Modified Luciferases
20240318151 ยท 2024-09-26
Inventors
Cpc classification
C12Y113/12005
CHEMISTRY; METALLURGY
C07K2319/60
CHEMISTRY; METALLURGY
International classification
Abstract
The instant disclosure relates to methods for luciferase modification.
Claims
1. A modified luciferase comprising a polypeptide having SEQ ID NO: 2 including at least one amino acid mutation, wherein the modified luciferase has a greater brightness than the polypeptide having SEQ ID NO: 2.
2. The modified luciferase of claim 1, wherein glutamine is replaced by alanine at amino acid 10, glutamine is replaced by alanine at amino acid 50, or aspartic acid is replaced by alanine at amino acid 94, or a combination thereof.
3. The modified luciferase of claim 1, wherein glutamine is replaced by alanine at amino acid 10.
4. The modified luciferase of claim 1, wherein glutamine is replaced by alanine at amino acid 50.
5. The modified luciferase of claim 1, wherein aspartic acid is replaced by alanine at amino acid 94.
6. A modified luciferase which exhibits greater brightness than luciferase of SEQ ID NO: 2, comprising a polypeptide having an amino acid sequence which differs from SEQ ID NO: 2 in that glutamine is replaced by alanine at amino acid 50.
7. The modified luciferase of claim 6, wherein the brightness exhibited is at least about two-fold greater than the brightness of luciferase of SEQ ID NO: 2.
8. The modified luciferase of claim 6, wherein the brightness exhibited is at about three-fold greater than the brightness of luciferase of SEQ ID NO: 2.
9. A polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 4, SEQ ID NO: 6, and SEQ ID NO: 8.
10. The polypeptide of claim 9, wherein the amino acid sequence is SEQ ID NO: 4.
11. The polypeptide of claim 9, wherein the amino acid sequence is SEQ ID NO: 6.
12. The polypeptide of claim 9, wherein the amino acid sequence is SEQ ID NO: 8.
13. A fusion protein comprising the polypeptide of claim 9.
14. A polynucleotide encoding the polypeptide of claim 9.
15. The polynucleotide of claim 14, wherein the amino acid sequence is SEQ ID NO: 4.
16. The polynucleotide of claim 14, wherein the amino acid sequence is SEQ ID NO: 6.
17. The polynucleotide of claim 14, wherein the amino acid sequence is SEQ ID NO: 8.
18. A vector comprising the polynucleotide of claim 14.
19. A host cell comprising the vector of claim 18.
20. A kit comprising the luciferase of claim 1.
21. A method of increasing the brightness of a luciferase comprising changing a salt bridge interaction of the luciferase.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
DETAILED DESCRIPTION
[0044] Disclosed herein is the generation of a brighter version of the smallest bioluminescent (luciferase) protein that will increase the utility of an artificially created luciferase protein (see US patent #US20220259575A1 (now U.S. Ser. No. 11/827,908); incorporated by reference herein). Specifically, the brighter variant of the picALuc protein described herein can be utilized in developing biological and biomedical assays such as measuring gene expression, determining protein-protein interaction, detecting biomolecules/biomarkers, etc.
[0045] The terms a, an, the and similar referents used in the context of describing the invention (especially in the context of the following claims) are to be construed to cover both the singular and the plural, unless otherwise indicated herein or clearly contradicted by context. Recitation of ranges of values herein is merely intended to serve as a shorthand method of referring individually to each separate value falling within the range. Unless otherwise indicated herein, each individual value is incorporated into the specification as if it were individually recited herein. All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g., such as) provided herein is intended merely to better illuminate the invention and does not pose a limitation on the scope of the invention otherwise claimed. No language in the specification should be construed as indicating any non-claimed element essential to the practice of the invention.
[0046] Unless otherwise indicated, all numbers expressing quantities of ingredients, properties such as molecular weight, reaction conditions, and so forth used in the specification and claims are to be understood as being modified in all instances by the term about. As used herein the terms about and approximately means within 10 to 15%, preferably within 5 to 10%. Accordingly, unless indicated to the contrary, the numerical parameters set forth in the specification and attached claims are approximations that may vary depending upon the desired properties sought to be obtained by the present invention. At the very least, and not as an attempt to limit the application of the doctrine of equivalents to the scope of the claims, each numerical parameter should at least be construed in light of the number of reported significant digits and by applying ordinary rounding techniques. Notwithstanding that the numerical ranges and parameters setting forth the broad scope of the invention are approximations, the numerical values set forth in the specific examples are reported as precisely as possible. Any numerical value, however, inherently contains certain errors necessarily resulting from the standard deviation found in their respective testing measurements.
[0047] As used herein, WT refers to a miniaturized variant of an artificial luciferase (ALuc), named picALuc, with a molecular weight of 13 kDa, and having an amino acid sequence corresponding to SEQ ID NO: 2.
[0048] Combining structural modeling, molecular dynamics (MD) simulations and mutational analysis, we show that the loss of a salt bridge interaction formed by Glu50 (E50) residue results in an increased enzymatic activity of picALuc. Specifically, we generated a model of picALuc using the available structure of the Gaussia luciferase (GLuc) and performed a 1 ?s long Gaussian accelerated molecular dynamics (GaMD) simulation which revealed a general compaction of the protein structure as well as residue level interactions in the protein.
[0049] Given that picALuc contains a number of charged residues, we focused our attention to salt bridge interactions and decided to mutate E10, E50 and D94 that were found to form a fluctuating, stable or a new salt bridge interaction, respectively. Live cell assays showed an enhanced bioluminescence in cells expressing the E50A mutant picALuc while in vitro assays revealed an increased Vmax of the E50A mutant without affecting its thermal stability. Analysis of GaMD simulation trajectories revealed altered collective dynamics in the protein, in which residue E50 contributed substantially. We envisage that the brighter variant of picALuc reported here will find a general applicability in developing bioluminescence-based assays and the strategy developed here will pave the way for further engineering of brighter variants of picALuc.
[0050] Provided herein is a modified luciferase comprising a polypeptide having SEQ ID NO: 2 including at least one amino acid mutation, wherein the modified luciferase has a greater brightness than the polypeptide having SEQ ID NO: 2.
[0051] In some embodiments, provided herein is a modified luciferase having an amino acid sequence which differs from the sequence of a polypeptide of SEQ ID NO: 2 by including at least one amino acid mutation, wherein the modified luciferase has a greater brightness than the polypeptide of SEQ ID NO: 2.
[0052] In some embodiments, glutamine is replaced by alanine at amino acid 10, glutamine is replaced by alanine at amino acid 50, or aspartic acid is replaced by alanine at amino acid 94, or a combination thereof.
[0053] In some embodiments, glutamine is replaced by alanine at amino acid 10. In some embodiments, glutamine is replaced by alanine at amino acid 50. In some embodiments, aspartic acid is replaced by alanine at amino acid 94.
[0054] In some embodiments, provided is a modified luciferase which exhibits greater brightness than luciferase of SEQ ID NO: 2, comprising a polypeptide having an amino acid sequence which differs from SEQ ID NO: 2 in that glutamine is replaced by alanine at amino acid 50.
[0055] In some embodiments, the brightness exhibited is at least about two-fold greater than the brightness of luciferase of SEQ ID NO: 2. In some embodiments, the brightness exhibited is at about three-fold greater than the brightness of luciferase of SEQ ID NO: 2.
[0056] Provided herein is a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 4, SEQ ID NO: 6, and SEQ ID NO: 8. In some embodiments, the amino acid sequence is SEQ ID NO: 4. In some embodiments, the amino acid sequence is SEQ ID NO: 6. In some embodiments, the amino acid sequence is SEQ ID NO: 8.
[0057] Provided is a fusion protein comprising a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 4, SEQ ID NO: 6, and SEQ ID NO: 8.
[0058] Provided is a polynucleotide encoding a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 4, SEQ ID NO: 6, and SEQ ID NO: 8.
[0059] In some embodiments, the polynucleotide encodes a polypeptide comprising the amino acid sequence SEQ ID NO: 4. In some embodiments, the polynucleotide encodes a polypeptide comprising the amino acid sequence SEQ ID NO: 6. In some embodiments, the polynucleotide encodes a polypeptide comprising the amino acid sequence SEQ ID NO: 8.
[0060] Provided is a vector comprising a polynucleotide encoding a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 4, SEQ ID NO: 6, and SEQ ID NO: 8.
[0061] Provided is a host cell comprising the vector comprising a polynucleotide encoding a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 4, SEQ ID NO: 6, and SEQ ID NO: 8.
[0062] Provided is a kit comprising a modified luciferase described above and herein.
[0063] Provided is a method of increasing the brightness of a luciferase comprising changing a salt bridge interaction of the luciferase.
[0064] Disclosed embodiments comprise bioassays and the development thereof, as well as biosensing applications.
TABLE-US-00001 mGL-picALucnucleotidesequence(SEQIDNO:1): ATGGGAAGTTCACATCATCATCATCATCACTCATCAGGACTGGTGCCACGGGGGTCTGAATT CGGCATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGG ACGGCGACGTAAACGGCCACAAGTTCAGCGTCCGCGGCGAGGGCGAGGGCGATGCCACCAAC GGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCT CGTGACCACCTTAGGCTACGGCGTGGCCTGCTTCGCCCGCTACCCCGACCACATGAAGCAGC ACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTCTTTCAAG GACGACGGTACCTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCG CATCGTGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGT ACAACTTCAACAGCCACAAGGTCTATATCACGGCCGACAAGCAGAAGAACGGCATCAAGGCT AACTTCAAGACCCGCCACAACGTTGAGGACGGCGGCGTGCAGCTCGCCGACCACTACCAGCA GAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCCATCAGT CCAAACTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGAAGGAGAGGGTGACC GCCGCCGGGATTACACATGACATGGACGAGCTGTACAAGTACGGATCCGCGGCCGCCACCGA GAACCTGTATGCAGTGCTCCAAAGCGGATTTCGCGGCTCTGGCAGCGCTATGAAGCTGCCCG GCAAGAAGCTGCCCCTGGAGGTGCTGAAGGAGCTGGAGGCCAACGCCCAGAAGGCCGGCTGC ACCAGGGGCTGCCTGATCTGCCTGAGCCACATCAAGTGCACCGCCAAGATGAAGAAGTGGCT GCCCGGCAGGTGCGAGAGCTGGGAGGGCGACAAGGAGACCGGCCAGGGCGGCATCGGCGAGG CCATCGTGGACATCCCCGAGATCCCCGGCTTCAAGGAGCTGGCCCCCATGGAGCAGTTCATC GCCCAGGTGGACCTGTGCGCCGACTGCACCACCGGCTGCCTGAAGGGCCTGGCCAACGTGAA GTGCAGCGCCCTGCTGAAGAAGTGGCTGCCCAGCAGGTGCGGTACCGACTACAAAGACCATG ACGGTGATTATAAAGATCATGACATCGATTACAAGGATGACGATGACAAGGATATCTGA mGL-picALucaminoacidsequence(WT)(SEQIDNO:2): MGSSHHHHHHSSGLVPRGSEFGMVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATN GKLTLKFICTTGKLPVPWPTLVTTLGYGVACFARYPDHMKQHDFFKSAMPEGYVQERTISFK DDGTYKTRAEVKFEGDTLVNRIVLKGIDFKEDGNILGHKLEYNFNSHKVYITADKOKNGIKA NFKTRHNVEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSHQSKLSKDPNEKRDHMVLKERVT AAGITHDMDELYKYGSAAATENLYAVLOSGFRGSGSAMKLPGKKLPLEVLKELEANAQKAGC TRGCLICLSHIKCTAKMKKWLPGRCESWEGDKETGOGGIGEAIVDIPEIPGFKELAPMEQFI AQVDLCADCTTGCLKGLANVKCSALLKKWLPSRCGTDYKDHDGDYKDHDIDYKDDDDKDI* InSEQIDNO:2above,theresiduesthatwere deemedsuitableformutationareunderlined. mGL-picALuc(E10A)nucleotidesequence(SEQIDNO:3): ATGGGAAGTTCACATCATCATCATCATCACTCATCAGGACTGGTGCCACGGGGGTCTGAATT CGGCATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGG ACGGCGACGTAAACGGCCACAAGTTCAGCGTCCGCGGCGAGGGCGAGGGCGATGCCACCAAC GGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCT CGTGACCACCTTAGGCTACGGCGTGGCCTGCTTCGCCCGCTACCCCGACCACATGAAGCAGC ACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTCTTTCAAG GACGACGGTACCTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCG CATCGTGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGT ACAACTTCAACAGCCACAAGGTCTATATCACGGCCGACAAGCAGAAGAACGGCATCAAGGCT AACTTCAAGACCCGCCACAACGTTGAGGACGGCGGCGTGCAGCTCGCCGACCACTACCAGCA GAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCCATCAGT CCAAACTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGAAGGAGAGGGTGACC GCCGCCGGGATTACACATGACATGGACGAGCTGTACAAGTACGGATCCGCGGCCGCCACCGA GAACCTGTATGCAGTGCTCCAAAGCGGATTTCGCGGCTCTGGCAGCGCTATGAAGCTGCCCG GCAAGAAGCTGCCCCTGGCCGTGCTGAAGGAGCTGGAGGCCAACGCCCAGAAGGCCGGCTGC ACCAGGGGCTGCCTGATCTGCCTGAGCCACATCAAGTGCACCGCCAAGATGAAGAAGTGGCT GCCCGGCAGGTGCGAGAGCTGGGAGGGCGACAAGGAGACCGGCCAGGGCGGCATCGGCGAGG CCATCGTGGACATCCCCGAGATCCCCGGCTTCAAGGAGCTGGCCCCCATGGAGCAGTTCATC GCCCAGGTGGACCTGTGCGCCGACTGCACCACCGGCTGCCTGAAGGGCCTGGCCAACGTGAA GTGCAGCGCCCTGCTGAAGAAGTGGCTGCCCAGCAGGTGCGGTACCGACTACAAAGACCATG ACGGTGATTATAAAGATCATGACATCGATTACAAGGATGACGATGACAAGGATATCTGA mGL-picALuc(E10A)aminoacidsequence(SEQIDNO:4): MGSSHHHHHHSSGLVPRGSEFGMVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATN GKLTLKFICTTGKLPVPWPTLVTTLGYGVACFARYPDHMKQHDFFKSAMPEGYVQERTISFK DDGTYKTRAEVKFEGDTLVNRIVLKGIDFKEDGNILGHKLEYNFNSHKVYITADKOKNGIKA NFKTRHNVEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSHQSKLSKDPNEKRDHMVLKERVT AAGITHDMDELYKYGSAAATENLYAVLOSGFRGSGSAMKLPGKKLPLAVLKELEANAQKAGC TRGCLICLSHIKCTAKMKKWLPGRCESWEGDKETGOGGIGEAIVDIPEIPGFKELAPMEQFI AQVDLCADCTTGCLKGLANVKCSALLKKWLPSRCGTDYKDHDGDYKDHDIDYKDDDDKDI* InSEQIDNO:4above,themutatedresidue (comparedtoWT)isshowninbold. mGL-picALuc(E50A)nucleotidesequence(SEQIDNO:5): ATGGGAAGTTCACATCATCATCATCATCACTCATCAGGACTGGTGCCACGGGGGTCTGAATT CGGCATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGG ACGGCGACGTAAACGGCCACAAGTTCAGCGTCCGCGGCGAGGGCGAGGGCGATGCCACCAAC GGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCT CGTGACCACCTTAGGCTACGGCGTGGCCTGCTTCGCCCGCTACCCCGACCACATGAAGCAGC ACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTCTTTCAAG GACGACGGTACCTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCG CATCGTGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGT ACAACTTCAACAGCCACAAGGTCTATATCACGGCCGACAAGCAGAAGAACGGCATCAAGGCT AACTTCAAGACCCGCCACAACGTTGAGGACGGCGGCGTGCAGCTCGCCGACCACTACCAGCA GAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCCATCAGT CCAAACTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGAAGGAGAGGGTGACC GCCGCCGGGATTACACATGACATGGACGAGCTGTACAAGTACGGATCCGCGGCCGCCACCGA GAACCTGTATGCAGTGCTCCAAAGCGGATTTCGCGGCTCTGGCAGCGCTATGAAGCTGCCCG GCAAGAAGCTGCCCCTGGAGGTGCTGAAGGAGCTGGAGGCCAACGCCCAGAAGGCCGGCTGC ACCAGGGGCTGCCTGATCTGCCTGAGCCACATCAAGTGCACCGCCAAGATGAAGAAGTGGCT GCCCGGCAGGTGCGCCAGCTGGGAGGGCGACAAGGAGACCGGCCAGGGCGGCATCGGCGAGG CCATCGTGGACATCCCCGAGATCCCCGGCTTCAAGGAGCTGGCCCCCATGGAGCAGTTCATC GCCCAGGTGGACCTGTGCGCCGACTGCACCACCGGCTGCCTGAAGGGCCTGGCCAACGTGAA GTGCAGCGCCCTGCTGAAGAAGTGGCTGCCCAGCAGGTGCGGTACCGACTACAAAGACCATG ACGGTGATTATAAAGATCATGACATCGATTACAAGGATGACGATGACAAGGATATCTGA mGL-picALuc(E50A)aminoacidsequence(SEQIDNO:6): MGSSHHHHHHSSGLVPRGSEFGMVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATN GKLTLKFICTTGKLPVPWPTLVTTLGYGVACFARYPDHMKQHDFFKSAMPEGYVQERTISFK DDGTYKTRAEVKFEGDTLVNRIVLKGIDFKEDGNILGHKLEYNENSHKVYITADKQKNGIKA NFKTRHNVEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSHQSKLSKDPNEKRDHMVLKERVT AAGITHDMDELYKYGSAAATENLYAVLQSGFRGSGSAMKLPGKKLPLEVLKELEANAQKAGC TRGCLICLSHIKCTAKMKKWLPGRCASWEGDKETGQGGIGEAIVDIPEIPGFKELAPMEQFI AQVDLCADCTTGCLKGLANVKCSALLKKWLPSRCGTDYKDHDGDYKDHDIDYKDDDDKDI* InSEQIDNO:6above,themutatedresidue (comparedtoWT)isshowninbold. mGL-picALuc(D94A)nucleotidesequence(SEQIDNO:7): ATGGGAAGTTCACATCATCATCATCATCACTCATCAGGACTGGTGCCACGGGGGTCTGAATT CGGCATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGG ACGGCGACGTAAACGGCCACAAGTTCAGCGTCCGCGGCGAGGGCGAGGGCGATGCCACCAAC GGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCT CGTGACCACCTTAGGCTACGGCGTGGCCTGCTTCGCCCGCTACCCCGACCACATGAAGCAGC ACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTCTTTCAAG GACGACGGTACCTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCG CATCGTGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGT ACAACTTCAACAGCCACAAGGTCTATATCACGGCCGACAAGCAGAAGAACGGCATCAAGGCT AACTTCAAGACCCGCCACAACGTTGAGGACGGCGGCGTGCAGCTCGCCGACCACTACCAGCA GAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCCATCAGT CCAAACTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGAAGGAGAGGGTGACC GCCGCCGGGATTACACATGACATGGACGAGCTGTACAAGTACGGATCCGCGGCCGCCACCGA GAACCTGTATGCAGTGCTCCAAAGCGGATTTCGCGGCTCTGGCAGCGCTATGAAGCTGCCCG GCAAGAAGCTGCCCCTGGAGGTGCTGAAGGAGCTGGAGGCCAACGCCCAGAAGGCCGGCTGC ACCAGGGGCTGCCTGATCTGCCTGAGCCACATCAAGTGCACCGCCAAGATGAAGAAGTGGCT GCCCGGCAGGTGCGAGAGCTGGGAGGGCGACAAGGAGACCGGCCAGGGCGGCATCGGCGAGG CCATCGTGGACATCCCCGAGATCCCCGGCTTCAAGGAGCTGGCCCCCATGGAGCAGTTCATC GCCCAGGTGGACCTGTGCGCCGCCTGCACCACCGGCTGCCTGAAGGGCCTGGCCAACGTGAA GTGCAGCGCCCTGCTGAAGAAGTGGCTGCCCAGCAGGTGCGGTACCGACTACAAAGACCATG ACGGTGATTATAAAGATCATGACATCGATTACAAGGATGACGATGACAAGGATATCTGA mGL-picALuc(D94A)aminoacidsequence(SEQIDNO:8): MGSSHHHHHHSSGLVPRGSEFGMVSKGEELFTGVVPILVELDGDVNGHKESVRGEGEGDATN GKLTLKFICTTGKLPVPWPTLVTTLGYGVACFARYPDHMKQHDFFKSAMPEGYVQERTISFK DDGTYKTRAEVKFEGDTLVNRIVLKGIDFKEDGNILGHKLEYNFNSHKVYITADKQKNGIKA NFKTRHNVEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSHQSKLSKDPNEKRDHMVLKERVT AAGITHDMDELYKYGSAAATENLYAVLQSGFRGSGSAMKLPGKKLPLEVLKELEANAQKAGC TRGCLICLSHIKCTAKMKKWLPGRCESWEGDKETGQGGIGEAIVDIPEIPGFKELAPMEQFI AQVDLCAACTTGCLKGLANVKCSALLKKWLPSRCGTDYKDHDGDYKDHDIDYKDDDDKDI*
[0065] In SEQ ID NO: 8 above, the mutated residue (compared to WT) is shown in bold.
EXAMPLES
Methods
[0066] Structural modeling of WT and E50A mutant picALuc: We utilize the available nuclear magnetic resonance (NMR)-derived structure of GLuc (PDB: 7D2O) (Wu N. et al. Sci Rep 10, 20069 (2020). to generate a homology-based structural model of the picALuc using the SWISS-MODEL webserver. The two proteins, picALuc and GLuc show considerable sequence similarity (92.5%; and 85% identity) with key differences in the N- and C-terminal allowing high confidence structural modelling of picALuc. Notably, picALuc lacks N-terminal ?-helices 1 and 2 and some residues in the C-terminal region of ALuc. Quality of the modelled structure is assessed using the MolProbity software (version 4.4) available as a part of the SWISS-MODEL webserver with a score of 2.90 and with only two Gly residues (located in the long loop between ?-helices 3 and 4) out of a total of 120 residues (1.69%; the GLuc template structure 7D2O showed 4 out 168 residues, which is equal to 2.8%) as Ramachandran plot outliers. All disulfide bridges observed in GLuc structure are maintained in the modelled picALuc structure. Structural model of the E50A mutant picALuc is generated by backbone rotamer-dependent replacement of the residue E with an A using Pymol (The PyMOL Molecular Graphics System, Version 2.0.0, Schr?dinger, LLC; pymol.org; New York, NY, USA).
[0067] MD Simulations: MD simulations of the modelled WT and E50A mutant picALuc structures is performed essentially as described previously (Geethakumari A. M., et al. bioRxiv, 2022.2001.2031.478460 (2022), Ahmed W. S., et al. Front Mol Biosci 9, 846996 (2022)). Inputs files including topology and parameter files are prepared using the QwikMD plugin available in the Visual Molecular Dynamics (VMD) 1.9.3 software and simulations are performed using the Nanoscale Molecular Dynamics (NAMD) 2.13 software and CHARMM36 force field. Briefly, proteins are solvated in explicit solvent using TIP3P cubic water box containing 0.15 M NaCl for charge neutralization and periodic boundary conditions applied with a 2 fs integration time-step. Prior to production simulations, energy minimization is performed on each system for 2000 steps (4 ?s). Subsequently, the systems are graduated heated from 60 K to 310 K at 1 K interval to reach the 310 K equilibrium temperature. Following thermalization, temperature is maintained at 310 K using Langevin temperature control and pressure is maintained at 1.0 atm using Nose-Hoover Langevin piston pressure control. The systems are then equilibrated for 500,000 steps (1 ns). GaMD simulations are then run using the integrated GaMD module in NAMD and its default parameters. This includes a 2 ns of conventional molecular dynamics equilibration run for collecting potential statistics that are used for calculating acceleration parameters, and another 50 ns equilibration run with the addition of boost potential and finally GaMD production runs for 1,000 ns. 400 ?s preparatory runs are included before each of the equilibration steps in GaMD. All GaMD simulations are run at the dual-boost level with one boost potential applied to the dihedral energetic term and the other applied to the total potential energetic term with a standard deviation upper limit set to 6.0 kcal/mol. Short-range non-bonded interactions are defined at 12 ? cut-off with 10 ? switching distance, while Particle-mesh Ewald (PME) scheme is used to handle long-range electrostatic interactions at 1 ? PME grid spacing. Trajectory frames are saved every 10,000 steps (20 ?s) and trajectories are analyzed using the available tools in Visual Molecular Dynamics (VMD) software and MDAnalysis package. Backbone root-mean-square deviation (RMSD), root-mean-square fluctuation (RMSF), solvent accessible surface area (SASA), radius of gyration (RoG), energy calculations, secondary structure salt bridges and H-bond occupancy are performed using VMD. Pairwise RMSD, number of H-bonds formed and S atom distances in disulfide bridges are calculated using the MDAnalysis package. Principal component analysis (PCA) is performed using the PCA module available in the MDAnalysis package. Contribution of individual residues to PC1 and 2 is calculated by projecting the principal components on C? atoms of the proteins using modules in the MDAnalysis package followed by calculation of individual C? atom displacement (root mean squared). Movies are prepared from 500 frames out of the 50,000 frames of the 1 ?s trajectory (with a step size of 100 frames) generated using the VMD Movie Maker plugin and compiled at 20 fps using the Fiji distribution of ImageJ software. All structural images are generated using Pymol (The PyMOL Molecular Graphics System, Version 2.0.0, Schrodinger, LLC; pymol.org; New York, NY, USA).
[0068] mGL-picALuc plasmid construct generation: A codon optimized gene sequence of picALuc generated using the previously described amino acid sequence (Ohmuro-Matsuyama Y., et al. ACS Chem Biol 17, 864-872 (2022)) is synthesized and subcloned into the pcDNA3.1-mGL-NLuc plasmid using BamHI and XhoI restriction enzyme sites (GenScript, Singapore) to generate the pcDNA3.1-mGL-picALuc plasmid. Additionally, the SARS-CoV-2 M.sup.pro N-terminal autocleavage sequence is included in the N-terminal and 3?FLAG-tag sequence is included at the C-terminal. Glu10Ala (E10A), Glu50Ala (E50A) and Asp94Ala (D94A) mutations are generated in the pcDNA3.1-mGL-picALuc plasmid (GenScript, Singapore).
[0069] Cell culture and transfection: HEK 293T cells are cultured in Dulbecco's Modified Eagle Medium (DMEM) supplemented with 10% fetal bovine serum, and 1% penicillin-streptomycin and grown at 37? C. in 5% CO.sub.2. Transfections are performed using polyethyleneimine (PEI) lipid according to the manufacturers' protocol. Briefly, HEK 293T cells are seeded onto 96-well white plates before 24 h of transfection. The plasmid DNA (encoding either the WT or mutant picALucs; 125 ng/well), Opti-MEM (Invitrogen; 31985088; 25 ?L/well) and PEI lipid (Sigma-Aldrich; 408727-100 mL; 0.625 ?L/well) is mixed and incubated at room temperature for 30 min prior to addition to the cells. For in vitro biochemical and thermal stability assays, cells are transfected in 60 mm dishes using appropriate proportion of DNA, PEI lipid and Opti-MEM. The PEI stock solution of 2 mg/mL is prepared by diluting in sterile Milli-Q water and stored at ?80? C. for subsequent usage.
[0070] Live cell assays: Live cell assays to determine fluorescence, bioluminescence and bioluminescence emission spectra are performed by transfecting HEK 293T cells with either the WT or the mutant pcDNA3.1-mGL-picALuc plasmid constructs. For SARS-CoV-2 M.sup.pro-mediated cleavage of mGL-picALuc, cells transfected with pcDNA3.1-mGL-picALuc plasmid along with either pLVX-EF1alpha-SARS-CoV-2-nsp5-2xStrep-IRES-Puro (M.sup.pro WT) (a gift from Nevan Krogan (Addgene plasmid #141370; http://n2t.net/addgene:141370; RRID:Addgene_141370) or pLVX-EF1alpha-SARS-CoV-2-nsp5-C145A-2xStrep-IRES-Puro (C145A mutant M.sup.pro) plasmid (a gift from Nevan Krogan (Addgene plasmid #141371; http://n2t.net/addgene:141371; RRID:Addgene_141371). After 48 h of transfection, mGL fluorescence is measured using a Tecan SPARK? multimode microplate reader prior to bioluminescence measurements. Samples are excited at a wavelength 480 nm and emission is acquired at a wavelength of 530 nm. Bioluminescence is measured in the cells after addition of luciferase substrate, coelenterazine h, addition at a final concentration of 5 ?M. Bioluminescence spectra are acquired using the Tecan SPARK? multimode microplate reader between 380 to 665 nm wavelengths with an acquisition time of 400 ms for each wavelength. Bioluminescence spectral data is normalized by dividing emissions at all wavelengths with that of emission at 483 nm. BRET is calculated as a ratio of emission at 516 nm (corresponding to the emission maxima of acceptor mGL) and 483 nm (corresponding to the emission maxima of donor picALuc). Bioluminescence of each sample is calculated from emissions at wavelengths between 380 and 665 nm and is first normalized with mGL fluorescence (relative to WT values) and then with that of bioluminescence of WT picALuc. All experiments are performed thrice in triplicates.
[0071] In vitro assays: In vitro assays are performed using lysates prepared from cells expressing the respective picALuc constructs as described previously. After 48 h of transfection, cells are washed thrice in chilled Dulbecco's phosphate-buffered saline (DPBS) and harvested and lysed by sonication on ice in a buffer containing 50 mM HEPES (pH 7.5), 100 mM NaCl, 2 mM EDTA, 1 mM dithiothreitol (DTT), 1?protease inhibitor cocktail (ThermoFisher Scientific, Massachusetts, USA) and 10% glycerol. Sonicated samples are centrifuged at 4? C. for 1 h and supernatant is collected for further experiments. For biochemical experiments to determine substrate affinity and reaction velocity, equivalent amounts of the proteins are taken after normalization with mGL fluorescence and incubated with a range of coelenterazine h concentrations. Data are fit to a allosteric sigmoidal model considering bioluminescence output (counts per second) representing the rate of reaction to determine V.sub.max and K.sub.half values. Thermal stability of the proteins is determined by measuring bioluminescence from equivalent amounts of cell lysates after incubation at a range of temperatures for 10 min. Data are fit to a Boltzmann sigmoidal model to determine the temperature at which the protein shows half maximal activity (T.sub.m). Bioluminescence is measured after addition of the substrate in a GloMax? Discover Microplate Reader (Promega). All experiments are performed thrice in triplicates.
[0072] Data Analysis and Figure Preparation: MATLAB (release 2021b), Matplotlib, GraphPad Prism (version 9 for macOS, GraphPad Software, La Jolla California USA; www.graphpad.com) and Microsoft Excel are used for data analysis and graph preparation. Figures are assembled using Adobe Illustrator.
Example 1: picALuc Structural Features and Reorganization
[0073] Deletion mutagenesis of ALuc, a synthetically designed luciferase protein, results in the generation of the smallest, 13 kDa, luciferase, picALuc. Specifically, deletion of residues 1 to 54 at the N-terminal (comprising of helices ?1 and ?2) and residues 175 to 194 at the C-terminal side (comprising of an extended unstructured loop region) is examined. To better understand the structural features of picALuc, we generate a structural model of the protein using the available NMR structure of GLuc. For this, the amino acid sequences of the picALuc and GLuc are aligned and a structural model is generated using the Modeller software (
[0074] To determine if the modelled picALuc structure is stable or assumes a more compact form, we perform molecular dynamics (MD) simulations. For this, we set up an all atom, explicit solvent MD simulation and run the simulation for 1 ?s using NAMD. We employ GaMD simulation to better explore the conformational dynamics of the protein within the simulation period of 1 ?s. Analysis of the simulation trajectory reveals a rapid compaction of the picALuc structure within the first 10 ns of the simulation with further changes observed until 50 ns (
[0075] Solvent accessible surface area (SASA) and radius of gyration (RoG) analysis of the protein is performed to confirm the structural compaction. These reveal a general reduction in both SASA and RoG during the initial 200 ns of the simulation with somewhat slower decrease in the initial 100 ns but a much rapid decrease in between 100 and 200 ns. This is in contrast with the C? RMSD and pairwise RMSD analyses which show large changes during the initial 100 ns and likely reflects side chain rearrangements and further packing in the protein. We also determine various types of energies of the protein and find that the van der Waal energy decreases in the initial phases of the simulation but reverts to similar level during the later phases of the simulation. Electrostatic (as well as non-bond and total) energy of the protein decreases during the initial phases of the simulation and remains low during the later phases of the simulation. However, the number of hydrogen bonds (H-bonds) also remains similar during the simulation. Additionally, secondary structure analysis reveals changes only in the C-terminal part of the loop between helices ?3 and ?4, indicating that the structural compaction of picALuc observed during the simulation is likely due to movement of the initially modelled a helices. We note that all five disulfide bridges are maintained all throughout the simulation.
Example 2: Increased Number of Salt Bridge Interactions Formed in picALuc
[0076] Given the observation of increased electrostatic interaction and the presence of a large number of charged residues in picALuc, we then focus our attention on the salt bridge interactions formed during the 1 ?s long GaMD simulation. Determining the total number of salt bridge interactions formed with an oxygen-nitrogen distance cutoff of 3.2 ? during the simulation reveals an increase in the number of salt bridge interactions formed by the protein (
Example 3: Mutational Analysis Reveals Increased Bioluminescence of picALuc
[0077] Following our observations with the specific salt bridge interactions above, we next determine their role in the bioluminescence activity of picALuc. For this, we mutate the residues E10, E50 and D94 to A (E10A, E50A and D94A, respectively) and express the proteins, along with the wild type (WT) protein, in mammalian (HEK 293T) cells. Additionally, we fuse the mGreenLantern (mGL) green fluorescent protein at the N-terminal of picALuc for monitoring expression level of the proteins (
Example 4: E50A Mutation Results an Increased Enzymatic Activity without Altering Thermal Stability of the Protein
[0078] Next, we determine the biochemical and thermal property of the protein in vitro. For this, HEK 293T cells transfected with the WT and various mutant picALuc proteins are used for preparing picALuc containing cell lysates to be used for in vitro assays. First, we perform enzyme kinetic studies with the WT and various mutants (equivalent concentrations of proteins are used) under a range of substrate (coelenterazine h) concentrations and utilize rate of photon emission as the enzymatic rate (bioluminescence; counts per second (CPS)) and fit the data to an allosteric sigmoidal model (
[0079] Further, we determine the bioluminescence activity of the four picALuc proteins after incubation at a range of temperatures (from 32 to 84? C.) for 10 min. We fit the data to a 13oltzmann sigmoidal model to determine the melting temperature (T.sub.m) of the proteins (
Example 5: Altered Structural Dynamics in the E50A Mutant picALuc
[0080] To understand the mechanism for increased bioluminescence, we introduce the E50A mutation in the structural model of picALuc and perform an all atom, explicit solvent 1 ?s GaMD simulation similar to the WT protein. We then analyze the trajectories of the WT and the E50A mutant picALuc to determine the distance between the C? atoms in residues at position 50 (E in the WT and A in the E50A mutant picALuc) and 42 (K in both proteins) and find that the E50A mutation did not result in any major changes between the two proteins except for some differences in the initial phases of the simulation (
[0081] MD simulation followed by detailed analysis of the trajectory not only reveals a compact three-dimensional structure of picALuc but also provides insights into the possible residue-level interactions. Specifically, closer inspection and mutational analysis of selected salt bridge forming residues enables the generation of a brighter picALuc variant. Comparative analysis of the WT and E50A mutant picALuc MD simulation trajectories reveal an altered collective motion and specifically the contribution of positions 42 and 50 in the mutant picALuc. The results may allow for the generation of new variants of the smallest luciferase proteins; highlight the role of collective dynamics in enzyme activity; and show that mutations in an enzyme can be selected based on their contribution in the collective dynamics of the protein.
[0082] Numerous references have been made to patents and printed publications throughout this specification. Each of the above-cited references and printed publications are individually incorporated herein by reference in their entirety.
[0083] It should be understood that various changes and modifications to the presently preferred embodiments described herein will be apparent to those skilled in the art. Such changes and modifications can be made without departing from the spirit and scope of the present subject matter and without diminishing its intended advantages. It is therefore intended that such changes and modifications be covered by the appended claims.