techniques may include calcium phosphate transfection, DEAE-Dextran, electroporation, liposome-mediated transfection and transduction using retrovirus or other virus, e.g. adenovirus, AAV, lentivirus or vaccinia. For bacterial cells, suitable techniques may include calcium chloride transformation, electroporation and transfection using bacteriophage.
[0186] Marker genes such as antibiotic resistance or sensitivity genes may be used in identifying clones containing nucleic acid of interest, as is well-known in the art.
[0187] The introduced nucleic acid may be on an extra-chromosomal vector within the cell or the nucleic acid may be integrated into the genome of the host cell. Integration may be promoted by inclusion of sequences within the nucleic acid or vector which promote recombination with the genome, in accordance with standard techniques.
[0188] In some embodiment, nucleic acid encoding a modified serpin as described herein may be contained in a vector suitable for administration to an individual e.g. for gene therapy applications. Suitable vectors include retroviral vectors, lentiviral vectors, adenoviral vectors and AAT vectors.
[0189] The introduction may be followed by expression of the nucleic acid to produce the encoded modified serpin. In some embodiments, host cells (which may include cells actually transformed although more likely the cells will be descendants of the transformed cells) may be cultured in vitro under conditions for expression of the nucleic acid, so that the encoded serpin polypeptide is produced. When an inducible promoter is used, expression may require the activation of the inducible promoter.
[0190] The expressed polypeptide comprising or consisting of the modified serpin may be isolated and/or purified, after production. This may be achieved using any convenient method known in the art. Techniques for the purification of recombinant polypeptides are well known in the art and include, for example HPLC, FPLC or affinity chromatography. In some embodiments, purification may be performed using an affinity tag on the polypeptide as described above.
[0191] Another aspect of the invention provides a method of producing a modified serpin comprising expressing a nucleic acid encoding a modified serpin as described above in a host cell and optionally isolating and/or purifying the modified serpin thus produced.
[0192] Polypeptides comprising or consisting of a modified serpin produced as described may be investigated further, for example the pharmacological properties and/or activity may be determined. Methods and means of protein analysis are well-known in the art.
[0193] A modified serpin as described herein, nucleic acid encoding a modified serpin or a recombinant cell expressing a modified serpin, may be useful in therapy. For example, a modified serpin as described herein, nucleic acid encoding a modified serpin or a recombinant cell expressing a modified serpin may be administered to an individual for the treatment of bleeding.
[0194] Whilst a modified serpin may be administered alone, modified serpins will usually be administered in the form of a pharmaceutical composition, which may comprise at least one component in addition to the modified serpin e.g. a nucleic acid encoding the modified serpin or recombinant cell expressing the modified serpin. Thus pharmaceutical compositions may comprise, in addition to the modified serpin, nucleic acid or cell, a pharmaceutically acceptable excipient, carrier, buffer, stabilizer or other materials well known to those skilled in the art. The term pharmaceutically acceptable as used herein pertains to compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgement, suitable for use in contact with the tissues of a subject (e.g., human) without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio. Each carrier, excipient, etc. must also be acceptable in the sense of being compatible with the other ingredients of the formulation. The precise nature of the carrier or other material will depend on the route of administration, which may be by bolus, infusion, injection or any other suitable route, as discussed below.
[0195] In some embodiments, modified serpins, nucleic acids or cells may be provided in a lyophilised form for reconstitution prior to administration. For example, lyophilised serpins may be re-constituted in sterile water and mixed with saline prior to administration to an individual.
[0196] For parenteral, for example sub-cutaneous or intra-venous administration, e.g. by injection, the pharmaceutical composition comprising the modified serpin, nucleic acid or cell may be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability. Those of relevant skill in the art are well able to prepare suitable solutions using, for example, isotonic vehicles, such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection. Preservatives, stabilizers, buffers, antioxidants and/or other additives may be employed as required including buffers such as phosphate, citrate and other organic acids; antioxidants, such as ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens, such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight polypeptides; proteins, such as serum albumin, gelatin or immunoglobulins; hydrophilic polymers, such as polyvinylpyrrolidone; amino acids, such as glycine, glutamine, asparagines, histidine, arginine, or lysine; monosaccharides, disaccharides and other carbohydrates including glucose, mannose or dextrins; chelating agents, such as EDTA; sugars, such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions, such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants, such as TWEEN?, PLURONICS? or polyethylene glycol (PEG). Suitable carriers, excipients, etc. can be found in standard pharmaceutical texts, for example, Remington's Pharmaceutical Sciences, 18th edition, Mack Publishing Company, Easton, Pa., 1990.
[0197] Pharmaceutical compositions and formulations may conveniently be presented in unit dosage form and may be prepared by any methods well known in the art of pharmacy. Such methods include the step of bringing into association the modified serpin with the carrier which constitutes one or more accessory ingredients. In general, the compositions are prepared by uniformly and intimately bringing into association the active compound with liquid carriers or finely divided solid carriers or both, and then if necessary shaping the product.
[0198] Preferably, modified serpins, nucleic acids or cells as described herein are formulated in a pharmaceutical composition for intra-venous or sub-cutaneous administration.
[0199] A pharmaceutical composition comprising a modified serpin, nucleic acid or cell may be administered alone or in combination with other treatments, either simultaneously or sequentially dependent upon the condition to be treated.
[0200] A modified serpin, nucleic acid or cell as described herein may be used in a method of treatment of the human or animal body, including therapeutic and prophylactic or preventative treatment (e.g. treatment before the onset of a condition in an individual to reduce the risk of the condition occurring in the individual; delay its onset; or reduce its severity after onset). The method of treatment may comprise administering a modified serpin to an individual in need thereof.
[0201] An individual suitable for treatment as described above may be a mammal, such as a rodent (e.g. a guinea pig, a hamster, a rat, a mouse), murine (e.g. a mouse), canine (e.g. a dog), feline (e.g. a cat), equine (e.g. a horse), a primate, simian (e.g. a monkey or ape), a monkey (e.g. marmoset, baboon), an ape (e.g. gorilla, chimpanzee, orang-utan, gibbon), or a human.
[0202] In some preferred embodiments, the individual is a human. In other preferred embodiments, non-human mammals, especially mammals that are conventionally used as models for demonstrating therapeutic efficacy in humans (e.g. murine, primate, porcine, canine, or rabbit animals) may be employed. The inhibition of human and murine APC by modified serpins without the inhibition of human or murine thrombin is shown below.
[0203] Administration is normally in a therapeutically effective amount or prophylactically effective amount, this being sufficient to show benefit to a patient. Such benefit may be at least amelioration of at least one symptom. The actual amount administered, and rate and time-course of administration, will depend on the nature and severity of what is being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the composition, the method of administration, the scheduling of administration and other factors known to medical practitioners.
[0204] A composition may be administered alone or in combination with other treatments, either simultaneously or sequentially dependent upon the circumstances of the individual to be treated.
[0205] Prescription of treatment, e.g. decisions on dosage etc, is within the responsibility of general practitioners and other medical doctors and may depend on the severity of the symptoms and/or progression of a disease being treated. Appropriate doses of therapeutic polypeptides are well known in the art (Ledermann J. A. et al. (1991) Int. J. Cancer 47: 659-664; Bagshawe K. D. et al. (1991) Antibody, Immunoconjugates and Radiopharmaceuticals 4: 915-922). Specific dosages may be indicated herein or in the Physician's Desk Reference (2003) as appropriate for the type of medicament being administered may be used. A therapeutically effective amount or suitable dose of a modified serpin may be determined by comparing its in vitro activity and in vivo activity in an animal model. Methods for extrapolation of effective dosages in mice and other test animals to humans are known. The precise dose will depend upon a number of factors, including whether the modified serpin is for prevention or for treatment, the size and location of the area to be treated, the precise nature of the modified serpin and the nature of any detectable label or other molecule attached to the modified serpin.
[0206] A typical modified serpin dose will be in the range of 0.1 mg/kg to 100 mg/kg, for example 1 to 80 mg/kg. For example, a dose in the range 100 ?g to 1 g may be used for systemic applications, and 1 ?g to 1 mg for topical applications. An initial higher loading dose, followed by one or more lower doses, may be administered. This is a dose for a single treatment of an adult patient, which may be proportionally adjusted for children and infants, and also adjusted for other modified serpin formats in proportion to molecular weight. Treatments may be repeated at daily, twice-weekly, weekly or monthly intervals, at the discretion of the physician. The treatment schedule for an individual may be dependent on the pharmocokinetic and pharmacodynamic properties of the modified serpin composition, the route of administration and the nature of the condition being treated.
[0207] Treatment may be periodic, and the period between administrations may be about one week or more, e.g. about two weeks or more, about three weeks or more, about four weeks or more, about once a month or more, about five weeks or more, or about six weeks or more. For example, treatment may be every two to four weeks or every four to eight weeks. Treatment may be given before, and/or after surgery, and/or may be administered or applied directly at the anatomical site of trauma, surgical treatment or invasive procedure. Suitable formulations and routes of administration are described above.
[0208] In some embodiments, modified serpins as described herein may be administered as sub-cutaneous injections. Sub-cutaneous injections may be administered using an auto-injector, for example for long term prophylaxis/treatment.
[0209] In some preferred embodiments, the therapeutic effect of the modified serpin may persist for several half-lives, depending on the dose.
[0210] Modified serpins described herein inhibit APC without inhibiting or substantially inhibiting procoagulant factors, such as thrombin, and may be useful in the treatment of bleeding and bleeding disorders; in particular disorders caused by reduced thrombin generation or increased APC anticoagulant pathway activity.
[0211] Hemostasis is the normal coagulation response to injury i.e. the prevention of bleeding or hemorrhage, for example from a damaged blood vessel. Hemostasis arrests bleeding and hemorrhage from blood vessels in the body. Modified serpins may promote hemostasis i.e. they may promote or increase the arrest of bleeding and hemorrhage from blood vessels in the body, for example in individuals with bleeding disorders or trauma.
[0212] Aspects of the invention provide; a modified serpin as described herein for use in a method of treatment of the human or animal body;
[0213] a modified serpin as described herein for use in a method of treatment of bleeding or the promotion of hemostasis; the use of a modified serpin as described herein in the manufacture of a medicament for the treatment of bleeding or the promotion of hemostasis; and a method of treatment of bleeding or the promotion of hemostasis comprising administering a modified serpin as described herein to an individual in need thereof.
[0214] Bleeding may include bleeding or hemorrhage from blood vessels in the body.
[0215] An individual suitable for treatment with a modified serpin as described herein may have a bleeding disorder.
[0216] Bleeding disorders may be caused or associated with reduced thrombin generation or increased activity of the APC anticoagulant pathway.
[0217] Bleeding disorders may include any heritable or acquired bleeding disorder in which there is reduced thrombin generation, reduced fibrin clot formation or reduced clot stability. For example, bleeding disorders may include congenital deficiencies of factors VII, VIII, X, IX, XI and XIII; combined V and VIII deficiency; prothrombin deficiency; fibrin deficiency; and rare deficiencies of other clotting factors; hemophilia A, B and C; increased bleeding associated with hyperfibrinolysis; increased bleeding due to reduced platelet count or reduced platelet function; and von Willebrand Disease.
[0218] Acquired bleeding disorders may include dilutional coagulopathy associated with major blood loss, bleeding resulting from trauma and surgery and the effects of anticoagulant therapy.
[0219] In some embodiments, the individual may be resistant to exogenous coagulation factors, such as exogenous fVIII or fIX. For example, exogenous fVIII or fIX may elicit an immune response in the individual, for example the production of inhibitory alloantibodies.
[0220] An individual suitable for treatment with a modified serpin as described herein may have an acquired bleeding disorder, such as bleeding related to trauma, surgery or anti-coagulant therapy. For example, an individual suitable for treatment with a modified serpin as described herein may have suffered a trauma; or may have undergone or be undergoing surgery or anti-coagulant therapy. Suitable individuals may be bleeding or at risk of bleeding from one or more blood vessels in the body.
[0221] In some embodiments, a modified serpin as described herein may be useful in the prevention or treatment of i) bleeding in patients with clotting factor alloantibodies; ii) bleeding in patients at high risk of inhibitor development, for example to avoid development of alloantibodies; iii) bleeding in patients with factor VIII deficiency in the absence of inhibitors; iv) bleeding in patients with congenital bleeding disorders, for example a congenital bleeding disorder for which there is no current recombinant optimal replacement therapy, such as severe factor VII deficiency, factor XI deficiency, combined VIII & V deficiency, factor X deficiency and factor V deficiency; v) bleeding in patients with hemophilia, for example patients for whom replacement therapy is inappropriate or unavailable; or vi) acquired bleeding, including bleeding related to trauma, surgery, and anticoagulant therapy.
[0222] Other aspects of the invention provide the use of a modified serpin as described herein as a procoagulant and the use of a modified serpin to inhibit APC in the treatment of bleeding.
[0223] Various further aspects and embodiments of the present invention will be apparent to those skilled in the art in view of the present disclosure.
[0224] Other aspects and embodiments of the invention provide the aspects and embodiments described above with the term comprising replaced by the term consisting of and the aspects and embodiments described above with the term comprising replaced by the term consisting essentially of.
[0225] It is to be understood that the application discloses all combinations of any of the above aspects and embodiments described above with each other, unless the context demands otherwise. Similarly, the application discloses all combinations of the preferred and/or optional features either singly or together with any of the other aspects, unless the context demands otherwise.
[0226] Modifications of the above embodiments, further embodiments and modifications thereof will be apparent to the skilled person on reading this disclosure, and as such these are within the scope of the present invention.
[0227] All documents and sequence database entries mentioned in this specification are incorporated herein by reference in their entirety for all purposes.
[0228] and/or where used herein is to be taken as specific disclosure of each of the two specified features or components with or without the other. For example A and/or B is to be taken as specific disclosure of each of (i) A, (ii) B and (iii) A and B, just as if each is set out individually herein.
[0229] Certain aspects and embodiments of the invention will now be illustrated by way of example and with reference to the figures described above and the tables described below.
[0230] Table 1 shows second-order rate constants for the inhibition of thrombin and APC by A22 PCI (PCI with an N-terminal truncation, starting at Ala22, numbering uses the mature protein sequence, including the propeptide), FL ?.sub.1AT Pitts (full length ?.sub.1AT with the P1R Pittsburgh (Pitts) mutation) and their variants. Standard errors are shown. * The rate constant of inhibition for thrombin by the P2KP1 variant of PCI is an estimate as after initial inhibition, reactions do not appear to approach complete inhibition, potentially due to serpin being shuttled down the substrate pathway or dissociation of the covalent serpin:protease inhibitory complex
[0231] Table 2 shows second-order rate constants for the inhibition of thrombin and APC by PCI and variants in the presence of heparin. Standard errors are shown. * the rate constant of inhibition for thrombin by the P2KP1K variant of PCI is an estimate from the initial slope of the plot of residual thrombin activity versus time. Complete inhibition is not achieved, potentially because of serpin being shuttled down the substrate pathway or dissociation of the covalent serpin:protease inhibitory complex.
[0232] Table 3 shows second-order rate constants for the inhibition of fXa by ?.sub.1AT Pitts and PCI and their variants. Standard errors are shown.
[0233] Table 4 shows second-order rate constants for the inhibition of fXIa by PCI and the PCI P2KP1K variant. APC inhibition is shown for comparison (from Table 1). Standard errors are shown.
[0234] Table 5 shows second-order rate constants for the inhibition of thrombin and APC by PCI variants generated by targeted random mutagenesis. Standard errors are shown. Constants for WT and P2KP1 PCI are shown for comparison. * The rate constant of inhibition for thrombin by the P2KP1 variant of PCI is an estimate as after initial inhibition, reactions do not appear to approach complete inhibition, potentially due to serpin being shuttled down the substrate pathway or dissociation of the covalent serpin:protease inhibitory complex.
[0235] Table 6 shows second-order rate constants for the inhibition of fXIa by FL ?.sub.1AT Pitts C232S and its P2KP1K variant. APC inhibition is shown for comparison (from Table 1). Standard errors are shown.
[0236] Table 7 shows a fraction of the RCL sequences of the PCI variants determined by targeted random mutagenesis to be specific for APC inhibition over thrombin inhibition. Sequences shown are from an initial experiment in which 88 mutants were assessed. The P4, P2 and P1 residues that were varied in this experiment are shown in bold. WT PCI and P2KP1K PCI sequences are shown for comparison.
[0237] Table 8 shows a fraction of the RCL sequences of the PCI variants determined by targeted random mutagenesis to be specific for APC inhibition over thrombin inhibition. Sequences shown are from a larger experiment in which 460 mutants were assessed. The P4, P2 and P1 residues that were varied in this experiment are shown in bold. WT PCI and P2KP1K PCI sequences are shown for comparison.
[0238] Table 9 shows a fraction of the RCL sequences of the ?.sub.1AT variants determined by targeted random mutagenesis to be specific for APC inhibition over thrombin inhibition. Sequences are shown compared to both WT ?.sub.1AT and ?.sub.1AT Pitts. The P2 and P1 residues are shown in bold, the P1 residues are underlined. Prefixes show the library of origin for the particular mutant with mutants denoted P2.nr coming from the P2 variant library P1.nr. coming from the P1 variant library and mutants labelled 1-5.nr. coming from plates 1-5 of the P2P1 variant library.
[0239] Table 10 shows second-order rate constants for the inhibition of thrombin and APC by a subset of variants of ?.sub.1AT determined by targeted random mutagenesis to be more specific for APC than for thrombin. Standard errors are given. The second-order rate constants for thrombin and APC inhibition by FL ?.sub.1AT Pitts C232S P2KP1K and FL ?.sub.1AT Pitts C232S are given for comparison.
[0240] Table 11 shows the results of PT and aPTT assays to investigate inhibition of procoagulant proteases by hits from random mutagenesis on the FL ?.sub.1AT Pitts C232S background. PT assays were performed using 1/4 diluted plasma to increase the sensitivity of the assay and performed in triplicate, except for the reactions shown for FL ?.sub.1AT Pitts C232S P2RP1C, which were performed in duplicate. The error shown is the standard deviation. aPTT assays were single experiments, no error is shown. For both PT and aPTT a buffer only control, where instead of protein, buffer (TBS) was added to the plasma was used as a control. Increases in PT or aPTT with respect to the control are an indication of inhibition of procoagulant proteases. For both PT and aPTT assays, the serpin mutants were used at a 5 ?M concentration. For comparison, the P2K and P1K mutants are shown as an average of triplicates. As shown from inhibition rate constants in Tables 1 and 3, these mutants show high specificity for APC over thrombin, but inhibit fXa significantly.
[0241] They are therefore good comparator for an inhibition of procoagulant proteases other than thrombin. ND indicates not determined.
[0242] Table 12 shows second-order rate constants for the inhibition of fXa by ?.sub.1AT variants from targeted random mutagenesis. The mutants evaluated here showed specificity for APC over thrombin, substantial APC inhibition and showed no prolongation of the PT. Most also showed only minor aPTT prolongation. Because of these features, they were selected for further analysis. For comparison, fXa inhibition by FL ?.sub.1AT Pitts C232S and FL ?.sub.1AT Pitts C232S P2KP1K is also shown (from Table 3).
[0243] Table 13 shows a summary of the characterization of two more mutants of ?.sub.1AT found by combining information from rational and random mutagenesis. FL ?.sub.1AT Pitts C232S and FL ?.sub.1AT Pitts C232S P2KP1K C232S are shown for comparison (data from Tables 1 and 3 and
[0244] Experiments
[0245] The coagulation cascade and the regulatory role of serpins in this cascade are shown in
[0246] Below we describe the conversion of serpins into specific inhibitors of APC for use as procoagulant agents (treatment, prophylaxis, bypassing or synergistic) in the treatment of bleeding disorders such as hemophilia. The modifications described here for both PCI and ?.sub.1AT show as a proof of principle that small changes in these proteins can be used to create specific APC inhibitors.
[0247] PCI was first described as the physiological inhibitor of APC and therefore served as a starting point for these investigations (Suzuki et al, 1983; 1984). However, PCI is promiscuous and also inhibits thrombin, thrombin:TM, fXIa, fXa and TF:fVIIa (Elisen et al, 1998; Mosnier et al, 2001; Suzuki et al, 1984; Fortenberry et al, 2011; Meijers et al, 1988). As a consequence, PCI can function as both a pro- and an anticoagulant. Its activity is regulated by binding to glycosaminoglycans, such as heparin and heparan sulfates (Pratt & Church, 1992; Pratt et al, 1992; Li & Huntington, 2008). For an overview of the role of PCI in the coagulation cascade, see
[0248] ?.sub.1AT is the natural inhibitor of neutrophil elastase (Kalsheker, 1989). Unlike other serpins in the coagulation cascade that have either Arg or Leu at P1, ?.sub.1AT has a Met instead. This makes it a very poor inhibitor of coagulation proteases. Nevertheless, because of the high concentration of ?.sub.1AT in plasma, it is believed to inhibit APC to a physiologically significant degree (Heeb & Griffin, 1988). Mutagenesis of the P1 residue has shown that the use of an Arg or Leu at P1 drastically improves inhibition of coagulation proteases by ?.sub.1AT (Heeb et al, 1990). This is exemplified by the Pittsburgh (M358R (P1R); Pitts) variant of ?.sub.1AT that causes a severe bleeding disorder (Owen et al, 1983).
[0249] To develop serpins specific for inhibition of APC over procoagulant proteases, PCI and ?.sub.1AT Pittsburgh (P1R, ?.sub.1AT Pitts) were used as template serpin scaffolds. All proteins used in this study were expressed from Escherichia coli cultures (Rosetta2(DE3)pLysS, Novagen) using the pETSUMO expression vector (Invitrogen) and purified using a combination of Ni-chromatography, anion-exchange and in the case of PCI, heparin affinity chromatography. The SUMO-tag was subsequently removed by SUMO protease cleavage and the tag removed by tandem Ni-anion exchange chromatography for ?.sub.1AT Pittsburgh (Pitts, P1R) and tandem anion exchange-heparin chromatography for PCI. The PCI construct is N-terminally truncated, starting at Ala22 (A22, numbering according to the mature protein sequence, starting with the propeptide). The ?.sub.1AT Pitts (P1R) construct is full-length (FL) and has an additional C232S mutation to abolish intermolecular disulfide bond formation and other modifications during expression and purification (Yamasaki et al, 2011). Due to the expression vector used, the ?.sub.1AT Pitts construct has a Ser (S) as its first residue instead of a Glu (E). The C232S and E1S mutations are not expected to alter the activity of ?.sub.1AT.
[0250] Lys residues were introduced at different positions into the RCL of PCI and ?.sub.1AT Pittsburgh and the resulting mutants tested for inhibition of thrombin and APC. In the initial stages of this study, inhibitors were not screened or tested for their inhibition of other coagulation proteases on the premise that once thrombin inhibition was abolished in favor of APC inhibition, the inhibitor could potentially be additionally modified if it had significant residual inhibitory activity towards other coagulation proteases. The RCL residues are numbered according to the Schechter-Berger nomenclature for serpins (Schechter & Berger, 1967).
[0251] Rate constants of thrombin and APC inhibition were measured under pseudo-first-order conditions using an excess of serpin over protease (Table 1). Serpin and protease were incubated together for varying lengths of time and the residual activity was determined by adding an excess of chromogenic substrate for the protease (S2238 for thrombin and S2366 for APC). Residual protease activity was then measured by following the absorbance at 405 nm. Plots of residual protease activity over time gave the observed rate constant k.sub.obs. The second-order rate constant, k.sub.2, is the slope of the plot of k.sub.obs versus serpin concentration (fitted using a linear regression model). Standard errors of the slope are shown.
[0252] The lysine mutations introduced at P2 and P1 were highly effective at increasing the specificity of PCI and ?.sub.1AT for APC over thrombin for all variants shown in Table 1. Generally, thrombin inhibition was greatly reduced in all cases. APC inhibition was also reduced for all mutants but not nearly to the same degree. Both serpins initially inhibited thrombin better than APC. This was reversed for all mutants tested.
[0253] PCI, unlike ?.sub.1AT, binds heparin and this binding considerably increases its inhibition of thrombin and APC (Pratt & Church, 1992). We therefore tested the inhibition of thrombin and APC by the P1K and P2KP1K PCI mutants in the presence of heparin to see if the swap in specificity seen in Table 1 would persist. Rate constants were measured under pseudo-first-order conditions using an excess of PCI over protease. PCI was preincubated with an equimolar concentration of unfractionated heparin for 30 min prior to the experiment. PCI:heparin and protease were incubated together for varying lengths of time and the residual activity after certain timepoints determined by adding an excess of chromogenic substrate for the protease mixed with polybrene to bind the heparin. Plots of residual protease activity over time gave the observed rate constant k.sub.obs. The second-order rate constant, k.sub.2, is the slope of the plot of k.sub.obs versus serpin concentration (fitted using a linear regression model). Standard errors of the slope are shown. The value calculated for the inhibition of thrombin by P2KP1K PCI was an estimate from the initial slope of the plot of residual thrombin activity versus time, as the graph suggests that complete inhibition is not achieved. This might be due to the substrate pathway or complex dissociation. The second-order rate constants are shown in Table 2. As for the inhibition in the absence of heparin, the P1K and P2KP1K mutants of PCI, unlike the WT protein were specific for APC over thrombin (Table 2).
[0254] These experiments showed that introducing only one or two modifications in the serpin RCL was sufficient to abolish or greatly reduce the inhibition of thrombin both in the presence and absence of cofactors. The inhibition of APC was reduced but still considerable, especially for the variants of ?.sub.1AT and the PCI variants in the presence of heparin. However, the specificity of PCI and ?.sub.1AT Pitts is not limited to thrombin and APC. Both these serpins also inhibit fXa, another procoagulant protease. In order not to inhibit coagulation, our variants also need to be specific for APC over fXa. We therefore also determined the rate constants of inhibition of PCI and ?.sub.1AT and their variants for fXa (Table 3).
[0255] Rate constants were measured under pseudo-first-order conditions using an excess of serpin over protease. Serpin and protease were incubated together for varying lengths of time and the residual activity determined by adding an excess of chromogenic substrate (S2222) for the protease. Plots of residual protease activity over time gave the observed rate constant k.sub.obs. The second-order rate constant, k.sub.2, is the slope of the plot of k.sub.obs versus serpin concentration (fitted using a linear regression model). Standard errors of the slope are shown (Table 3).
[0256] As seen before for thrombin, WT PCI inhibited fXa better than APC. ?.sub.1AT Pitts inhibited APC better than fXa, but the inhibition of fXa was still considerable. The inhibition of fXa was still significant for P1K PCI, P2K ?.sub.1AT Pitts and P1K ?.sub.1AT Pitts (Table 3). The P2KP1K variants of ?.sub.1AT Pitts and PCI were both highly specific for APC over fXa, with absent or negligible inhibition of fXa and were therefore considered lead candidates. The P1K variant of PCI is also of interest as its inhibition of fXa is very slow in the absence of heparin. The presence of heparin accelerates the rate of APC inhibition significantly, which could potentially skew the specificity ratio in favor of APC.
[0257] The PCI lead compounds will be discussed first, followed by the ?.sub.1AT lead compound.
[0258] To investigate the properties of A22 P2KP1K PCI in a more complex plasma system and to rule out any negative effects on the procoagulant proteases, a prothrombin time assay (PT) was performed. This assay measures the time until clot formation in plasma after coagulation is initiated via the extrinsic pathway. A22 WT PCI showed a small increase in the clotting time, whereas P2KP1K showed a smaller increase, consistent with reduced inhibitory activity towards procoagulant proteases (
[0259] In addition, we wanted to rule out any effect of the PCI mutant on the contact activation pathway of coagulation. To do so, rate constants of inhibition were measured for the inhibition of fXIa and an aPTT assay was done. This assay is similar to the PT assay except that it measures coagulation initiated via the intrinsic pathway.
[0260] Second-order rate constants of inhibition for inhibition of fXIa by PCI and the P2KP1K variant were measured under pseudo-first-order conditions using an excess of serpin over protease. Serpin and protease were incubated together for varying lengths of time and the residual activity determined by adding an excess of chromogenic substrate for the protease (S2366). Plots of residual protease activity over time gave the observed rate constant k.sub.obs. The second-order rate constant, k.sub.2, is the slope of the plot of k.sub.obs versus serpin concentration (fitted using a linear regression model). Standard errors of the slope are given. fXIa inhibition by A22 P2KP1K PCI did not go to completion over the course of the experiment, potentially due to serpin cleavage by the protease. Compared to WT, the P2KP1K mutant showed a much reduced inhibition towards fXIa and greater specificity for APC than for fXIa (Table 4).
[0261] The aPTT assay showed that WT PCI was a potent inhibitor of the contact activation pathway, potentially due to inhibition of fXIa or fXIIa (
[0262] The results shown here so far therefore show that both A22 P1K PCI and A22 P2KP1K PCI are promising, APC-specific lead compounds for development into bypassing agents for the treatment of hemophilia.
[0263] To generate additional PCI mutants with specificity for APC over thrombin, a targeted random mutagenesis strategy was employed on the PCI scaffold. The residues targeted were P4, P2 and P1. The random approach is based on a selection for APC inhibition and against thrombin inhibition by testing inhibitory activity of bacterial lysates, after PCI expression in a 96-well format.
[0264] The assay was calibrated using the most specific PCI mutant generated from the rational mutagenesis combined with the testing for specificity outlined above; A22 P2KP1K PCI. WT PCI was used as an additional control. The negative selection against inhibition of thrombin was achieved by incubating bacterial lysates for a time period such that A22 WT PCI showed complete inhibition and the incubation period extended from that timepoint on to also select against minor inhibition. Positive selection for APC inhibition was calibrated such that both WT and P2KP1K PCI fell into the intermediate range of APC inhibitory activity so we would be able to determine both increases as well as decreases in inhibition.
[0265] In an initial assay, 88 variants were screened for thrombin and APC inhibitory activity. Cultures were grown, induced and protein expressed in 96-well plates. Cells were lysed by the addition of a lysis buffer and the lysates assayed for inhibitory activity against thrombin and APC by incubating the lysate with the protease for 1 h for thrombin and 30 min for APC. Residual protease activity was then read by addition of a chromogenic substrate to the protease. A22 WT PCI and A22 P2KP1K PCI were used as controls. Any lysate with higher or equivalent residual thrombin activity and lower or equivalent residual APC activity compared to P2KP1K PCI was considered to be a promising APC-specific candidate. These sequences are shown in Table 7. P4, P2 and P1 positions are shown in bold.
[0266] The mutant with the greatest APC inhibitory activity from this set of experiments (D8; P4QP2RP1N) was characterized in a preliminary fashion and was shown to be more specific for the inhibition of APC than thrombin, whilst utilizing different mutations than P2KP1K (Table 5). This indicated that it would be possible to make additional mutations in the serpin RCL, which would have equivalent effects to the mutations already described.
[0267] To generate a larger dataset, a further 460 mutants were screened in both the positive and negative selection assays. Cultures were grown, induced and protein expressed in five 96-well plates. Cells were lysed by the addition of a lysis buffer and the lysates assayed for inhibitory activity against thrombin and APC by incubating the lysate with the protease for 1 h for thrombin and 30 min for APC. Residual protease activity was then read by addition of a chromogenic substrate to the protease (S2238 for thrombin, S2366 for APC). A22 WT PCI and A22 P2KP1K PCI were used as controls. Any lysate with higher or equivalent residual thrombin activity and lower or equivalent residual APC activity compared to P2KP1K PCI was considered to be a promising APC-specific candidate. From this dataset, colonies were picked and sequenced for serpins that showed better inhibition of APC and worse or equivalent inhibition of thrombin than P2KP1K and these were retested in triplicate in the same assay to verify that these were indeed true hits and not false positives. From this retest a set of 15 out of the 17 mutants found in the initial screen was determined to be better or equivalent at inhibiting APC than P2KP1K and worse or equivalent at inhibiting thrombin (Table 8). Sequences of variants that were positive after retesting are shown in Table 8. Interestingly, the random mutagenesis confirmed the beneficial effects of positively charged residues in the P2 and P1 positions. However alternative RCL compositions were also found.
[0268] Preliminary second-order rate constants for the inhibition of thrombin and APC by random mutagenesis PCI variants were measured under pseudo first-order conditions using an excess of serpin over protease. Serpin and protease were incubated together for varying lengths of time and the residual activity determined by adding an excess of chromogenic substrate for the protease. Plots of residual protease activity over time gave the observed rate constant k.sub.obs. The second-order rate constant, k.sub.2, is the slope of the plot of k.sub.obs versus serpin concentration (fitted using a linear regression model). WT and P2KP1K are shown for comparison. Rate constants are shown in Table 5. The error shown is the standard error of the slope.
[0269] Preliminary characterization of some of the selected mutants from the random mutagenesis assay showed that the selected mutants were at least functionally equivalent to P2KP1K PCI, and some had a slightly improved rate of APC inhibition (Table 5). These experiments strongly suggest that P2KP1K is not the only composition which could be utilized to generate APC-specific serpins.
[0270] The main lead compound based on ?.sub.1AT Pitts from the rate constants shown in Tables 1 and 3 was FL ?.sub.1AT Pitts C232S P2KP1K. This mutant was shown not to inhibit thrombin and only slowly inhibited fXa, but retained APC inhibition (Tables 1 and 3).
[0271] To investigate the properties of this mutant in a more complex plasma system and to rule out any negative effects on the procoagulant proteases, a prothrombin time assay (PT) was performed. This assay measures the time until clot formation after coagulation is initiated via the extrinsic pathway. As expected, the anticoagulant ?.sub.1AT Pitts showed an increase in clotting time, due to its inhibition of thrombin and fXa (
[0272] The data so far indicated that the P2KP1K mutant of ?.sub.1AT Pitts did not interfere with procoagulant proteases in either the extrinsic (tissue factor) pathway or the common pathway of coagulation. In addition we wanted to determine whether FL ?.sub.1AT Pitts C232S P2KP1K affected the intrinsic (contact activation) pathway. Second-order rate constants of inhibition of fXIa by FL ?.sub.1AT Pitts C232S and the P2KP1K variant were measured under pseudo first-order conditions using an excess of serpin over protease. Serpin and protease were incubated together for varying lengths of time and the residual activity determined by adding an excess of chromogenic substrate for the protease (S2366). Plots of residual protease activity over time gave the observed rate constant k.sub.obs. The second-order rate constant, k.sub.2, is the slope of the plot of k.sub.obs versus serpin concentration (fitted using a linear regression model). Standard errors of the slope are given.
[0273] fXI is activated during the contact activation pathway and it feeds into the common pathway of coagulation by activating fIX. In addition, fXI is activated once coagulation is initiated by thrombin. fXIa was inhibited to a significant degree by FL ?.sub.1AT Pitts C232S, however this inhibition was greatly reduced for FL ?.sub.1AT Pitts C232S P2KP1K (Table 6).
[0274] Because a small degree of inhibition of fXIa by the P2KP1K mutant of ?.sub.1AT Pitts was detected and to determine any potential negative effect on fXIIa, we additionally performed an aPTT assay. This assay is similar to the PT assay except that it measures coagulation initiated via the intrinsic pathway of coagulation. The aPTT could therefore be used to detect any negative effect on fXIa and the contact activation pathway of coagulation. In this assay, plasma incubated with FL ?.sub.1AT Pitts C232S did not clot within the time of the assay except for one reaction with 0.67 ?M serpin (
[0275] To investigate whether the P2KP1K mutant of ?.sub.1AT Pitts was able to inhibit APC in a plasma system, we used a modified thrombin generation assay (TGA). Thrombin generation was measured in human pooled normal plasma (NP) in the presence and absence of recombinant soluble thrombomodulin (TM). This TM was expressed and purified from a HEK-EBNA expression system and comprises the soluble extracellular domain. TM is not normally present in the TGA because physiologically it is a transmembrane protein, present on the endothelial membrane and largely absent from plasma. Therefore, there is no activation of the PC pathway in a normal TGA or other coagulation assays utilizing plasma, such as the PT and aPTT assays. Adding TM to the assay allows PC activation and thereby might give a more realistic picture of thrombin generation in vivo. Assays shown in
[0276] Addition of TM to pooled normal plasma reduced thrombin generation in a concentration-dependent manner. From this experiment we chose two concentrations of TM to knock down thrombin generation to either intermediate levels (1.25 nM TM final assay concentration) or to low levels (10 nM TM final assay concentration). These concentrations were used in subsequent assays to evaluate the ability of FL ?.sub.1AT Pitts C232S P2KP1K to inhibit APC in plasma.
[0277] Addition of FL ?.sub.1AT Pitts C232S to normal human plasma (NP) reduced thrombin generation at all concentrations used, likely due to the inhibition of thrombin as well as fXa (
[0278] In order to perform the same experiments in fVIII- or fIX-deficient plasma, it was necessary to increase the amount of tissue factor (TF) used to initiate the assay because at the baseline conditions (RB trigger only), there was no detectable thrombin generation in factor deficient plasma. To demonstrate the effect of an increase in TF on thrombin generation, the reactions were spiked with different dilutions of TF reagent (Dade Innovin, Siemens) in addition to the RB reagent used to trigger the assay at baseline conditions. The concentration of TF in the Innovin reagent is not disclosed by the manufacturer, however previous measurements have shown it to be around 7.36 nM (Duckers et al, 2010). Increasing the TF trigger shortened lag-time and increased both peak thrombin and endogenous thrombin potential (ETP) in human NP, fVIII-deficient (HA) and fIX-deficient (HB) plasma. From these experiments we chose an Innovin dilution of 1:4,000 in the final reaction to initiate thrombin generation. RB reagent, which contains both phospholipids and TF was added because of the need to add phospholipids to the assay.
[0279] Because the use of factor-deficient plasma required modification of the assay parameters, we repeated the TM titration experiment for human normal pooled plasma in human HA plasma with the addition of 1:4,000 Innovin. The assay was performed in human fVIII-deficient plasma (less than 1% fVIII activity) from George King Biomedical. Coagulation was initiated by the addition of CaCl.sub.2 and/or TF/phospholipid (RB low TF and phospholipid reagent, Technoclone) with 1:4,000 final dilution of Dade Innovin (Siemens) to activate coagulation through the extrinsic pathway. Thrombin generation was measured through the cleavage of a fluorogenic substrate (Z-Gly-Gly-Arg-AMC). Fluorescence units were converted to thrombin concentration by calibrating fluorescence units against known concentrations of thrombin, using the Technothrombin calibration kit (Technoclone). Thrombomodulin (TM) was found to reduce thrombin generation in the thrombin generation assay (TGA) in fVIII-deficient plasma (HA).
[0280] From this experiment, 1.25 nM and 5 nM TM were selected for subsequent experiments. The high TM concentration used was lower than for NP, mainly because the total thrombin generation in HA plasma in the assay conditions used was lower.
[0281] The effects of both FL ?.sub.1AT Pitts C232S and FL ?.sub.1AT Pitts C232S P2KP1K on HA and HB plasma were comparable to the results from pooled NP. FL ?.sub.1AT Pitts inhibited thrombin generation in the presence and absence of TM in both HA (fVIII-deficient) and HB plasma (fIX-deficient) (
[0282] In order to verify our in vitro data we wanted to use in vivo mouse models of hemophilia. However, to verify that the effect of human ?.sub.1AT on mouse plasma would be comparable to the effect seen in human plasma we first performed a TGA in mouse plasma. This was done using a modified TGA protocol (Bunce et al, 2011; Ivanciu et al, 2011). These modifications were necessary because of the increased concentrations of inhibitory proteins in mouse plasma that preclude TGA assays under standard conditions (Tchaikovski et al, 2007; Bunce et al, 2011; Ivanciu et al, 2011). Comparable to the human system, there was no thrombin generation in HB mouse plasma under the baseline conditions of the assay. Therefore, we performed a titration spiking in different concentrations of Innovin. A concentration of 1:12,000 Innovin was chosen for subsequent assays.
[0283] Because no murine TM was available, we used soluble human TM as used in the human plasma TGAs to promote APC formation in the mouse TGA assay. The concentration required to see any effect of human TM in HB mouse plasma was ?100-fold higher than seen in human plasma. This could be explained by the observation that human TM knock-in mice show reduced ability to activate murine PC (Raife et al, 2011). This indicated that human TM is less potent at promoting murine PC activation than murine TM. A concentration of 750 nM human TM was used in subsequent experiments.
[0284] Different concentrations of both FL ?.sub.1AT Pitts C232S and FL ?.sub.1AT Pitts C232S P2KP1K were then added to the determined conditions in mouse HB plasma both in the absence and presence of TM to compare the effect of these mutants in mouse plasma to the previous TGA results in human plasma.
[0285] FL ?.sub.1AT Pitts C232S reduced thrombin generation in mouse HB plasma in the absence of TM as seen in human plasma (
[0286] To investigate a potential in vivo effect of FL ?.sub.1AT Pitts C232S P2KP1K and to determine if it could potentially be useful as either a prophylactic agent or a treatment for hemophilia we used two in vivo mouse assays; tail clip and a cremaster arteriole laser injury model. The mice used were male, fIX knockout mice on the BALB/c background (Lin et al, 1997; Ivanciu et al, 2011).
[0287] In the tail clip assay, protein or buffer was injected through the tail vein and after a 5 min incubation period, the tail was transected at a diameter of 3 mm and placed in 14 ml 37? C. saline solution in a 37? C. water bath. Blood was collected for 10 min and the resulting blood loss was quantified by measuring total hemoglobin after red cell lysis by measuring absorbance at 575 nm (Ivanciu et al, 2011). The volume blood loss was calculated by making a standard curve where known volumes of blood collected by tail transection were processed in a similar manner to the tail clip samples. After red cell lysis, the absorbance at 575 nm was determined and plotted against the volume blood loss to generate the standard curve. Tail clip assays showed a potent procoagulant effect of FL ?.sub.1AT Pitts C232S P2KP1K (
[0288] Another in vivo model used for evaluating procoagulant agents is the intravital cremaster arteriole laser-induced injury model (Falati et al, 2002). In this system, a cannula is inserted into the mouse jugular vein to allow infusion of the therapeutic protein as well as fluorescently-tagged antibodies to fibrin and platelets. The cremaster muscle is then spread out for imaging. Clot formation after laser-induced injury to the arterioles is imaged and quantified using fluorescence microscopy.
[0289] For an overall qualitative assessment, injuries were sorted into three categories: no clot (no fluorescence detected), platelet clot (only platelets visible, these clots were generally unstable and dissolved over the course of the imaging) and platelets+fibrin (both platelet and fibrin fluorescence visible and clot remained stable over the course of the imaging). This showed that there was a dose-dependent increase in stable platelet and fibrin clot formation with increasing concentration of FL ?.sub.1AT Pitts C232S P2KP1K (
[0290] Taken together, these results show that FL ?.sub.1AT Pitts C232S P2KP1K has a procoagulant effect in both in vitro assays and in vivo models of hemophilia. The in vivo experiments were all done in mouse models of hemophilia B, however TGA results in human plasma (
[0291] A targeted random mutagenesis strategy was also employed on the ?.sub.1AT scaffold in order to explore potential additional APC specific mutants on the ?.sub.1AT scaffold.
[0292] Three different ?.sub.1AT variant libraries were generated on the FL ?.sub.1AT Pitts C232S background: one randomised at P2, one randomised at P1 and a third library randomised at both P2 and P1. The resulting plasmid libraries were transformed into the Rosetta2(DE3)pLysS expression strain and protein expressed in 96-well plates. Bacteria were lysed and the lysates assayed for thrombin and APC inhibition.
[0293] For the single variant libraries, 88 colonies were assayed per library. For the double (P2P1) variant library, 460 colonies were assayed. FL ?.sub.1AT Pitts and FL ?.sub.1AT Pitts P2KP1K (the lead APC specific variants) were expressed on all assay plates as a reference. Variants with higher or equal APC inhibitory activity (lower or equal residual APC activity) and lower or equal thrombin inhibitory activity (higher or equal residual thrombin activity) compared to P2KP1K ?.sub.1AT were deemed candidates for variants specific for APC over thrombin. A subset of candidate variants was picked and re-assayed in the same setup to verify the results from the first screen. Mutants showing similar properties in both assays were then sequenced. The resulting sequences are shown in Table 9. To verify the ability of this assay to pick out variants, which were specific for APC over thrombin, nine variants identified in Table 9 were expressed on a larger scale in E. coli and purified. The second-order rate constant of inhibition with respect to thrombin and APC was then determined for each mutant. The results are shown in Table 10. These results confirmed that all variants tested had a higher specificity for APC than for thrombin unlike the FL ?.sub.1AT Pitts C232S variant.
[0294] Certain types of residues were favored in the ?.sub.1AT Pitts scaffold at both P2 and P1 positions (Table 9). Specificity was primarily conferred by the presence of bulky polar (Q, N, Y) bulky hydrophobic (W) or positively charged residues (R, H, K) at P2 and P1. Other residues seen at these positions included C, A, T, S and V. These medium to small residues were accompanied in the double variant library by a complementing large positively charged residue (R, K) or large polar residue (Y, N, Q) at the other position, which likely has a larger influence on the specificity swap. However, there may be a cooperative effect of these mutations as well, especially where the P1 is R. P1R showed variable results in the single variant library screen and may have some residual thrombin inhibitory activity. The P2 P is known to be important for thrombin cleavage of substrates (Gallwitz et al, 2012). Simple removal of this residue coupled to a specificity swapping mutation at P1 may be sufficient to generate an APC specific inhibitor with little residual thrombin inhibitory activity. Especially T at P2 might have some effect on its own as, out of its partnering residues at P1 (Q, N, Y, R), only R was identified in the single residue P1 variant library as being sufficient to cause a specificity swap by itself.
[0295] Interestingly, non-specific mutants that clustered around the ?.sub.1AT Pitts control were shown to be largely ?.sub.1AT Pitts. All retained the P2 P, showing its importance in maintaining thrombin inhibitory activity. The P1 was more variable, consistent with the distribution of mutants in the P1 variant library. Comparing the spread of variants in the P2 and P1 libraries, thrombin seemed to be more tolerant to P1 than to P2 mutations. However, the appearance of favorable residues in the double variant libraries that were not present in the single variant libraries indicate that the effects of these residues on specificity may be cooperative and double mutations may be more effective than single mutations at increasing specificity.
[0296] The random mutagenesis results presented above showed that it was possible to generate mutants that showed specificity for APC over thrombin other than the lysine mutants already identified. So far, the random mutagenesis strategy was used, assuming that once specificity over thrombin was obtained, these mutants would also show some degree of specificity for APC over other procoagulant proteases. To test this, the PT and aPTTs of the random mutants in Table 10 were tested. These results are displayed in Table 11. None of the mutants had a significant effect on the PT, unlike previously shown for FL ?1AT Pitts C232S (
[0297] From these results, we selected four mutants, P2R, P2QP1K, P2KP1H and P2KP1N (all on the Pitts, P1R background). These showed either a high inhibition of APC over thrombin (Table 10) and for some also a low prolongation of the aPTT (P2KP1H and P2KP1N). Because they did not prolong the PT, it is unlikely that they inhibit TF:fVIIa. The most likely candidates for prolongation of the aPTT would be inhibition of fXIa or fXa. Of these, fXa inhibition would most inhibit the initial stages of coagulation and was therefore considered to be a more significant barrier for a successful inhibitor. Inhibition constants for the inhibition of fXa by these four mutants were therefore determined as described above (Table 12). P2R showed significant inhibition of fXa, which may be the reason for its prolongation of the aPTT. The other three mutants showed lower fXa inhibition, but none of the mutants were as specific as the previously identified P2KP1K mutant. Nevertheless, P2KP1N, P2QP1K and P2KP1H represent additional promising candidates for further development as they show specificity for APC over thrombin and fXa. In addition, their inhibition of APC is roughly 2-fold increased with respect to the P2KP1K mutant described earlier. This faster inhibition might in part compensate for the slightly reduced specificity.
[0298] However, these results indicated that selecting for specificity for APC over thrombin is not completely sufficient to design an inhibitor which also shows specificity over fXa and other procoagulant proteases. Therefore, the random mutagenesis strategy was extended further. Mutants, which previously had been selected for specificity for APC over thrombin, were rescreened against fXa and mutants selected, which had reduced fXa inhibition, while maintaining low thrombin inhibition and APC inhibition.
[0299] Four additional mutants were identified from this additional screen. These all had the P1R mutation and in addition had either P2RP1A, P2RP1Q, P2WP1I or P2WP1H. To verify the specificity of these mutants, an initial experiment was performed, using only one concentration of serpin and testing its inhibition of thrombin and fXa. APC inhibition was not considered at this stage, because mutants were selected based on their low inhibition of thrombin and fXa. Serpin and protease were incubated for different times and at the indicated timepoints, the reaction was stopped by addition of an excess of chromogenic substrate. Residual protease activity was divided by the initial protease activity and the natural log of this value plotted against time (
[0300] Only one mutant showed significant selectivity against both thrombin and fXa. This mutant had a P2RP1Q in addition to the Pitts (P1R) mutation. Because of its selectivity, it was interesting for more thorough investigation. Previous results from both the random and rational mutagenesis studies indicated that R and K residues perform reasonably similarly. We therefore also generated a P2KP1Q mutant on the P1R background as it was expected from the results shown here to have similar properties. The results from measurements of inhibition constants and aPTTs (experiments performed as described before) for both mutants are shown in Table 13. The P2KP1K mutant is shown for comparison. Both P2KP1Q and P2RP1Q showed very low inhibition of thrombin and fXa. In addition, there was also hardly any effect on the aPTT. APC inhibition was significant, being only slightly reduced in comparison to P2KP1K. Therefore, these two mutants would be expected to perform similarly to P2KP1K and may represent other potentially promising alternative molecules for further development.
[0301] We evaluated inhibition of murine thrombin and APC by FL ?.sub.1AT Pitts C232S P2KP1K. Thrombin and APC were obtained from recombinant sources. The proteases used are truncated with respect to the plasma version, including only the EGF2-protease domains for APC (Gla-domainless APC) and the protease domain for thrombin. Therefore, we also tested the human versions of these proteases to ensure that any differences were due to a species difference, rather than a construct difference. Human and murine thrombin showed none or very little reactivity with FL ?.sub.1AT Pitts C232S P2KP1K by SDS-PAGE, indicating that in this respect, results from model systems would be relevant to the human system. Second-order rate constants of inhibition were (8.14?0.58)?10.sup.3 M.sup.?1.Math.s.sup.?1, for human Gla-domainless APC, (3.80?0.37)?10.sup.3 M.sup.?1.Math.s.sup.?1 for murine Gla-domainless APC, compared to (14.88?1.87)?10.sup.3 M.sup.?1.Math.s.sup.?1 for human plasma APC. These results provided indication that while the reactivity of the mutant in mouse models would likely be lower than in humans, i.e. the relative dose for the same effect might need to be higher, the effect in terms of protease inhibition is likely to be similar.
[0302] The data presented show as a proof-of-principle that the serpin scaffold can be used to generate specific APC inhibitors, using only very few mutations, that these inhibitors can have procoagulant activities both in vitro and in vivo and as such show promise as procoagulant agents for treatment and prophylaxis of bleeding disorders such as hemophilia.
REFERENCES
[0303] Berntorp E (2009) Haemophilia 15: 3-10 [0304] Bertina R M, et al (1994) Nature 369: 64-67 [0305] Bohn R L et al (2004) Haemophilia 10: 63-68 [0306] Bolton-Maggs P H B & Pasi K J (2003) Lancet 361: 1801-1809 [0307] Brettler D B (1996) Baillieres Clin. Haematol. 9: 319-329 [0308] Brummel-Ziedins K E et al (2011) J. Thromb. Haemost. 9: 2262-2267 [0309] Bunce M W et al (2011). Blood 117: 290-298 [0310] Butenas S et al (2006) J. Thromb. Haemost. 4: 2411-2416 [0311] Carrell R et al (1985) Trends in Biochemical Sciences 10: 20-24 [0312] Chuansumrit A et al (2000) Haemophilia 6: 61-65 [0313] De Nanteuil G et al (2006) J. Med. Chem. 49: 5047-5050 [0314] Di Minno M N D et al (2010) Haemophilia 16: e190-201 [0315] DiMichele D (2007) J. Haematol. 138: 305-315 [0316] Duckers C et al (2010) Blood 115: 879-886 [0317] Elisen MGLM et al (1998) Blood 91: 1542-1547 [0318] Escobar M A (2010) Haemophilia 16 Suppl 3: 29-34 [0319] Escobar M & Sallah S et al (2013) J. Thromb. Haemost. 11, 1449-1453. [0320] Falati S et al (2002) Nat. Med. 8: 1175-1181 [0321] Fortenberry Y M et al (2011) J. Thromb. Haemost. 9: 861-863 [0322] Franchini M & Lippi G (2010) Thrombosis Research 125: 119-123 [0323] Fukudome K et al (1996) J. Biol. Chem. 271: 17491-17498 [0324] Gallwitz et al (2012) PLoS ONE 7(2): e31716 [0325] Gettins P G W (2002) Chem. Rev. 102: 4751-4803 [0326] Gringeri A et al (2003) Blood 102: 2358-2363 [0327] Haya S et al (2007) Haemophilia 13 Suppl 5: 52-60 [0328] Heeb M J & Griffin J H (1988) J. Biol. Chem. 263: 11613-11616 [0329] Heeb M J et al (1990) J. Biol. Chem. 265: 2365-2369 [0330] Hopkins et al (1993) Biochemistry 32; 7650-7657 [0331] Hua B et al (2009) Haematologica 94: 881-884 [0332] Huntington J A et al (2000) Nature 407: 923-926 [0333] Irving et al (2000) Genome Res. 10; 1845-1864 [0334] Ivanciu L et al (2011) Nat. Biotechnol. 29: 1028-1033 [0335] Kalsheker N (1989) Biosci. Rep. 9: 129-138 [0336] Laurell C B et al (1977) Clin Sci Mol Med 52: 457-461 [0337] Laurell M et al (1990) Blood 76: 2290-2295 [0338] Lee M et al (2006) Haemophilia 12 Suppl 3: 1-7 [0339] Li W & Huntington J A (2008) J. Biol. Chem. 283: 36039-36045 [0340] Li W et al (2008) Proc. Natl. Acad. Sci. U.S.A. 105: 4661-4666 [0341] Lin H F et al 1997) Blood 90: 3962-3966 [0342] Lowe, G. D. & Ludlam, C. A. (2008) J. Thromb. Haemost. 6, 1982-1983. [0343] Lu D et al (1996) Blood 87: 4708-4717 [0344] Mannucci P M (2003) J. Thromb. Haemost. 1: 1349-1355 [0345] Mannucci P M (2008) Haemophilia 14 Suppl 3: 10-18 [0346] Mather T et al (1996) EMBO J 15: 6822-6831 [0347] Meijers J C et al 1988) Biochemistry 27: 4231-4237 [0348] Mosnier L O et al (2001) Thromb. Haemost. 86: 1057-1064 [0349] Nagel K. et al (2011) Haemophilia, 17, 872-874. [0350] Negrier C et al 2006) Haemophilia 12 Suppl 6: 48-52-discussion 52-3 [0351] Owen M C et al (1983) N. Engl. J. Med. 309: 694-698 [0352] Pratt C W & Church F C (1992) J. Biol. Chem. 267: 8789-8794 [0353] Pratt C W et al (1992) J. Biol. Chem. 267: 8795-8801 [0354] Raife T J et al (2011) Arterioscler. Thromb. Vasc. Biol. 31: 2509-2517 [0355] Schechter I et al (1967)Biochem Biophys Res Comm 27: 157-162 [0356] Stearns-Kurosawa D J et al (1996) PNAS. U.S.A. 93: 10212-10216 [0357] Suzuki K et al (1983) J. Biol. Chem. 258: 163-168 [0358] Suzuki K et al (1984) Journal of Biochemistry 95: 187-195 [0359] Tagariello, G et al (2009) Blood, 114, 779-784. [0360] Tchaikovski S N et al (2007) J. Thromb. Haemost. 5: 2079-2086 [0361] Teitel J M (1999) Haemophilia 5 Suppl 3: 43-49 [0362] Teitel, J M & Sholzberg, M (2013) Blood Reviews 27 103-109 [0363] Turecek P L, et al (2004) Haemophilia 10 Suppl 2: 3-9 [0364] Ullman M et al (2006) Haemophilia 12 Suppl 6: 74-9; discussion 79-80 World Federation of Hemophilia (2011) 2010 WFH Global Survey Report [0365] Yamasaki M et al (2011) EMBO Rep. 12: 1011-1017 [0366] Zechmeister-Machhart M et al (1996) Immunopharmacology 32: 96-98
TABLE-US-00001 TABLE 1 Second-order rate constants of inhibition (mM.sup.?1 .Math. s.sup.?1) Fold inhibition Variant Thrombin APC APC/thrombin A22 WT PCI 28.21 ? 1.51 0.68 ? 0.032 0.02 A22 P1K PCI 0.022 ? 0.0024 0.88 ? 0.074 40 A22 P2KP1K PCI ~0.03* 0.28 ? 0.013 9.3 FL ?.sub.1AT Pitts 292.76 ? 17.60 108.16 ? 7.086 0.4 C232S FL ?.sub.1AT Pitts 0.051 ? 0. 0028 64.82 ? 7.14 1,271 C232S P2K FL ?.sub.1AT Pitts 0.17 ? 0.017 95.66 ? 13.70 563 C232S P1K FL ?.sub.1AT Pitts no inhibition 15.14 ? 1.68 no thrombin C232S P2KP1K after 4 h inhibition
TABLE-US-00002 TABLE 2 Second-order rate constants of inhibition (mM.sup.?1 .Math. s.sup.?1) Thrombin + Fold inhibition Variant heparin APC + heparin APC/Thrombin A22 WT PCI 1310.32 ? 218.72 564.47 ? 71.29 0.4 A22 P1K PCI 0.017 ? 0.0019 321.54 ? 31.94 18914 A22 P2KP1K PCI 0.11 ? 0.040* 146.38 ? 18.85 1331.7
TABLE-US-00003 TABLE 3 Second-order rate constants of inhibition (mM.sup.?1 .Math. s.sup.?1) Fold inhibition Variant fXa APC/fXa A22 WT PCI 10.31 ? 0.73 0.07 A22 P1K PCI 0.52 ? 0.079 1.7 A22 P2KP1K PCI no detectable no fXa inhibition inhibition FL ?.sub.1AT Pitts C232S 41.33 ? 2.36 2.6 FL ?.sub.1AT Pitts C232S P2K 3.93 ? 0.31 16.5 FL ?.sub.1AT Pitts C232S P1K 4.89 ? 0.16 19.6 FL ?.sub.1AT Pitts C232S P2KP1K 0.12 ? 0.010 126.2
TABLE-US-00004 TABLE 4 Second-order rate constants of inhibition (mM.sup.?1 .Math. s.sup.?1) Inhibition of Variant fXIa APC APC/fXIa A22 WT PCI 8.59 ? 0.43 0.68 ? 0.032 0.08 A22 P2KP1K PCI 0.023 ? 0.0052 0.28 ? 0.013 12.2
TABLE-US-00005 TABLE 5 Second-order rate constants of inhibition (mM.sup.?1 .Math. s.sup.?1) Inhibition of Variant Thrombin APC APC/Thrombin A22 WT PCI 28.21 ? 1.51 0.68 ? 0.032 0.02 A22 P2KP1K PCI ~0.03* 0.28 ? 0.013 9.3 A22 D8 PCI 0.084 ? 0.0016 1.00 ? 0.15 11.9 (P4QP2RP1N) A22 4.H11 PCI 0.021 ? 0.0012 0.45 ? 0.15 21.4 (P4KP2RP1H) A22 2.B10 PCI 0.016 ? 0.00090 0.43 ? 0.0086 26.9 (P4SP2LP1K) A22 5.E12 PCI 0.023 ? 0.0021 0.26 ? 0.035 11.3 (P4HP2RP1V)
TABLE-US-00006 TABLE 6 Second-order rate constants of inhibition (mM.sup.?1 .Math. s.sup.?1) Inhibition of Variant fXIa APC APC/fXIa FL ?.sub.1AT Pitts C232S 398.88 ? 13.012 108.16 ? 7.086 0.3 FL ?.sub.1AT Pitts C232S 0.47 ? 0.037 15.14 ? 1.68 32.2 P2KP1K
TABLE-US-00007 TABLE 7 P6 P5 P4 P3 P2 P1 P1 P2 P3 P4 WT SEQ ID NO: T I F T F R S A R L 43 P2KP1K SEQ ID NO: T I F T K R K A R L 44 E7 SEQ ID NO: T I S T H R R A R L 45 E10 SEQ ID NO: T I R T Q R V A R L 46 E11 SEQ ID NO: T I T T L R Y A R L 47 D8 SEQ ID NO: T I Q T R R N A R L 48 H11 SEQ ID NO: T I A T Q R Y A R L 49
TABLE-US-00008 TABLE 8 P6 P5 P4 P3 P2 P1 P1 P2 P3 P4 WT SEQ ID NO: 43 T I F T F R S A R L P2KP1K SEQ ID NO: 44 T I F T K R K A R L 2.B10 SEQ ID NO: 50 T I S T L R K A R L 3.B11 SEQ ID NO: 51 T I F T F R R A R L 3.C3 SEQ ID NO: 52 T I V T R R I A R L 3.E8 SEQ ID NO: 53 T I F T R R K A R L 3.G10 SEQ ID NO: 54 T I C T L R K A R L 3.G11 SEQ ID NO: 55 T I W T W R N A R L 3.H11 SEQ ID NO: 55 T I W T W R N A R L 4.E4 SEQ ID NO: 56 T I K T D R M A R L 4.F7 SEQ ID NO: 57 T I F T V R K A R L 4.F10 SEQ ID NO: 58 T I R T R R I A R L 4.H7 SEQ ID NO: 59 T I G T I R R A R L 4.H11 SEQ ID NO: 60 T I K T R R H A R L 5.D2 SEQ ID NO: 62 T I T T R R V A R L 5.E7 SEQ ID NO: 62 T I L T R R I A R L 5.E12 SEQ ID NO: 63 T I H T R R V A R L
TABLE-US-00009 TABLE 9 P6 P5 P4 P3 P2 P1 P1 P2 P3 P4 ?.sub.1AT WT SEQ ID NO: 64 L E A I P M S I P P ?.sub.1AT Pitts SEQ ID NO: 65 L E A I P R S I P P P2.G11 SEQ ID NO: 66 L E A I K R S I P P P2.F10 SEQ ID NO: 67 L E A I R R S I P P P2.D8 SEQ ID NO: 66 L E A I K R S I P P P2.G8 SEQ ID NO: 67 L E A I R R S I P P P2.E7 SEQ ID NO: 67 L E A I R R S I P P P2.D10 SEQ ID NO: 67 L E A I R R S I P P P2.G4 SEQ ID NO: 67 L E A I R R S I P P P2.F4 SEQ ID NO: 67 L E A I R R S I P P P1.H8 SEQ ID NO: 68 L E A I P R E I P P P1.A11 SEQ ID NO: 69 L E A I P R R I P P P1.F10 SEQ ID NO: 68 L E A I P R E I P P P1.F9 SEQ ID NO: 70 L E A I P R K I P P P1.F4 SEQ ID NO: 68 L E A I P R E I P P 4.G9 SEQ ID NO: 71 L E A I T R N I P P 4.G4 SEQ ID NO: 72 L E A I Q R K I P P 3.E5 SEQ ID NO: 73 L E A I R R A I P P 3.B6 SEQ ID NO: 74 L E A I S R R I P P 3.B2 SEQ ID NO: 75 L E A I K R N I P P 3.A10 SEQ ID NO: 76 L E A I T R Y I P P 2.H1 SEQ ID NO: 77 L E A I R R H I P P 2.C6 SEQ ID NO: 78 L E A I T R R I P P 1.H10 SEQ ID NO: 79 L E A I V R R I P P 1.B11 SEQ ID NO: 80 L E A I R R C I P P 1.A12 SEQ ID NO: 81 L E A I K R H I P P 2.E5 SEQ ID NO: 78 L E A I T R R I P P 3.G9 SEQ ID NO: 82 L E A I Y R R I P P 3.F4 SEQ ID NO: 83 L E A I A R R I P P 3.C9 SEQ ID NO: 84 L E A I C R K I P P 2.H5 SEQ ID NO: 75 L E A I K R N I P P 2.E7 SEQ ID NO: 85 L E A I W R N I P P 1.B2 SEQ ID NO: 86 L E A I S R R I P P 5.C12 SEQ ID NO: 87 L E A I H R N I P P 5.A6 SEQ ID NO: 88 L E A I R R N I P P 4.E1 SEQ ID NO: 70 L E A I P R K I P P 4.C12 SEQ ID NO: 89 L E A I N R N I P P 3.F8 SEQ ID NO: 90 L E A I T R M I P P 3.C10 SEQ ID NO: 91 L E A I T R H I P P 2.E8 SEQ ID NO: 92 L E A I K R S I P P 1.H9 SEQ ID NO: 93 L E A I T R Q I P P
TABLE-US-00010 TABLE 10 Second-order rate constants of inhibition (mM.sup.?1 .Math. s.sup.?1) Inhibition of Variant Thrombin APC APC/thrombin FL ?.sub.1AT Pitts 292.76 ? 17.60 108.16 ? 7.086 0.4 C232S FL ?.sub.1AT Pitts no inhibition 15.14 ? 1.68 No thrombin C232S P2KP1K after 4 h inhibition FL ?.sub.1AT Pitts 0.042 ? 0.0024 61.12 ? 6.26 1455.2 C232S P2R FL ?.sub.1AT Pitts 0.68 ? 0.068 131.57 ? 13.32 193.5 C232S P1R FL ?.sub.1AT Pitts 0.15 ? 0.015 2.99 ? 0.29 19.9 C232S P1E FL ?.sub.1AT Pitts 0.27 ? 0. 047 62.37 ? 2.46 231.0 C232S P2TP1N FL ?.sub.1AT Pitts 0.023 ? 0.0014 5.70 ? 0.83 247.8 C232S P2TP1Y FL ?.sub.1AT Pitts 0.0038 ? 0.0013 33.41 ? 6.36 8792.1 C232S P2QP1K FL ?.sub.1AT Pitts no inhibition 28.84 ? 3.05 No thrombin C232S P2KP1H after 2 h inhibition FL ?.sub.1AT Pitts 0.015 ? 0.0026 37.80 ? 2.48 2520.0 C232S P2KP1N FL ?.sub.1AT Pitts 0.034 ? 0.0094 24.55 ? 2.15 722.1 C232S P2RP1C
TABLE-US-00011 TABLE 11 Variant PT (s) aPTT (s) Plasma 27.2 ? 0.8 60.3 FL ?.sub.1AT Pitts C232S P2K 27.0 ? 0.5 107.2 FL ?.sub.1AT Pitts C232S P1K 27.1 ? 0.4 228.1 FL ?.sub.1AT Pitts C232S P2R 27.8 ? 0.4 111.6 FL ?.sub.1AT Pitts C232S P1R 28.1 ? 0.5 287 FL ?.sub.1AT Pitts C232S P1E 27.2 ? 0.4 84 FL ?.sub.1AT Pitts C232S P2TP1N 29.5 ? 0.9 >300 FL ?.sub.1AT Pitts C232S P2TP1Y 28.3 ? 0.8 185.4 FL ?.sub.1AT Pitts C232S P2QP1K 27.9 ? 0.3 111.5 FL ?.sub.1AT Pitts C232S P2KP1H 27.4 ? 0.9 77.8 FL ?.sub.1AT Pitts C232S P2KP1N 27.8 ? 0.3 81.9 FL ?.sub.1AT Pitts C232S P2RP1C 28.5 ? 0.6 ND
TABLE-US-00012 TABLE 12 Second-order rate constants of inhibition (mM.sup.?1 .Math. s.sup.?1) Inhibition of Variant fXa APC/fXa FL ?.sub.1AT Pitts C232S 41.33 ? 2.36 2.6 FL ?.sub.1AT Pitts C232S P2KP1K 0.12 ? 0.010 126.2 FL ?.sub.1AT Pitts C232S P2R 4.79 ? 0.58 12.8 FL ?.sub.1AT Pitts C232S P2QP1K 1.082 ? 0.15 30.9 FL ?.sub.1AT Pitts C232S P2KP1H 0.62 ? 0.040 46.5 FL ?.sub.1AT Pitts C232S P2KP1N 0.91 ? 0.13 41.5
TABLE-US-00013 TABLE 13 Second-order rate constants of inhibition (mM.sup.?1 .Math. s.sup.?1) Variant Thrombin APC fXa aPTT (s) FL ?.sub.1AT Pitts C232S 292.76 ? 17.60 108.16 ? 7.086 41.33 ? 2.36 >300 (55.0 ? 3.8) FL ?.sub.1AT Pitts C232S P2KP1K no inhibition after 4 h 15.14 ? 1.87 0.12 ? 0.010 62.1 ? 4.2 (55.0 ? 3.8) FL ?.sub.1AT Pitts C232S P2RP1Q 0.0054 ? 0.0011 8.30 ? 1.11 0.13 ? 0.0067 55.1 ? 2.8 (49.3 ? 2.5) FL ?.sub.1AT Pitts C232S P2KP1Q 0.0029 ? 0.0015 9.00 ? 0.67 0.17 ? 0.010 53.9 ? 3.0 (49.3 ? 2.5)
TABLE-US-00014 Sequences 1 mqlflllclvllspqgaslhrhhpremkkrvedlhvgatvapssrrdftfdlyralasaa 61 psqniffspvsismslamlslgagsstkmqileglglnlqkssekelhrgfqqllqelnq 121 prdgfqlslgnalftdlvvdlqdtfvsamktlyladtfptnfrdsagamkqindyvakqt 181 kgkivdllknldsnavvimvnyiffkakwetsfnhkgtqeqdfyvtsetvvrvpmmsred 241 qyhylldrnlscrvvgvpyqgnatalfilpsegkmqqvenglsektlrkwlkmfkkrqle 301 lylpkfsiegsyqlekvlpslgisnvftshadlsgisnhsniqvsemvhkavvevdesgt 361 raaaatgtiftfrsarlnsqrlvfnrpflmfivdnnilflgkvnrpSEQIDNO:1 SEQIDNO:1ProteinCinhibitor(PCI) Matureprotein,includingthepropeptide,correspondstoresidues20 to406.Signalsequencecorrespondstoresidues1-19.Propeptide correspondstoresidues20-25.ResiduesP4,P2,P1andP1ofthe RCLboldandunderlined. 1 mermlpllalgllaagfcpavlchpnspldeenltgenqdrgthvdlglasanvdfafsl 61 ykqlvlkapdknvifsplsistalaflslgahnttlteilkglkfnltetseaeihqsfq 121 hllrtlnqssdelqlsmgnamfvkeqlslldrftedakrlygseafatdfqdsaaakkli 181 ndyvkngtrgkitdlikdldsqtmmvlvnyiffkakwempfdpqdthqsrfylskkkwvm 241 vpmmslhhltipyfrdeelsctvvelkytgnasalfilpdqdkmeeveamllpetlkrwr 301 dslefreigelylpkfsisrdynlndillqlgieeaftskadlsgitgarnlavsqvvhk 361 avldvfeegteasaatavkitllsalvetrtivrfnrpflmiivptdtqniffmskvtnp 421 kqaSEQIDNO:2 SEQIDNO:2Alpha-1-antichymotrypsin Matureproteincorrespondstoresidues26to423.ResiduesP4,P2, P1andP1 oftheRCLboldandunderlined 1 masrltlltllllllagdrassnpnatssssqdpeslqdrgegkvattviskmlfvepil 61 evsslpttnsttnsatkitanttdepttqpttepttqptiqptqpttqlptdsptqpttg 121 sfcpgpvtlcsdleshsteavlgdalvdfslklyhafsamkkvetnmafspfsiaslltq 181 vllgagentktnlesilsypkdftcvhqalkgfttkgvtsvsqifhspd1airdtfvnas 241 rtlysssprvlsnnsdanlelintwvakntnnkisrlldslpsdtrlvllnaiylsakwk 301 ttfdpkktrmepfhfknsvikvpmmnskkypvahfidqtlkakvgqlqlshnlslvilvp 361 qnlkhrledmegalspsvfkalmeklemskfqptlltlprikvttsqdmlsimekleffd 421 fsydlnlcgltedpdlqvsamqhqtvleltetgveaaaasaisvartllvfevqqpflfv 481 lwdqqhkfpvfmgrvydpraSEQIDNO:3 SEQIDNO:3C1-esteraseinhibitor Matureproteincorrespondstoresidues23-500.ResiduesP4,P2,P1 andP1 oftheRCLboldandunderlined 1 mallwgllvlswsclqgpcsvfspvsameplgrqltsgpnqeqvspltllklgnqepggq 61 talksppgvcsrdptpeqthrlarammaftadlfslvaqtstcpnlilsplsvalalshl 121 algaqnhtlqrlqqvlhagsgpclphllsrlcqdlgpgafrlaarmylqkgfpikedfle 181 qseqlfgakpvsltgkqeddlaninqwvkeategkiqeflsglpedtvllllnaihfqgf 241 wrnkfdpsltqrdsfhldeqftvpvemmqartyplrwflleqpeiqvahfpfknnmsfvv 301 lvpthfewnvsqvlanlswdtlhpplvwerptkvrlpklylkhqmdlvatlsqlglqelf 361 qapdlrgiseqslvvsgvqhqstlelsevgveaaaatsiamsrmslssfsvnrpflffif 421 edttglplfvgsvrnpnpsaprelkeqqdspgnkdflqslkgfprgdklfgpdlklvppm 481 eedypqfgspkSEQIDNO:4 SEQIDNO:4?.sub.2-Antiplasmin Matureproteincorrespondstoresidues28-491.ResiduesP4,P2,P1 andP1 oftheRCLforinhibitionofchymotrypsininbold,residues fortheinhibitionofplasminunderlined. 1 mysnvigtvtsgkrkvyllsllligfwdcvtchgspvdictakprdipmnpmciyrspek 61 katedegseqkipeatnrrvwelskansrfattfyqhladskndndniflsplsistafa 121 mtklgacndtlqqlmevfkfdtisektsdqihfffaklncrlyrkankssklvsanrlfg 181 dksltfnetyqdiselvygaklqpldfkenaeqsraainkwvsnktegritdvipseain 241 eltvlvlvntiyfkglwkskfspentrkelfykadgescsasmmyqegkfryrrvaegtq 301 vlelpfkgdditmvlilpkpekslakvekeltpevlqewldeleemmlvvhmprfriedg 361 fslkeqlqdmglvdlfspeksklpgivaegrddlyvsdafhkaflevneegseaaastav 421 viagrslnpnrvtfkanrpflvfirevplntiifmgrvanpcvkSEQIDNO:5 SEQIDNO:5Antithrombin(ATIII) Matureproteincorrespondstoresidues33-464.ResiduesP4,P2,P1and P1 oftheRCLboldandunderlined 1 mkhslnallifliitsawggskgpldqlekggetaqsadpqweqlnnknlsmpllpadfh 61 kentvtndwipegeedddyldlekifsedddyidivdslsvsptdsdvsagnilqlfhgk 121 sriqrlnilnakfafnlyrvlkdqvntfdnifiapvgistamgmislglkgetheqvhsi 181 lhfkdfvnasskyeittihnlfrklthrlfrrnfgytlrsvndlyiqkqfpilldfktkv 241 reyyfaeaqiadfsdpafisktnnhimkltkglikdalenidpatqmmilnciyfkgswv 301 nkfpvemthnhnfrlnerevvkvsmmqtkgnflaandqeldcdilqleyvggismlivvp 361 hkmsgmktleaqltprvverwqksmtnrtrevllpkfkleknynlveslklmgirmlfdk 421 ngnmagisdqriaidlfkhqgtitvneegtqattvttvgfmplstqvrftvdrpflfliy 481 ehrtscllfmgrvanpsrsSEQIDNO:6 SEQIDNO:6HeparincofactorII Matureproteincorrespondstoresidues20-499.ResiduesP4,P2,P1 andP1 oftheRCLboldandunderlined 1 mpssyswgilllaglcclvpvslaedpqgdaaqktdtshhdqdhptfnkitpnlaefafs 61 lyrqlahqsnstniffspvslatafamlslgtkadthdelleglnfnlteipeaqihegf 121 qellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyhseaftvnfgdteeakkq 181 indyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkdteeedfhvdqvttv 241 kvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegklqhlenelthdiitkfl 301 enedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvteeaplklskavhka 361 vltidekgteaagamfleaipmsippevkfnkpfvflmieqntksplfmgkvvnptqkSEQID NO:7 SEQIDNO:7?.sub.1-antitrypsin(DAT) Matureproteincorrespondstoresidues25-418.ResiduesP4,P2,P1 andP1 oftheRCLboldandunderlined 1 mhlidylllllvgllalshgqlhvehdgescsnsshqqiletgegspslklapanadfaf 61 rfyyliasetpgkniffsplsisaayamlslgacshsrsqileglgfnltelsesdvhrg 121 fqhllhtlnlpghgletrvgsalflshnlkflakflndtmavyeaklfhtnfydtvgtiq 181 lindhvkketrgkivdlvselkkdvlmvlvnyiyfkalwekpfissrttpkdfyvdentt 241 vrvpmmlqdqehhwylhdrylpcsvlrmdykgdatvffilpnqgkmreieevltpemlmr 301 wnnllrkrnfykklelhlpkfsisgsyvldqilprlgftdlfskwadlsgitkqqkleas 361 ksfhkatldvdeagteaaaatsfaikffsaqtnrhilrfnrpflvvifststqsvlflgk 421 vvdptkpSEQIDNO:8 SEQIDNO:8Kallistatin Matureproteincorrespondstoresidues21-427.ResiduesP4,P2,P1 andP1 oftheRCLboldandunderlined 1 mqmspaltclvlglalvfgegsavhhppsyvahlasdfgvrvfqqvagaskdrnvvfspy 61 gvasvlamlqlttggetqqqiqaamgfkiddkgmapalrhlykelmgpwnkdeisttdai 121 fvqrdlklvqgfmphffrlfrstvkqvdfseverarfiindwvkthtkgmisnllgkgav 181 dqltrlvlvnalyfngqwktpfpdssthrrlfhksdgstvsvpmmaqtnkfnytefttpd 241 ghyydilelpyhgdtlsmfiaapyekevplsaltnilsaqlishwkgnmtrlprllvlpk 301 fsletevdlrkplenlgmtdmfrqfqadftslsdgeplhvaqalqkvkievnesgtvass 361 stavivsarmapeeiimdrpflfvvrhnptgtvlfmgqvmepSEQIDNO:9 SEQIDNO:9Plasminogenactivatorinhibitor Matureproteincorrespondstoresidues24-402.ResiduesP4,P2,P1 andP1 oftheRCLboldandunderlined 1 mkvvpslllsvllaqvwlvpglapspqspetpapqnqtsrvvqapkeeeedeqeaseeka 61 seeekawlmasrqqlaketsnfgfsllrkismrhdgnmvfspfgmslamtglmlgatgpt 121 etqikrglhlqalkptkpgllpslfkglretlsrnlelgltqgsfafihkdfdvketffn 181 lskryfdtecvpmnfrnasqakrlmnhyinketrgkipklfdeinpetklilvdyilfkg 241 kwltpfdpvftevdtfhldkyktikvpmmygagkfastfdknfrchvlklpyqgnatmlv 301 vlmekmgdhlaledylttdlvetwlrnmktrnmevffpkfkldqkyemhellrqmgirri 361 fspfadlselsatgrnlqvsrvlqrtvievdergteavagilseitaysmppvikvdrpf 421 hfmiyeetsgmllflgrvvnptllSEQIDNO:10 SEQIDNO:10ProteinZdependentinhibitor Matureproteincorrespondstoresidues22-444.ResiduesP4,P2,P1 andP1 oftheRCLboldandunderlined 1 mnwhlplfllasvtlpsicshfnplsleelgsntgiqvfnqivksrphdnivisphgias 61 vlgmlqlgadgrtkkqlamvmrygvngvgkilkkinkaivskknkdivtvanavfvknas 121 eievpfvtrnkdvfqcevrnvnfedpasacdsinawvknetrdmidnllspdlidgvltr 181 lvlvnavyfkglwksrfqpentkkrtfvaadgksyqvpmlaqlsvfrcgstsapndlwyn 241 fielpyhgesismlialptesstplsaiiphistktidswmsimvpkrvqvilpkftava 301 qtdlkeplkvlgitdmfdsskanfakittgsenlhvshilqkakievsedgtkasaatta 361 iliarssppwfivdrpflffirhnptgavlfmgqinkpSEQIDNO:11 SEQIDNO:11Proteasenexin1 Matureproteincorrespondstoresiduesresidues20-398-isoforma. ResiduesP4,P2,P1andP1 oftheRCLboldandunderlined 1 mpssyswgilllaglcclvpvslaedpqgdaaqktdtshhdqdhptfnkitpnlaefafs 61 lyrqlahqsnstniffspvslatafamlslgtkadthdeileglnfnlteipeaqihegf 121 qellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyhseaftvnfgdteeakkq 181 indyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkdteeedfhvdqvttv 241 kvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegklqhlenelthdiitkfl 301 enedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvteeaplklskavhka 361 vltidekgteaagamfleaikrkippevkfnkpfvflmieqntksplfmgkvvnptqkSEQID NO:12 SEQIDNO:12ModifiedSerpinin?.sub.1ATscaffold Matureproteincorrespondstoresidues25-418.ResiduesP4,P2,P1 andP1 oftheRCLboldandunderlined