Fusion protein comprising IDS and use thereof

12098209 ยท 2024-09-24

Assignee

Inventors

Cpc classification

International classification

Abstract

An asymmetric fusion protein in which a fragment of an antibody binding to an insulin receptor, an iduronate-2-sulfatase (IDS) enzyme, and an Fc region are fused, and a use thereof are disclosed. The fusion protein can cross the blood-brain barrier (BBB) to deliver the IDS enzyme to the brain. Therefore, a pharmaceutical composition containing the fusion protein as an active ingredient can be used as a therapeutic agent for a central nervous system disease and particularly, is expected to prevent and treat various diseases caused by ribosome accumulation.

Claims

1. A fusion protein, comprising: a first domain that includes a fragment of an antibody that binds to an insulin receptor; and a second domain comprising iduronate-2-sulfatase (IDS), wherein the first domain comprises: a heavy chain variable region (VH) that includes H-CDR1 comprising the amino acid sequence of SEQ ID NO: 1; H-CDR2 comprising the amino acid sequence of SEQ ID NO: 3; and H-CDR3 comprising any one selected from the group consisting of the amino acid sequences of SEQ ID NOs: 5, 7, and 9; and a light chain variable region (VL) that includes L-CDR1 comprising the amino acid sequence of SEQ ID NO: 2; L-CDR2 comprising the amino acid sequence of SEQ ID NO: 4; and L-CDR3 comprising any one selected from the group consisting of the amino acid sequences of SEQ ID NOs: 6, 8, 10, and 11.

2. The fusion protein of claim 1, further comprising: an Fc region.

3. The fusion protein of claim 2, wherein the Fc region is heterodimeric.

4. The fusion protein of claim 3, wherein one of the heterodimeric Fc has a knob structure, and the other has a hole structure.

5. The fusion protein of claim 2, wherein the Fc region is derived from the heavy chain constant region (CH) of IgG1, IgG2, IgG3, or IgG4.

6. The fusion protein of claim 2, wherein the C-terminus of the first domain is bound to the N-terminus of the Fc region.

7. The fusion protein of claim 2, wherein the C-terminus of the second domain is bound to the N-terminus of the Fc region.

8. The fusion protein of claim 1, wherein the first domain is a Fab or scFv region of the antibody binding to an insulin receptor.

9. The fusion protein of claim 1, wherein the second domain comprises the amino acid sequence of SEQ ID NO: 21.

10. The fusion protein of claim 1, wherein the fusion protein does not inhibit binding between an insulin receptor and insulin.

11. A pharmaceutical composition comprising as an active ingredient: the fusion protein of claim 1, and a pharmaceutically acceptable carrier.

12. A method for treating an individual with a lysosomal storage disease, comprising: administering, to the individual, a pharmaceutical composition of claim 11, wherein the lysosomal storage disease is any one selected from the group consisting of Hunter syndrome, Tay-Sachs disease, Niemann-Pick disease, Pompe disease, Krabbe disease, Gaucher disease, Fabry disease, Wolman disease, Morquio syndrome, Menkes syndrome, galactosialidosis, glycogen storage disease, Fanconi-Bickel syndrome, Lesch-Nyhan syndrome, and Zellweger syndrome.

13. A method for preparing a fusion protein, comprising steps of: causing a fragment of an antibody that binds to an insulin receptor to be bound to an Fc region, to prepare a first monomer; causing iduronate-2-sulfatase (IDS) to be bound to a heterodimeric Fc region, to prepare a second monomer; and mixing the first monomer with the second monomer, wherein the antibody fragment comprises: a heavy chain variable region (VH) that includes H-CDR1 comprising the amino acid sequence of SEQ ID NO: 1; H-CDR2 comprising the amino acid sequence of SEQ ID NO: 3; and H-CDR3 comprising any one selected from the group consisting of the amino acid sequences of SEQ ID NOs: 5, 7, and 9; and a light chain variable region (VL) that includes L-CDR1 comprising the amino acid sequence of SEQ ID NO: 2; L-CDR2 comprising the amino acid sequence of SEQ ID NO: 4; and L-CDR3 comprising any one selected from the group consisting of the amino acid sequences of SEQ ID NOs: 6, 8, 10, and 11.

14. The method of claim 13, wherein in a case where CH3 in the Fc region of the first monomer has a knob structure, CH3 in the second monomer has a hole structure; or in a case where CH3 in the Fc region of the first monomer has a hole structure, CH3 in the second monomer has a knob structure.

15. The method of claim 13, wherein the IDS has the amino acid sequence of SEQ ID NO: 21.

16. The method of claim 13, wherein the first monomer includes a heavy chain comprising any one selected from the group consisting of the amino acid sequences of SEQ ID NOs: 12, 14, 16, and 17, and a light chain comprising any one selected from the group consisting of the amino acid sequences of SEQ ID NO: 13, 15, 18, and 19, and the second monomer comprises the amino acid sequence of SEQ ID NO: 20.

Description

BRIEF DESCRIPTION OF DRAWINGS

(1) FIG. 1 illustrates schematic diagrams for the structure and the mechanism of action of the fusion protein.

(2) FIG. 2 illustrates mutation-introduced sites in an antibody (IR739) binding to an insulin receptor.

(3) FIG. 3 illustrates CDR3 sequences of antibody variants (H031, HL009, L016, L113, and H118) binding to an insulin receptor.

(4) FIG. 4 illustrates results obtained by performing FACS analysis for evaluating cross-reactivity of IR739 in a human, a monkey, and a mouse.

(5) FIG. 5 illustrates results obtained by comparing binding affinity of IR739 and variants of IR739 (H031, HL009, L016, L113, and H118) to a human insulin receptor and a mouse insulin receptor.

(6) FIG. 6 illustrates results obtained by comparing binding affinity of IR739 and fusion proteins (IDS-IR739, IDS-HL009, and IDS-H031) to a human insulin receptor and a mouse insulin receptor.

(7) FIG. 7 illustrates results obtained by comparing an interaction effect between insulin and IR739 on an insulin receptor, depending on changes in IR739 concentration.

(8) FIG. 8 illustrates results obtained by comparing an interaction effect between insulin and IR739 on an insulin receptor, depending on changes in insulin concentration.

(9) FIG. 9 illustrates a half-life of IR739 in mouse blood.

(10) FIG. 10 illustrates half-lives of IDS and IDS-HL009 in mouse blood.

(11) FIG. 11 illustrates brain uptake efficiency of IR739.

(12) FIG. 12 illustrates results obtained by comparing brain uptake efficiency of variants of IR739 (H031, HL009, L113, and H118).

(13) FIG. 13 illustrates results obtained by comparing brain uptake efficiency of fusion proteins.

BEST MODE FOR CARRYING OUT THE INVENTION

(14) In an aspect of the present invention, there is provided a fusion protein, comprising a first domain that includes a fragment of an antibody binding to an insulin receptor, and a second domain that includes a protein having iduronate-2-sulfatase (IDS) activity.

(15) The term insulin receptor, as used herein, refers to a transmembrane receptor protein that is expressed on cells and is capable of transporting insulin. Here, the insulin receptor can act as one of blood-brain barrier (BBB) receptors. The blood-brain barrier receptors include insulin receptor, insulin-like growth factor receptor (IGF-R), transferrin receptor, low density lipoprotein (LDL) receptor, glucose transporter 1 (Glut1), heparin-binding epidermal growth factor-like growth factor (HB-EGF), and the like; and these are extracellular transmembrane receptor proteins that are capable of transporting molecules across the BBB or that can be used to transport administered exogenous molecules.

(16) In an embodiment of the present invention, the fusion protein can bind to the extracellular domain (ECD) of a human insulin receptor and pass through the BBB, so that the fused IDS can be delivered to the brain.

(17) The term antibody, as used herein, refers to an immunoglobulin (Ig) molecule that is immunologically reactive with a certain antigen, the molecule being a protein molecule that plays a role as a receptor specifically recognizing the antigen. The antibody means a concept encompassing both whole antibodies and fragments thereof (antibody fragments).

(18) The term iduronate-2-sulfatase (IDS), as used herein, refers to an enzyme essential for decomposition of lysosomal glycosaminoglycan (GAG). In a case where a mutation occurs in IDS or a case where IDS has decreased activity or becomes inactive, GAG accumulates in most tissues and cells, which may cause a disease. Here, the IDS may have the amino acid sequence of SEQ ID NO: 21.

(19) In an embodiment of the present invention, the fusion protein may further comprise an Fc region, and the Fc region may be derived from the heavy chain constant region (CH) of IgG1, IgG2, IgG3, or IgG4. In addition, the Fc region may be heterodimeric; and one of the heterodimeric Fc may have a knob structure, and the other may have a hole structure. The knob or hole structure may be located at CH3 in the Fc region.

(20) The term Fc region, as used herein, refers to a C-terminal region of an immunoglobulin heavy chain that contains a portion of a constant region. The Fc region usually includes CH2 and CH3 of an antibody heavy chain constant region. In addition, the Fc region includes a wild-type Fc region and a variant Fc region.

(21) In an embodiment of the present invention, the first domain may be a Fab or scFv region of an antibody binding to an insulin receptor. The term Fab, as used herein, refers to one that includes variable and constant regions of a light chain, and variable and CH1 regions of a heavy chain. The term scFv, as used herein, refers to one that includes a heavy chain variable region and a light chain variable region of an antibody, and may be composed of light chain variable region (VL)-linker-heavy chain variable region (VH). The linker refers to an amino acid sequence having a certain length which functions to artificially link the heavy chain variable region to the light chain variable region.

(22) The first domain includes CDRs, and these CDRs confer binding specificity for a certain antigen, in which a set of the CDRs (CDR1, CDR2, CDR3) may provide a binding site for the antigen.

(23) In an embodiment of the present invention, the first domain may include a heavy chain variable region (VH) that includes H-CDR1 having the amino acid sequence of SEQ ID NO: 1; H-CDR2 having the amino acid sequence of SEQ ID NO: 3; and H-CDR3 having any one selected from the group consisting of the amino acid sequences of SEQ ID NOs: 5, 7, and 9; and a light chain variable region (VL) that includes L-CDR1 having the amino acid sequence of SEQ ID NO: 2; L-CDR2 having the amino acid sequence of SEQ ID NO: 4; and L-CDR3 having any one selected from the group consisting of the amino acid sequences of SEQ ID NOs: 6, 8, 10, and 11. Preferably, the first domain may include a heavy chain variable region (VH) that includes H-CDR1 having the amino acid sequence of SEQ ID NO: 1; H-CDR2 having the amino acid sequence of SEQ ID NO: 3; and H-CDR3 having the amino acid sequence of SEQ ID NO: 7; and a light chain variable region (VL) that includes L-CDR1 having the amino acid sequence of SEQ ID NO: 2; L-CDR2 having the amino acid sequence of SEQ ID NO: 4; and L-CDR3 having the amino acid sequence of SEQ ID NO: 8.

(24) In an embodiment of the present invention, a first monomer obtained by binding the C-terminus of the first domain to the N-terminus of the Fc region may have a heavy chain having any one selected from the group consisting of the amino acid sequences of SEQ ID NOs: 12, 14, 16, and 17; and a light chain having any one selected from the group consisting of the amino acid sequences of SEQ ID NO: 13, 15, 18, and 19.

(25) In an embodiment of the present invention, the second domain may have the amino acid sequence of SEQ ID NO: 21. In an embodiment of the present invention, the fusion protein may have a structure in which the C-terminus of the second domain is bound to the N-terminus of the Fc region; and a second monomer obtained by the above-mentioned binding may have the amino acid sequence of SEQ ID NO: 20.

(26) More specifically, the first domain and the Fc region may be bound to each other via a linker. In addition, the second domain and the Fc region may be bound to each other via a linker. As the linker, a single-chain peptide linker, which consists of 5 to 20 amino acids joined together by peptide bonds, may be used. The amino acids may be one or more selected from the group consisting of glycine, serine, alanine, proline, valine, leucine, isoleucine, methionine, phenylalanine, tyrosine, tryptophan, threonine, cysteine, asparagine, glutamine, lysine, arginine, histidine, aspartic acid, and glutamic acid. Specifically, the linker may consist of glycine and serine, and may be a linker of (G4S)n (where n is 1 to 5). In an embodiment of the present invention, the linker may have the amino acid sequence of SEQ ID NO: 22.

(27) In an embodiment of the present invention, the fusion protein may have an asymmetric structure in which the C-terminus of the first domain is bound to the N-terminus of either one of the dimeric Fc region, and the C-terminus of the second domain is bound to the other N-terminus of the dimeric Fc region. Since the fusion protein has an asymmetric structure, it is possible to prevent a problem that a divalent antibody is likely to be biased toward a degradation pathway.

(28) In an embodiment of the present invention, the fusion protein may be a human antibody, a humanized antibody, or a chimeric antibody. The term human antibody refers to an intact antibody having a variable region whose structure and CDR regions are derived from an immunoglobulin sequence; the term humanized antibody refers to a chimeric antibody that includes a minimal sequence derived from an immunoglobulin of a non-human antibody such as a mouse antibody; and the term chimeric antibody refers to an antibody derived from a combination of different mammals such as mouse, rat, rabbit, goat, or human.

(29) In an embodiment of the present invention, the fusion protein may be prepared by methods commonly practiced in the art, for example, knob-in-hole method (Ridgway et al, Protein Engineering, 617-621 (1996)), phage antibody library method (Clackson et al, Nature, 352:624-628 (1991)), fusion method (Kohler and Milstein, European Journal of Immunology, 6:511-519 (1976)), and recombinant DNA method (U.S. Pat. No. 4,816,567).

(30) In an embodiment of the present invention, IDS-fused fusion proteins (IDS-IR739, IDS-HL009, and IDS-H031) were prepared using the phage antibody library method and the knob-in-hole method. The fusion proteins can bind to an insulin receptor and pass through the BBB via a receptor-mediated transcytosis (RMT) mechanism, so that an IDS-fused fusion partner site can act on a target in the brain (FIG. 1).

(31) For antibodies that pass through the BBB via the RMT mechanism, their affinity for a BBB receptor is very important. Specifically, in a case where the affinity is lower than an appropriate level, there is a problem that their binding efficiency to the BBB is decreased. On the other hand, in a case where the affinity is higher than the appropriate level, a rate at which a therapeutic agent is released after passing through the BBB is deceased, resulting in a decrease in BBB passage efficiency.

(32) In an embodiment of the present invention, the fusion protein may not inhibit binding of insulin to an insulin receptor.

(33) In addition, in an aspect of the present invention, there is provided a pharmaceutical composition for preventing or treating a central nervous system (CNS) disease, comprising the fusion protein as an active ingredient.

(34) The term central nervous system (CNS), as used herein, refers to a complex of nervous tissues which controls body functions, and includes the brain and the spinal cord. The central nervous system disease refers to a disease or disorder which affects the CNS and/or has an etiology in the CNS. Specific examples of the disease include lysosome storage disease (LSD), Huntington's disease, epilepsy, Parkinson's disease, Alzheimer's disease, stroke, corticobasal degeneration (CBD), corticobasal ganglionic degeneration (CBGD), frontotemporal dementia (FTD), multiple system atrophy (MSA), progressive supranuclear palsy (PSP), and brain cancer. Specific examples of the lysosomal storage disease include Hunter syndrome, Tay-Sachs disease, Niemann-Pick disease, Pompe disease, Krabbe disease, Gaucher disease, Fabry disease, Wolman disease, Morquio syndrome, Menkes syndrome, galactosialidosis, glycogen storage disease, Fanconi-Bickel syndrome, Lesch-Nyhan syndrome, Zellweger syndrome, and the like.

(35) The pharmaceutical composition may further comprise a pharmaceutically acceptable carrier. For oral administration, a binder, a lubricant, a disintegrant, an excipient, a solubilizer, a dispersant, a stabilizer, a suspending agent, a coloring agent, a flavoring agent, and the like may be used. For injections, a buffering agent, a preservative, a soothing agent, a solubilizer, an isotonic agent, a stabilizer, and the like may be mixed and used. For topical administration, a base, an excipient, a lubricant, a preservative, and the like may be used.

(36) The pharmaceutical composition may be prepared in various formulations by being mixed with the above-described pharmaceutically acceptable carrier. For injections, the pharmaceutical composition may be prepared in unit dosage ampoules or multiple dosage forms.

(37) In addition, the pharmaceutical composition may comprise a surfactant capable of enhancing membrane permeability thereof. This surfactant includes, but is not limited to, those derived from steroids, cationic lipids such as N-[1-(2,3-dioleoyl)propyl-N,N,N-trimethylammoniumchloride (DOTMA), or various compounds such as cholesterol hemisuccinate and phosphatidyl glycerol.

(38) For administration route and dosage of the pharmaceutical composition, administration may be performed in various ways and amounts depending on the individual's condition and the presence or absence of adverse effects, and the optimal administration method and dosage may be selected in an appropriate range by a person skilled in the art.

(39) Specifically, for parenteral administration, the pharmaceutical composition may be administered by any one route selected from, but not limited to, the group consisting of intravenous, intramuscular, intradermal, subcutaneous, intraperitoneal, intraarteriolar, intraventricular, intralesional, intrathecal, and topical administration, and combinations thereof. In addition, a daily dosage of the composition is about 0.0001 mg/kg to 100 mg/kg, and preferably 0.001 mg/kg to 10 mg/kg; and the dosage is preferably administered once to several times a day. However, the dosage may vary depending on the individual's body weight, age, gender, health status, diet, administration time, administration method, excretion rate, and severity of disease.

(40) The pharmaceutical composition may be administered in various formulations when administered parenterally; and in a case of being prepared into formulations, the pharmaceutical composition may be prepared using commonly used diluents or excipients, such as fillers, extenders, binders, wetting agents, disintegrants, and surfactants. Formulations for parenteral administration may include sterilized aqueous solutions, non-aqueous solutions, suspensions, emulsions, lyophilized formulations, and suppositories. In addition, for the non-aqueous solutions or suspensions, vegetable oils such as propylene glycol, polyethylene glycol, and olive oil, injectable esters such as ethyl oleate, and the like may be used. For a base of the suppositories, Witepsol, Macrogol, Tween 61, cacao butter, laurin fat, glycerogelatin, or the like may be used.

(41) The term individual, as used herein, refers to a mammal, preferably a human, suffering from or at risk of developing a condition or disease that can be alleviated, suppressed, or treated by administration of the pharmaceutical composition.

(42) The term prevention, as used herein, refers to any act of blocking a disease, or suppressing or delaying symptoms of the disease using the pharmaceutical composition.

(43) The term treatment, as used herein, refers to any act of improving or beneficially altering a disease using the pharmaceutical composition.

(44) In addition, in an aspect of the present invention, there is provided a method for preparing a fusion protein, comprising steps of: causing an antibody binding to an insulin receptor to be bound to an Fc region, to prepare a first monomer; causing iduronate-2-sulfatase (IDS) to be bound to a heterodimeric Fc region, to prepare a second monomer; and mixing the first monomer with the second monomer.

(45) In an embodiment of the present invention, the Fc region may be derived from the heavy chain constant region (CH) of IgG1, IgG2, IgG3, or IgG4.

(46) In an embodiment of the present invention, the antibody may include a heavy chain variable region (VH) that includes H-CDR1 having the amino acid sequence of SEQ ID NO: 1; H-CDR2 having the amino acid sequence of SEQ ID NO: 3; and H-CDR3 having any one selected from the group consisting of the amino acid sequences of SEQ ID NOs: 5, 7, and 9; and a light chain variable region (VL) that includes L-CDR1 having the amino acid sequence of SEQ ID NO: 2; L-CDR2 having the amino acid sequence of SEQ ID NO: 4; and L-CDR3 having any one selected from the group consisting of the amino acid sequences of SEQ ID NOs: 6, 8, 10, and 11. Specifically, the antibody fragment may include a heavy chain variable region (VH) that includes H-CDR1 having the amino acid sequence of SEQ ID NO: 1; H-CDR2 having the amino acid sequence of SEQ ID NO: 3; and H-CDR3 having the amino acid sequence of SEQ ID NO: 7; and a light chain variable region (VL) that includes L-CDR1 having the amino acid sequence of SEQ ID NO: 2; L-CDR2 having the amino acid sequence of SEQ ID NO: 4; and L-CDR3 having the amino acid sequence of SEQ ID NO: 8.

(47) In an embodiment of the present invention, in a case where CH3 in the Fc region of the first monomer has a knob structure, CH3 in the second monomer may have a hole structure; or in a case where CH3 in the Fc region of the first monomer has a hole structure, CH3 in the second monomer may have a knob structure.

(48) In an embodiment of the present invention, the IDS may have the amino acid sequence of SEQ ID NO: 21.

(49) In an embodiment of the present invention, the first monomer may include a heavy chain having any one selected from the group consisting of the amino acid sequences of SEQ ID NOs: 12, 14, 16, and 17, and a light chain having any one selected from the group consisting of the amino acid sequences of SEQ ID NO: 13, 15, 18, and 19; and the second monomer may have the amino acid sequence of SEQ ID NO: 20.

(50) More specifically, the fusion protein IDS-IR739 according to the present invention may comprise a first monomer that includes a heavy chain having the amino acid sequence of SEQ ID NO: 12 or 16 and a light chain having the amino acid sequence of SEQ ID NO: 13, and a second monomer having the amino acid sequence of SEQ ID NO: 20.

(51) The fusion protein IDS-HL009 according to the present invention may comprise a first monomer that includes a heavy chain having the amino acid sequence of SEQ ID NO: 14 and a light chain having the amino acid sequence of SEQ ID NO: 15, and a second monomer having the amino acid sequence of SEQ ID NO: 20.

(52) The fusion protein IDS-H031 according to the present invention may comprise a first monomer that includes a heavy chain having the amino acid sequence of SEQ ID NO: 14 and a light chain having the amino acid sequence of SEQ ID NO: 13, and a second monomer having the amino acid sequence of SEQ ID NO: 20.

(53) The fusion protein IDS-H118 according to the present invention may comprise a first monomer that includes a heavy chain having the amino acid sequence of SEQ ID NO: 17 and a light chain having the amino acid sequence of SEQ ID NO: 13, and a second monomer having the amino acid sequence of SEQ ID NO: 20.

(54) The fusion protein IDS-L016 according to the present invention may comprise a first monomer that includes a heavy chain having the amino acid sequence of SEQ ID NO: 12 or 16 and a light chain having the amino acid sequence of SEQ ID NO: 18, and a second monomer having the amino acid sequence of SEQ ID NO: 20.

(55) The fusion protein IDS-L113 according to the present invention may comprise a first monomer that includes a heavy chain having the amino acid sequence of SEQ ID NO: 12 or 16 and a light chain having the amino acid sequence of SEQ ID NO: 19, and a second monomer having the amino acid sequence of SEQ ID NO: 20.

(56) The present invention provides a use of the fusion protein for preventing or treating a central nervous system disease.

(57) In addition, the present invention provides a use of the fusion protein for manufacture of a medicament for preventing or treating a central nervous system disease.

(58) In addition, the present invention provides a method for preventing or treating a central nervous system disease, and/or a method for enhancing a therapeutic effect, the method comprising a step of administering, to an individual, the fusion protein or the pharmaceutical composition comprising the fusion protein.

(59) The individual may be an individual suffering from a central nervous system disease. In addition, the individual may be a mammal, and preferably a human.

(60) For administration route, dosage, and administration frequency of the fusion protein or the pharmaceutical composition, administration to a subject may be performed in various ways and amounts depending on the subject's condition and the presence or absence of adverse effects, and the optimal administration method, dosage, and administration frequency may be selected in an appropriate range by a person skilled in the art. In addition, the fusion protein or the pharmaceutical composition may be administered in combination with other drugs or physiologically active substances whose therapeutic effect is known for the disease to be treated, or may be formulated in the form of a combination formulation with other drugs.

MODE FOR THE INVENTION

(61) Hereinafter, the present invention will be described in more detail by way of the following examples. However, the following examples are for illustrative purposes only, and the scope of the present invention is not limited thereto.

Preparation Example 1. Preparation of IR739 Antibody

(62) Human synthetic scFv libraries (MIDAS, MOGAM) were used to prepare anti-IR antibodies. A phage library of MIDAS was placed in a tube coated with human IR at a concentration of 5 ?g/ml, and treatment was performed at 37? C. for 2 hours. Washing was performed 4 times with PBS buffer to which 0.05% Tween 20 was added. Then, treatment with 1% BSA/0.1 M glycine (pH 2.0) buffer was performed at room temperature for 10 minutes to elute phages bound to IR. The eluted phages were neutralized with 70 ?l of 2 M Tris-HCl (pH 9.0), and used to infect 9 ml of previously cultured E. coli (XL1-Blue) for 30 minutes. To the phage-infected XL1-Blue were added super broth (SB) medium, tetracycline, and carbenicillin, and culture was performed at 37? C. for 1 hour. Then, helper phages were added thereto. Culture was performed for additional one hour. The medium was added thereto up to 100 ml, and culture was performed overnight at 37? C.

(63) The culture medium was harvested by centrifugation, and the phages were precipitated with a 20% PEG solution. After centrifugation, the phages were collected with a PBS solution to which 1% BSA was added. Using the solution in which the phages were collected, a panning process was repeated up to the fourth time alternately with a mouse IR-coated tube and a human IR-coated tube. Each of tertiary phage- and quaternary phage-infected XL1-Blue colonies was cultured, to obtain each phage-containing culture solution. Using the culture solution and IR-coated plates, phage-expressing XL1-Blue clones that simultaneously bind to human IR and mouse IR were selected by ELISA. Plasmids of the selected clones were sequenced to obtain VH and VL sequences. Based on these sequences, antibodies having a conventional IgG form were prepared.

(64) Through the cross-reactivity evaluation in Experimental Example 1 below, among the antibodies obtained through screening of the MIDAS human scFv libraries, IR739, which is an antibody binding to both human IR, monkey IR, and mouse IR, was selected. A protein sequence of IR739 prepared as described above is shown in Table 1 below.

(65) TABLE-US-00001 TABLE1 H- EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMSWVRQAPGK chain GLEWVSAISYGGSSTYYADSVKGRFTISRDNSKNTLYLQMNSL RAEDTAVYYCARHPSYGTVNHAYFDVWGQGTLVTVSSASTKGP SVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNT KVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEW ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG(SEQIDNO:12) L- DIQMTQSPSSLSASVGDRVTITCGASRDVSSYLAWYQQKPGKA chain PKLLIYDANILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATY YCLEYNNLPLTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGT ASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDST YSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQIDNO:13)

Preparation Example 2. Preparation of Variants of IR739 Antibody

(66) Using random mutagenesis, mutations were introduced into the Asn-Asn sequence in LCDR3 and the Ser-Tyr-Gly-Thr-Val-Asn-His sequence in HCDR3 (FIG. 2). In order to introduce the mutations, the gene of IR739 was subjected to PCR using primers obtained by replacing codons of the corresponding sequences with NNK degenerate codons (N=A, T, G, or C, and K=G or T), to prepare mutant scFv DNA fragments. 1 ?g of pCIw vector (Promega), to which each of the mutant scFv DNA fragments was ligated, was transformed into 100 ?l of XL1-Blue by electroporation. Then, the resultant was placed in 10 ml of super broth (SB) medium, and culture was performed at 37? C. for 1 hour.

(67) 10 ml of helper phages were added thereto, and culture was performed at 37? C. for 1 hour. Then, 80 ml of medium supplemented with tetracycline and carbenicillin was further added thereto, and culture was performed overnight. The culture solution of XL1-Blue into which the mutations were introduced was harvested by centrifugation, and the phages were precipitated with a 20% PEG solution. After centrifugation, culture with 1% BSA/0.1 M glycine (pH 2.0) buffer was performed at room temperature for 10 minutes to elute phages bound to IR. The eluted phages were neutralized with 70 ?l of 2 M Tris-HCl (pH 9.0), and used to infect 9 ml of previously cultured E. coli (XL1-Blue) for 30 minutes. To the phage-infected XL1-Blue were added super broth (SB) medium, tetracycline, and carbenicillin, and culture was performed at 37? C. for 1 hour. Then, helper phages were added thereto. Culture was performed for additional one hour. The medium was added thereto up to 100 ml, and culture was performed overnight at 37? C.

(68) The culture medium was harvested by centrifugation, and the phages were precipitated with a 20% PEG solution. After centrifugation, the phages were collected with a PBS solution to which 1% BSA was added. Using the solution in which the phages were collected, a panning process was repeated up to the fourth time alternately with a mouse IR-coated tube and a human IR-coated tube. Each of tertiary phage- and quaternary phage-infected XL1-Blue colonies was cultured, to obtain each phage-containing culture solution. Using the culture solution and IR-coated plates, clones having higher or smaller absorbance than IR739 were selected through ELISA. The selected clones were sequenced to select unique sequences (FIG. 3), and cloned to prepare H031, H118, HL009, L016, and L113, which are variants having a conventional IgG form.

Preparation Example 3. Preparation of Asymmetric Fusion Antibodies

(69) To prepare each of IDS fusion antibodies (IDS-IR739, IDS-H031, IDS-HL009, and IDS-8D3) in which one Fab was replaced with IDS, a knob-in-hole was introduced into the heavy chain of an immunoglobulin. In the heavy chain into which a knob was introduced, Lys409 was replaced with Trp409; and in the heavy chain into which a hole was introduced, Asp399 and Phe405 were replaced with Val399 and Thr405, respectively. Through cloning, the VH in IR739, HL009, and 8D3 was replaced with the VH of the heavy chain into which the hole was introduced, and the C-terminus of IDS was fused to the N-terminus of CH2 of the heavy chain into which the knob was introduced. The 8D3, which is an antibody against a transferrin receptor, was used as a control.

(70) A plasmid expressing the light chain and the heavy chain into which the hole was introduced, and a plasmid expressing CH2-CH3 into which the knob was introduced and to which IDS was fused were co-transfected into CHO cells. Culture was performed at 37? C. for 10 days. The culture solution was separated by centrifugation. Then, IDS-IR739, IDS-HL009, IDS-H031, and IDS-8D3 were purified with a Protein A column. The IDS fusion antibody was eluted from the Protein A column using 1 M L-arginine solution (pH 4). A structure of the asymmetric fusion antibody prepared as described above is illustrated in FIG. 1 (left).

Experimental Example 1. Cross-Reactivity Evaluation

(71) Respective Expi-293 cells, in which each of human IR, monkey IR, and mouse IR was overexpressed, were harvested, and placed in respective tubes at 5?10.sup.6 cells/ml. Then, the tubes were treated with 1 ?g/ml of each of the antibodies obtained through screening of the MIDAS human scFv libraries. Culture was performed at 4? C. for 30 minutes, and then washing was performed 3 times with cold PBS using a centrifuge. A fluorochrome-labeled anti-human antibody (FITC-conjugated anti-human IgG) in 3% BSA/PBS buffer was added thereto, and culture was performed at 4? C. for 30 minutes in the dark. Washing was performed 3 times with a cold buffer of 3% BSA/1% sodium azide/PBS using a centrifuge. Analysis was performed using a FACS instrument. As a result, it was identified that the antibody IR739 bound to all of the human IR, the monkey IR, and the mouse IR (FIG. 4).

Experimental Example 2. Evaluation of Binding Affinity to IR

Experimental Example 2.1. Evaluation of Binding Affinity of IR739

(72) The binding affinity of IR739 to IR was analyzed through surface plasmon resonance (SPR). Human IR or mouse IR at 1 ?g/ml was immobilized with acetate (pH 4.0) on a CM5 sensor chip. IR739 was flowed, at a concentration of 100 nM, 50 nM, 25 nM, 12.5 nM, 6.25 nM, 3.125 nM, or 1.563 nM, over the CM5 sensor chip to which the human IR or the mouse IR was immobilized, while measuring association and dissociation thereof. For measurement conditions, a flow rate was set as 30 ?l/min, and an association time and a dissociation time were set as 120 seconds and 600 seconds, respectively. For regeneration, 10 mM glycine-HCl (pH 1.5) was flowed for 30 seconds. The results of the binding affinity of IR739 to the human IR and the mouse IR are shown in Table 2 below.

(73) TABLE-US-00002 TABLE 2 pH 7.0 Ka (/Ms) Kd (/s) KD (M) Human IR 9.595 ? 10.sup.4 14.35 ?10.sup.?4 14.96 ?10.sup.?9 Mouse IR 9.532 ? 10.sup.4 6.100 ?10.sup.?4 6.4 ?10.sup.?9

Experimental Example 2.2. Comparison of Binding Affinity of IR739 and Variants of IR739

(74) ELISA was performed to compare the binding affinity of IR739 and variants thereof to IR. An ELISA plate coated with IR at a concentration of 5 ?g/ml was blocked with 3% skim milk for 1 hour, and then respective wells were treated with IR739 and the variants thereof at various concentrations. Treatment was performed at 37? C. for 1 hour, and then washing was performed 3 times with 0.05% Tween 20/PBS solution. To detect IR739 and the variants thereof, treatment with peroxidase-conjugated anti-human Fc IgG was performed, and incubation was performed at 37? C. for 1 hour. Then, washing was performed 3 times with 0.05% Tween 20/PBS solution. Color development was performed with tetramethylbenzidine (TMB) ELISA solution, and absorbance at 450 nm was analyzed. As a result, H031 and HL009 had higher binding affinity to the human IR and the mouse IR than IR739, and L016 and H118 had lower binding affinity thereto than IR739. L113 exhibited similar binding affinity to IR739 (FIG. 5).

Experimental Example 2.3. Evaluation of Binding Affinity of Asymmetric Fusion Antibodies

(75) ELISA was performed to identify the binding affinity of IDS-HL009 to IR. An ELISA plate coated with IR at a concentration of 5 ?g/ml was blocked with 3% skim milk for 1 hour, and then respective wells were treated with IR739, IDS-IR739, IDS-HL009, or IDS-H031 at various concentrations. Treatment was performed at 37? C. for 1 hour, and then washing was performed 3 times with 0.05% Tween 20/PBS solution. To detect IR-739, IDS-IR739, IDS-HL009, and IDS-H031, treatment with peroxidase-conjugated anti-human Fc IgG was performed, and incubation was performed at 37? C. for 1 hour. Then, washing was performed 3 times with 0.05% Tween 20/PBS solution. Color development was performed with TMB ELISA solution, and absorbance at 450 nm was analyzed. As a result, IDS-IR739, IDS-H031, and IDS-HL009 had lower binding affinity to the human IR and the mouse IR than IR739 because in such antibodies, an avidity effect was eliminated by replacement of one Fab with IDS (FIG. 6).

Experimental Example 3. Identification of Competition Between Insulin and IR739 for IR

(76) To identify interaction between IR739 and insulin on IR, competitive ELISA was performed. An ELISA plate coated with IR at a concentration of 5 ?g/ml was blocked with 3% skim milk for 1 hour. Then, to respective wells was added a mixture of IR739 and biotinylated insulin at various concentrations. Incubation was performed at 37? C. for 1 hour, and then washing was performed 3 times with 0.05% Tween 20/PBS solution. Treatment with peroxidase-conjugated anti-human Fc IgG was performed to detect IR739, and treatment with peroxidase-conjugated streptavidin was performed to detect the biotinylated insulin.

(77) Incubation was performed at 37? C. for 1 hour. Then, washing was performed 3 times with 0.05% Tween 20/PBS solution, and color development was performed with TMB ELISA solution. Absorbance at 450 nm was analyzed. As a result, a binding pattern of IR739 to IR was not affected by changes in insulin concentration. Specifically, while the insulin concentration changed from 0.6 nM to 150 nM, no changes were observed in binding curves for respective concentrations of IR739 (FIG. 7). In addition, a binding pattern of insulin to IR was also not affected by changes in IR739 concentration; and specifically, no changes were observed in binding curves for respective insulin concentrations while the IR739 concentration changed from 0.03 nM to 7 nM (FIG. 8).

Experimental Example 4. Evaluation of Pharmacokinetics in Mouse Blood

Experimental Example 4.1. Evaluation of Pharmacokinetics of IR739 in Mouse Blood

(78) To analyze stability of IR739 in mouse blood, 5 mg/kg of IR739 or 8D3 antibody (anti-TfR antibody), which was a control, was administered to the tail vein of each mouse. After administration, 50 ?l of blood was collected by eye-bleeding at 30 minutes, 1 hour, 2 hours, 6 hours, and 24 hours, respectively. The blood was centrifuged, and an antibody concentration in the supernatant was analyzed by ELISA. For ELISA, an ELISA plate was coated with anti-human Fab IgG at 1 ?g/ml, blocked with 3% skim milk, and then treated with 50 ?l of the supernatant diluted 1/10. Incubation was performed at 37? C. for 1 hour, and then washing was performed 3 times with 0.05% Tween 20/PBS solution. Treatment with peroxidase-conjugated anti-human Fc IgG was performed. Treatment was performed at 37? C. for 1 hour. Then, washing was performed 3 times with 0.05% Tween 20/PBS solution, and detection was performed with TMB ELISA solution. The concentration was calculated using, as a standard, the results obtained by performing ELISA in the same manner as above with IR739 at 10,000 ng/ml to 4.5 ng/ml (10,000 ng/ml, 3,333 ng/ml, 1,111 ng/ml, 370 ng/ml, 123 ng/ml, 41.2 ng/ml, 13.7 ng/ml, 4.5 ng/ml). It was identified that IR739 had a half-life of about 24 hours (FIG. 9).

Experimental Example 4.2. Evaluation of Pharmacokinetics of IDS-HL009 in Mouse Blood

(79) To analyze stability of IDS-HL009 in mouse blood, 5 mg/kg of IDS, IR739, IDS-HL009, or IDS-8D3 was administered to the tail vein of each mouse. After administration, 50 ?l of blood was collected by eye-bleeding at 30 minutes, 1 hour, 2 hours, 6 hours, and 24 hours, respectively. The blood was centrifuged, and an antibody concentration in the supernatant was analyzed by ELISA. For ELISA, an ELISA plate was coated with anti-human Fab IgG at 1 ?g/ml, blocked with 3% skim milk, and then treated with 50 ?l of the supernatant diluted 1/10.

(80) Incubation was performed at 37? C. for 1 hour, and then washing was performed 3 times with 0.05% Tween 20/PBS solution. Treatment with peroxidase-conjugated anti-human Fc IgG was performed. Treatment was performed at 37? C. for 1 hour. Then, washing was performed 3 times with 0.05% Tween 20/PBS solution, and detection was performed with TMB ELISA solution. The concentration was calculated using, as a standard, the results obtained by performing ELISA in the same manner as above with IR739, IDS-HL009, and IDS-8D3 at 10,000 ng/ml to 4.5 ng/ml (10,000 ng/ml, 3,333 ng/ml, 1,111 ng/ml, 370 ng/ml, 123 ng/ml, 41.2 ng/ml, 13.7 ng/ml, 4.5 ng/ml). To measure the IDS concentration, ELISA was performed on an ELISA plate coated with anti-IDS IgG using biotin-conjugated anti-IDS and HRP-conjugated streptavidin. It was identified that IDS-HL009 had a half-life of about 14 hours (FIG. 10).

Experimental Example 5. Evaluation of Brain Uptake

Experimental Example 5.1. Evaluation of Brain Uptake Efficiency of IR739

(81) To analyze brain uptake efficiency of IR739, negative control IgG (anti-mesothelin (MSLN) IgG), 8D3, or IR739 at 5 mg/kg was injected into the tail vein of each mouse. Here, the anti-mesothelin IgG was used as a negative control and 8D3 was used as a positive control. After 1 hour and 24 hours, each of 3 mice for each substance was perfused, and then the brain was removed therefrom. 1 ml of lysis buffer was added per 100 mg of the brain, and pulverization was performed. Then, centrifugation was performed at 13,000 rpm. An ELISA plate was coated with anti-human Fab IgG at 1 ?g/ml, blocked with 3% skim milk, and then treated with 50 ?l of the supernatant. Incubation was performed at 37? C. for 1 hour, and then washing was performed 3 times with 0.05% Tween 20/PBS solution. Treatment with peroxidase-conjugated anti-human Fc IgG was performed. Incubation was performed at 37? C. for 1 hour. Then, washing was performed 3 times with 0.05% Tween 20/PBS solution, and detection was performed with TMB ELISA solution. The concentration was calculated using, as a standard, the results obtained by performing ELISA in the same manner as above with anti-MSLN IgG, 8D3, and IR739 at 1,000 ng/ml to 0.45 ng/ml (1,000 ng/ml, 333 ng/ml, 111 ng/ml, 37.0 ng/ml, 12.3 ng/ml, 4.12 ng/ml, 1.37 ng/ml, 0.45 ng/ml). IR739 exhibited lower brain uptake efficiency than 8D3 while exhibiting higher brain uptake efficiency than the anti-MSLN IgG (FIG. 11).

Experimental Example 5.2. Evaluation of Brain Uptake Efficiency of Variants of IR739

(82) To analyze brain uptake efficiency of the variants of IR739, anti-MSLN IgG, 8D3, IR739, H031, HL009, L113, or H118 at 5 mg/kg was injected into the tail vein of each mouse. After 1 hour and 24 hours, each of 3 mice for each substance was perfused, and then the brain was removed therefrom. 1 ml of lysis buffer was added per 100 mg of the brain, and pulverization was performed. Then, centrifugation was performed at 13,000 rpm. An ELISA plate was coated with anti-human Fab IgG at 1 g/ml, blocked with 3% skim milk, and then treated with 50 ?l of the supernatant. Incubation was performed at 37? C. for 1 hour, and then washing was performed 3 times with 0.05% Tween 20/PBS solution. Treatment with peroxidase-conjugated anti-human Fc IgG was performed. Incubation was performed at 37? C. for 1 hour. Then, washing was performed 3 times with 0.05% Tween 20/PBS solution, and detection was performed with TMB ELISA solution. The concentration was calculated using, as a standard, the results obtained by performing ELISA in the same manner as above with anti-MSLN IgG, 8D3, IR739, H031, HL009, L113, and H118 at 1,000 ng/ml to 0.45 ng/ml (1,000 ng/ml, 333 ng/ml, 111 ng/ml, 37.0 ng/ml, 12.3 ng/ml, 4.12 ng/ml, 1.37 ng/ml, 0.45 ng/ml). As a result of the analysis, among the variants, HL009 exhibited higher brain uptake efficiency than IR739, whereas H031, L113, and H118 exhibited lower brain uptake efficiency than IR739 (FIG. 12).

Experimental Example 5.3. Evaluation of Brain Uptake Efficiency of IDS-HL009

(83) To analyze brain uptake efficiency of IDS-HL009, IDS-HL009 at 5 mg/kg was injected into the tail vein of each mouse. After 1 hour and 24 hours, each of 3 mice for each substance was perfused, and then the brain was removed therefrom. 1 ml of lysis buffer was added per 100 mg of the brain, and pulverization was performed. Then, centrifugation was performed at 13,000 rpm. An ELISA plate was coated with anti-human Fab IgG at 1 ?g/ml, blocked with 3% skim milk, and then treated with 50 ?l of the supernatant. Incubation was performed at 37? C. for 1 hour, and then washing was performed 3 times with 0.05% Tween 20/PBS solution. Treatment with peroxidase-conjugated anti-human Fc IgG was performed. Incubation was performed at 37? C. for 1 hour. Then, washing was performed 3 times with 0.05% Tween 20/PBS solution, and detection was performed with TMB ELISA solution. The concentration was calculated using, as a standard, the results obtained by performing ELISA in the same manner as above with IDS-HL009 at 1,000 ng/ml to 0.45 ng/ml (1,000 ng/ml, 333 ng/ml, III ng/ml, 37.0 ng/ml, 12.3 ng/ml, 4.12 ng/ml, 1.37 ng/ml, 0.45 ng/ml). IDS-HL009 exhibited higher brain uptake efficiency than IDS, IDS-IR739, and IDS-H031 (FIG. 13).

Experimental Example 6. Evaluation of Characteristics of IDS-HL009

(84) To analyze characteristics of IDS and IDS-HL009, 10 ng/ml IDS or 10 ?l of IDS-HL009 and 20 ?l of 100 mM 4-methylumbelliferyl ?-L-idopyranosiduronic acid-2-sulfate (4MU-?-IdopyraA-2) were placed in a 96-well plate (black), and incubation was performed at 37? C. for 4 hours. The reaction was stopped by addition of 20 ?l of a Pi/Ci solution (pH 4.5), and 10 ?l of 25 ?g/ml recombinant human ?-L-iduronidase was added thereto. Incubation was performed at 37? C. for 24 hours. Then, 200 ?l of 0.25 M sodium carbonate/bicarbonate (pH 10.0) was added thereto and fluorescence was measured (absorption: 355 nm/emission: 460 nm). The activity was analyzed using 4-methylumbelliferone as a standard, and the results are shown in Table 3 below.

(85) TABLE-US-00003 TABLE 3 IDS IDS-HL009 nmol/min/?g 51.4 13.0 nmol/min/pmole 3,084 2,105 % of IDS 68.3

(86) As shown in Table 3, IDS activity of IDS-HL009 indicated IDS:IDS-HL009=51.4:13.0 nmol/min based on ?g of protein, and indicated IDS:IDS-HL009=3,084:2,105 nmol/min based on mole of protein. From the above results, it was identifiable that IDS-HL009 had about 70% IDS activity with respect to IDS based on mole of protein.