COAGONISTS OF GLUCAGON-LIKE PEPTIDE 1 RECEPTOR AND NEUROPEPTIDE Y2 RECEPTOR
20180271947 ยท 2018-09-27
Assignee
Inventors
Cpc classification
C07K2319/75
CHEMISTRY; METALLURGY
International classification
Abstract
Peptide sequences that can serve as agonists of both the glucagon-like peptide 1 receptor (GLP-IR) and the neuropeptide Y2 receptor (NPYR2). The peptide sequences include regions that correspond to certain aspect of natural substrates and known agonists of the glucagon-like peptide 1 receptor (GLP-IR) and the neuropeptide Y2 receptor (NPYR2) in a single sequence.
Claims
1. A composition for simultaneously treating obesity and insulin deficiency, comprising a peptide sequence having a first portion that corresponds to a selected portion of the sequence of an agonist of the glucagon-like peptide 1 receptor (GLP-1R) and a second potion that corresponds to a selected portion of the sequence of an agonist of the neuropeptide Y2 receptor (NPYR2).
2. The composition of claim 1, wherein the sequence comprises HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSTRQRY-NH2 (SEQ ID NO: 3).
3. The composition of claim 1, wherein the sequence comprises HGEGTFTSDLSKQMEEEAVRLFIEWLRHYLNLVTRQRY-NH2 (SEQ ID NO: 4).
4. The composition of claim 1, wherein the sequence comprises IKPEAPREDASPEEENQAYKEFIAYLNLVTRQRY-NH2 (SEQ ID NO: 5).
5. The composition of claim 1, wherein the sequence comprises HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSRHYLNLVTRQRY-NH2 (SEQ ID NO: 15),
6. The composition of claim 1, wherein the sequence comprises HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSTRQ-NH2 (SEQ ID NO: 16).
7. The composition of claim 1, wherein the sequence comprises HGEGTFTSDLSK(azido)QMEEEAVRLFIEWLKNGGPSSTRQRY (SEQ ID NO: 17)
8. A method of simultaneously treating obesity and insulin deficiency, comprising the steps of administering a peptide sequence having a first portion that corresponds to a selected portion of the sequence of an agonist of the glucagon-like peptide 1 receptor (GLP-1R) and a second potion that corresponds to a selected portion of the sequence of an agonist of the neuropeptide Y2 receptor (NPYR2).
9. The method of claim 8, wherein the sequence comprises HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSTRQRY-NH2 (SEQ ID NO: 3).
10. The method of claim 8, wherein the sequence comprises HGEGTFTSDLSKQMEEEAVRLFIEWLRHYLNLVTRQRY-NH2 (SEQ ID NO: 4).
11. The method of claim 8, wherein the sequence comprises IKPEAPREDASPEEENQAYKEFIAYLNLVTRQRY-NH2 (SEQ ID NO: 5).
12. The method of claim 8, wherein the sequence comprises HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSRHYLNLVTRQRY-NH2 (SEQ ID NO: 15),
13. The method of claim 8, wherein the sequence comprises HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSTRQ-NH2 (SEQ ID NO: 16).
14. The method of claim 8, wherein the sequence comprises HGEGTFTSDLSK(azido)QMEEEAVRLFIEWLKNGGPSSTRQRY (SEQ ID NO: 17).
Description
BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWING(S)
[0005] The present invention will be more fully understood and appreciated by reading the following Detailed Description in conjunction with the accompanying drawings, in which:
[0006]
[0007]
[0008]
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
DETAILED DESCRIPTION OF THE INVENTION
[0027] Referring now to the drawings, wherein like reference numerals refer to like parts throughout, the present inventions comprises peptide sequences that are coagonists of GLP-1R and NPYR2. The sequences of the present invention were designed by combining certain aspects of the natural substrates or known agonists of GLP-1R and NPYR2, such as Peptide YY (IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY-NH2; SEQ ID NO: 1) and exendin-4 (HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2; SEQ. ID NO: 2).
EXAMPLE 1
[0028] Following the approach of the present invention, the sequences HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSTRQRY-NH2 (SEQ ID NO: 3), referred to herein as Peptide RLB001, HGEGTFTSDLSKQMEEEAVRLFIEWLRHYLNLVTRQRY-NH2 (SEQ ID NO: 4), referred to herein as Peptide RLB002, and IKPEAPREDASPEEENQAYKEFIAYLNLVTRQRY-NH2 (SEQ ID NO: 5), referred to herein as Peptide RLB003 were designed and synthesized through solid phase peptide synthesis.
[0029] Referring to
[0030] Referring to
[0031] These results demonstrate that the peptide RLB001 has comparable function at the GLP-1R and the NPYR2. A single peptide may thus be used to activate two receptors responsible for glucose control and appetite suppression. In addition, the unique profile of calcium release after activation at the NPYR2 may indicate biased agonism.
EXAMPLE 2
[0032] To overcome the compensatory effects of PYY(3-36) a hybrid peptide made from fragments of Ex-4 and PYY(3-36) should be able to target both GLP-1R and NPY2R without the PD effects of two different drugs. The initial series of three sequences were designed with the first two peptides composed primarily of Ex-4 sequence and the third as a modified version of PYY(3-36) to screen for dual agonism. After the results of these three peptides as described above, an additional three sequences were designed, i.e., Peptides RLB004 (HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSRHYLNLVTRQRY-NH2; SEQ ID NO: 15), RLB005 (HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSTRQ-NH2; SEQ ID NO: 16), and RLB006 (HGEGTFTSDLSK(azido)QMEEEAVRLFIEWLKNGGPSSTRQRY; SEQ ID NO: 17), as seen in
[0033] In Vitro Screening and Testing
[0034] The RLB series peptides were tested for function at receptors corresponding to the glucagon super family of receptors and NPY receptors. These receptors were transfected into either HEK293 cells or CHO cells. HEK 293 cells stably transfected with either GLP-1R or GIPR followed by an infection of adenovirus incorporating AKAR3 to indirectly follow cAMP production. CHO cells were transfected with NPY2R and a promiscuous g protein using FURA2 to follow calcium release.
[0035] Screening the RLB Series for GLP-1R Agonism and Dose Response
[0036] Function was first established at the GLP-1R by screening the initial conjugates in the HEK-GLP-1R cells. These cells were treated with adenovirus containing AKAR3 and a agonism was determined by a decrease in FRET ratio. The initial screen of compounds is found in
[0037] The initial screen showed that modifications to Ex-4 do not completely hinder function at the GLP-1R. The peptides showing function at the GLP-1R were then analyzed further to establish an EC.sub.50.
[0038] Peptides 11, 12 and 14 all retained picomolar agonism at GLP-1R warranting further analysis at NPY2R and other glucagon superfamily receptors. Peptides 13 was discarded as a potential dual agonist due to its loss of function.
[0039] Screening the RLB Series for NPY2R Agonism and Dose Response
[0040] Following a screen at the GLP-1R, a screen for agonism at NPY2R was conducted.
[0041] Peptides 12 and 14 were followed up with a full dose response curve to show and EC.sub.50 for each peptide (see
[0042] After establishing agonism at the GLP-1R, the RLB series peptides were tested against similar receptors. Receptors in the glucagon receptor superfamily were tested based on the similarities of native peptide agonists. Shown in
[0043] Peptides 11 and 14 were screened for gcgr agonism compared to Ex-4. Each of these peptides, including Ex-4, showed slight agonism at the receptor at high concentrations (>300 nM). Only peptides 11, 14 and 14 were confirmed to have function at more than one receptor. Peptides 11 is an effective in vitro dual agonist of GLP-1R and GIPR and Peptides 12 and 14 are effective agonists of GLP-1R and NPY2R.
[0044] In Vivo Testing of 11 Compared to Ex-4 and PYY(3-36)
[0045] After the initial screening of the RLB series peptides an in vivo study was planned to compare the dual agonists Peptides 11 and 14 to Ex-4 and PYY(3-36). Since RLB002 was significant less potent at the GLP-1R it was not selected for in vivo testing. A one-day food intake screen of Peptides 11 and 14 showed that Peptide 11 had a reduction in food intake but Peptides 14 actually resulted in the opposite effect and caused an increased food intake from the rats (see
[0046] Peptide 11 was isolated as the lead candidate for both blood glucose control and weight loss. A dose response study was then done to determine the optimal concentration of Peptide 11.
[0047] A two day food intake study was conducted to verify that Peptide 11 behaved uniquely when compared to Ex-4 and co-administration of both Ex-4 and PYY(3-36).
[0048] Food intake was studied further in diet induced obese (DIO) rats over two days comparing Peptide 11 treatment at 2.4 nmol/kg to an equimolar mixture of Ex-4 and PYY(3-36) at 2.4 nmol/kg (shown in
[0049] Direct comparison of Peptide 11 and Ex-4 at 10 nmol/kg dosing is seen in
[0050] Glucoregulatory Effects of Peptide 11 Versus Ex-4
[0051] Peptide 11 was compared directly to Ex-4 to determine efficacy in blood glucose control. An intraperitoneal glucose tolerance test was performed on rats to treated with Peptide 11, Ex-4 and saline (see
[0052] Outcomes and Conclusions
[0053] A summary of the results from the in vitro agonism of each receptor is highlighted in
[0054] Sequences according to the present invention may be further modified according to known processes, such as glycosylation, to improve the use of the sequences as pharmaceuticals by assisting with the delivery of the protein to a subject. For example, N-linked glycosylation may be used to attach oligosaccharides to a nitrogen atom, such as the N4 of asparagine residues. Similarly, O-linked glycosylation may be used to attach glycans to serine and threonine and C-linked glycosylation used for the covalent attachment of a mannose residue to a tryptophan residue.
[0055] Sequences according to the present invention may be further modified by pegylation, which is the attachment of a therapeutic protein to poly(ethylene glycol) polymer chains (PEG). The attachment of poly(ethylene glycol) chains can prevent degradation by proteolytic enzymes, reduce rapid clearance of the sequences by the kidneys, and increase the circulating half-life. As is known in the art, PEG is linked to a protein sequence through reactive molecular groups on amino acid side chains such as lysine.
[0056] Sequences according to the present invention may be further modified by lipidation. The presence of a lipid group in peptides modulates their hydrophobicity, secondary structures and self-assembling propensities while retaining their abilities to bind to target receptors. Lipidation improves metabolic stability, membrane permeability, bioavailability, and changes pharmacokinetic and pharmacodynamic properties of peptides.
[0057] The sequences may also be encapsulated in a suitable vehicle to either aid in the delivery of the compound to target cells, to increase the stability of the composition, or to minimize potential toxicity of the composition. For example, nanoparticles, liposomes, microemulsions, micelles, dendrimers and other phospholipid-containing systems may be used as is known in the art.
[0058] Sequences according to the present invention may further be conjugated to known conjugation partners to assist in the use of the sequences as a pharmaceutical. For example, conjugation partners such as an organic drug molecule, an enzyme label, a toxin, a cytostatic agent, a label which can be photoactivated and which is suitable in photodynamic therapy, a pharmaceutically suitable radioactive label, a hapten, digoxigenin, biotin, a chemotherapeutic metal complex or metal, colloidal gold, or a moiety that extends the serum half-life may be used to assist with the delivery of the present invention.
[0059] The present invention includes pharmaceutical compositions comprising a preparation of the sequences of the invention. Such pharmaceutical compositions may be for administration for injection, or for oral, nasal, transdermal or other forms of administration, including, e.g., by intravenous, intradermal, intramuscular, intramammary, intraperitoneal, intrathecal, intraocular, retrobulbar, intrapulmonary (e.g., aerosolized drugs) or subcutaneous injection (including depot administration for long term release); by sublingual, anal, vaginal, or by surgical implantation. The treatment may consist of a single dose or a plurality of doses over a period of time. In general, pharmaceutical compositions comprising effective amounts of a sequence according to the invention, whether modified as described above or not, together with pharmaceutically acceptable diluents, preservatives, solubilizers, emulsifiers, adjuvants and/or carriers. Such compositions include diluents of various buffer content, pH and ionic strength; additives such as detergents and solubilizing agents, anti-oxidants, preservatives and bulking substances. The pharmaceutical compositions optionally may include still other pharmaceutically acceptable liquid, semisolid, or solid diluents that serve as pharmaceutical vehicles, excipients, or media. Such compositions may influence the physical state, stability, rate of in vivo release, and rate of in vivo clearance of the present proteins and derivatives. The compositions may be prepared in liquid form, or may be in dried powder, such as lyophilized form. Implantable sustained release formulations are also contemplated, as are transdermal formulations.