ANTI-PLA2G2D CONSTRUCTS AND USES THEREOF
20240327540 ยท 2024-10-03
Inventors
- Li-Fen LEE (South San Francisco, CA, US)
- Kan LU (San Francisco, CA, US)
- Jessica YU (South San Francisco, CA, US)
- Julie HUANG (South San Francisco, CA, US)
- Madeline WU (South San Francisco, CA, US)
- Ariel Yuxin CHEN (South San Francisco, CA, US)
Cpc classification
A61K45/06
HUMAN NECESSITIES
International classification
Abstract
The present application provides anti-PLA2G2D constructs that bind to PLA2G2D (e.g., anti-PLA2G2D antibodies), nucleic acid molecules encoding an amino acid sequence of the anti-PLA2G2D, vectors comprising the nucleic acid molecules, host cells containing the vectors, methods of preparing the anti-PLA2G2D construct, pharmaceutical compositions containing the anti-PLA2G2D construct, and methods of using the anti-PLA2G2D construct or compositions.
Claims
1. An anti-PLA2G2D construct comprising an antibody moiety comprising a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein: 1) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 131, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 133, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 134, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 2) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 139, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 140, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 141, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 142, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 3) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 150, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 151, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 4) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 139, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 145, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 146, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 5) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 157, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 145, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 6) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 160, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 145, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 7) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 162, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 8) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 165, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 9) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 17, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 278, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 19, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 20, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 22, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 10) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 170, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 171, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 11) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 174, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 175, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 12) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 188, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 189, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 13) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 178, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 181, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 14) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 178, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 15) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 192, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 16) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 192, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 200, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 17) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 203, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 18) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 185, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 19) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 206, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 207, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 208, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 20) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 195, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 196, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 197, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 21) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 211, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 22) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 214, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 215, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 216, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 217, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 218, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 219, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 23) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 222, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 223, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 224, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 24) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 227, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 228, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 25) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 227, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 231, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 232, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 233, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 234, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 26) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 237, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 238, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 189, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 27) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 241, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 242, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 28) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 261, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 262, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 263, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 264, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 29) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 267, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 268, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 269, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 270, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 30) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 45, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 46, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 47, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 48, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 22, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 31) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 17, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 18, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 19, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 20, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 22, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 32) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 25, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 26, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 27, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 28, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 29, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 33) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 77, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 78, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 27, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 28, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 79, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 34) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 82, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 83, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 84, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 85, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 86, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 35) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 124, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 125, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 126, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 127, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 128, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 36) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 89, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 90, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 91, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 92, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 93, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 94, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 37) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 97, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 99, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 105, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 93, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 106, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 38) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 245, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 246, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 247, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 248, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 249, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 250, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 39) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 253, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 254, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 255, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 256, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 257, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 258, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 40) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 9, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 10, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 11, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 13, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 14, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 42) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 67, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 68, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 69, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 13, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 273, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 43) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 1, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 2, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 3, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 4, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 6, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 44) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 51, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 52, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 53, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 54, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 55, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 56, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 45) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 116, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 117, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 118, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 119, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 120, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 121, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 46) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 59, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 60, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 61, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 62, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 63, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 64, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 47) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 108, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 109, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 110, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 111, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 112, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 113, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 49) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 37, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 38, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 39, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 40, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 41, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 42, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 50) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 67, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 274, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 69, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 275, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 273, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 51) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 97, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 99, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 100, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 101, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 102, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs; 52) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 279, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 280, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 133, 140, 145, 151, 162, 165, 170, 174, 178, 185, 188, 192, 196, 203, 206, 216, 223, 228, 232, 238, 242, 262, or 268; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 281, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 282, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 283; 53) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 284 or 285, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 286 or 287, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 288, 47, or 19; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 289, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 290; 54) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 291, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 292, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 293; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 295, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 295, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 250, 258, 94, or 106; 55) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 294, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 246 or 254, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 247 or 255; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 295, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 295, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 250, 258, 94, or 106; 56) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 9, 32, or 67, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 10, 33, 68, or 274, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 11, 34, or 69; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 297, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 298; 57) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 1, 51, or 116, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 2, 52, 117, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 3, 53, or 118; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 299, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 300, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 6, 56, or 121; 58) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 59 or 108, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 60 or 109, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 61 or 110; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 301, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 302, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 303; 59) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 67, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 68, 274, or 304, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 69; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 305, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 273; or 60) the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 306 or 97, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 307 or 98, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 39, 99, or 53; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 308 or 54, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 41, 101, or 55, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 309 or 102.
2. An anti-PLA2G2D construct comprising an antibody moiety that specifically binds to PLA2G2D, comprising: 1) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 7, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 8; 2) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 15, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 16; 3) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 23, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 24; 4) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 30, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 31; 6) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 43, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 44; 7) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 49, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 50; 8) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 57, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 58; 9) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 65, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 66; 10) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 70, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 71; 11) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 75, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 76; 12) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 80, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 81; 13) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 87, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 88; 14) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 95, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 96; 15) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 103, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 104; 16) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 103, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 107; 17) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 114, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 115; 18) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 122, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 123; 19) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 129, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 130; 20) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 137, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 138; 21) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 143, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 144; 22) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 148, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 149; 23) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 153, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 154; 24) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 158, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 159; 25) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 155, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 156; 26) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 163, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 164; 27) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 168, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 169; 28) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 172, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 173; 29) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 166, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 167; 30) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 176, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 177; 31) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 183, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 184; 32) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 186, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 187; 33) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 190, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 191; 34) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 179, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 180; 35) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 193, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 194; 36) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 198, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 199; 37) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 201, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 202; 38) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 204, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 205; 39) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 209, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 210; 40) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 212, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 213; 41) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 220, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 221; 42) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 225, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 226; 43) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 229, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 230; 44) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 235, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 236; 45) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 239, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 240; 46) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 243, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 244; 47) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 251, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 252; 48) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 259, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 260; 49) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 265, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 266; 50) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 271, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 272; or 51) a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 276, and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 277.
3. The anti-PLA2G2D construct of claim 1 or claim 2, wherein the V.sub.H comprises an amino acid sequence of any one of SEQ ID NOs: 7, 15, 23, 30, 35, 43, 49, 57, 65, 70, 75, 80, 87, 95, 103, 114, 122, 129, 137, 143, 148, 153, 158, 155, 163, 168, 172, 166, 176, 183, 186, 190, 179, 193, 198, 201, 204, 209, 212, 220, 225, 229, 235, 239, 243, 251, 259, 265, 271, and 276, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and/or wherein the V.sub.L comprises an amino acid sequence of any one of SEQ ID NOs: 8, 16, 24, 31, 36, 44, 50, 58, 66, 71, 76, 81, 88, 96, 104, 107, 115, 123, 130, 138, 144, 149, 154, 159, 156, 164, 169, 173, 167, 177, 184, 187, 191, 180, 194, 199, 202, 205, 210, 213, 221, 226, 230, 236, 240, 244, 252, 260, 266, 272, and 277, or a variant comprising an amino acid sequence having at least about 80% sequence identity.
4. The anti-PLA2G2D construct of any one of claims 1-3, wherein: 1) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 7, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 8, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 2) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 15, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 16, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 3) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 23, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 24, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 4) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 30, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 31, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 6) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 43, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 44, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 7) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 49, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 50, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 8) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 57, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 58, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 9) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 65, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 66, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 10) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 70, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 71, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 11) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 75, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 76, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 12) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 80, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 81, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 13) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 87, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 88, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 14) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 95, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 96, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 15) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 103, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 104, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 16) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 103, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 107, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 17) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 114, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 115, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 18) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 122, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 123, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 19) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 129, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 130, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 20) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 137, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 138, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 21) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 143, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 144, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 22) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 148, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 149, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 23) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 153, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 154, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 24) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 158, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 159, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 25) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 155, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 156, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 26) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 163, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 164, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 27) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 168, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 169, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 28) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 172, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 173, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 29) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 166, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 167, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 30) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 176, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 177, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 31) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 183, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 184, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 32) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 186, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 187, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 33) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 190, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 191, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 34) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 179, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 180, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 35) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 193, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 194, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 36) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 198, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 199, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 37) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 201, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 202, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 38) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 204, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 205, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 39) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 209, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 210, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 40) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 212, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 213, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 41) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 220, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 221, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 42) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 225, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 226, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 43) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 229, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 230, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 44) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 235, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 236, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 45) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 239, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 240, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 46) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 243, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 244, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 47) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 251, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 252, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 48) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 259, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 260, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 49) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 265, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 266, or a variant comprising an amino acid sequence having at least about 80% sequence identity, 50) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 271, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 272, or a variant comprising an amino acid sequence having at least about 80% sequence identity, or 51) the V.sub.H comprises an amino acid sequence of SEQ ID NO: 276, or a variant comprising an amino acid sequence having at least about 80% sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 277, or a variant comprising an amino acid sequence having at least about 80% sequence identity.
5. The anti-PLA2G2D construct of any one of claims 1-4, wherein the antibody moiety is an antibody or antigen-binding fragment thereof selected from the group consisting of a full-length antibody, a bispecific antibody, a single-chain Fv (scFv) fragment, a Fab fragment, a Fab fragment, a F (ab)2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv).sub.2, a Fv-Fc fusion, a scFv-Fc fusion, a scFv-Fv fusion, a diabody, a tribody, and a tetrabody.
6. The anti-PLA2G2D construct of claim 5, wherein the antibody moiety is a full-length antibody.
7. The anti-PLA2G2D construct of any one of claims 1-6, wherein the antibody moiety has an Fc fragment is selected from the group consisting of Fc fragments form IgG, IgA, IgD, IgE, IgM, and combinations and hybrids thereof.
8. The anti-PLA2G2D construct of claim 7, wherein the Fc fragment is selected from the group consisting of Fc fragments from IgG1, IgG2, IgG3, IgG4, and combinations and hybrids thereof.
9. The anti-PLA2G2D construct of claim 7 or claim 8, wherein the Fc fragment has a reduced effector function as compared to the corresponding wildtype Fc fragment.
10. The anti-PLA2G2D construct of claim 7 or claim 8, wherein the Fc fragment has an enhanced effector function as compared to the corresponding wildtype Fc fragment.
11. The anti-PLA2G2D construct of any one of claims 1-10, wherein the construct is a full-length antibody, a fusion protein, or an immunoconjugate.
12. The anti-PLA2G2D construct of any one of claims 1-11, wherein the PLA2G2D is a human PLA2G2D.
13. An anti-PLA2G2D construct competes for a binding epitope of PLA2G2D with the anti-PLA2G2D construct of any one of claims 1-12.
14. A pharmaceutical composition comprising the anti-PLA2G2D construct of any one of claims 1-13, and a pharmaceutical acceptable carrier.
15. An isolated nucleic acid encoding the anti-PLA2G2D construct of any one of claims 1-13 or a portion thereof.
16. A vector comprising the isolated nucleic acid of claim 15.
17. An isolated host cell comprising the isolated nucleic acid of claim 15, or the vector of claim 16.
18. A method of producing an anti-PLA2G2D construct comprising: a) culturing the isolated host cell of claim 16 under conditions effective to express the anti-PLA2G2D construct; and b) obtaining the expressed anti-PLA2G2D construct from the host cell.
19. A method of treating a disease or condition in an individual, comprising administering to the individual an effective mount of the anti-PLA2G2D construct of any one of claims 1-13, or the pharmaceutical composition of claim 14.
20. The method of claim 19, wherein the disease or condition is a cancer, optionally the cancer is a solid tumor.
21. The method of claim 19, wherein the cancer is an advanced or malignant tumor.
22. The method of claim 20 or claim 21, wherein the cancer has an increased expression level of PLA2G2D.
23. The method of any one of claims 20-22, wherein the cancer is selected from the group consisting of lung cancer, breast cancer, liver cancer, gastric cancer, cervical cancer, endometrial cancer, thyroid cancer, colorectal cancer, head and neck cancer, pancreatic cancer, renal cancer, prostate cancer, urothelial cancer, testis cancer, ovarian cancer and melanoma.
24. The method of claim 19, wherein the disease or condition is a viral infection.
25. The method of claim 24, wherein the expression level of PLA2G2D at an infected site is higher than that of an uninfected site.
26. The method of any one of claims 19-25, wherein the method further comprises administering a second agent.
27. The method of claim 26, wherein the second agent is selected from the group consisting of a chemotherapeutic agent, an immunomodulator, an anti-angiogenesis agent, a growth inhibitory agent, and an antineoplastic agent.
28. The method of claim 27, wherein the second agent is an immunomodulator.
29. The method of claim 28, wherein the immunomodulator is an immune checkpoint inhibitor.
30. The method of claim 29, wherein the immune checkpoint inhibitor specifically target PD-L1, PD-L2, CTLA4, PD-L2, PD-1, CD47, TIGIT, GITR, TIM3, LAG3, CD27, 4-1BB, or B7H4.
31. The method of claim 26, wherein the second agent comprises a cell comprising a chimeric antigen receptor that specifically binds to a tumor antigen.
32. The method of any one of claims 26-31, wherein the anti-PLA2G2D construct and the second agent are administered simultaneously or concurrently.
33. The method of any one of claims 26-31, wherein the anti-PLA2G2D construct and the second agent are administered sequentially.
34. The method of any one of claims 26-33, wherein the anti-PLA2G2D construct and/or the second agent are administered parentally.
35. The method of any one of claims 19-34, wherein the anti-PLA2G2D construct is administered to the cancer tissue or infection site directly.
36. The method of any one of claims 19-35, wherein the anti-PLA2G2D construct is administered at a dose of about 0.001 ?g/kg to about 100 mg/kg.
37. The method of any one of claims 19-36, wherein the individual has an increased number of immune cells in the cancer tissue or at the infection site after administration of the anti-PLA2G2D construct.
38. The method of claim 37, wherein the immune cells are T cells.
39. The method of claim 38, wherein the T cells are activated T cells.
40. The method of any one of claims 37-39, wherein the number of immune cells in the cancer tissue or at the infection site is increased by at least about 5% after administration of the anti-PLA2G2D construct.
41. The method of any one of claims 20-40, wherein immune cells in the cancer tissue or at the infection site produce an increased level of a cytokine after administration of the anti-PLA2G2D construct.
42. The method of claim 41, wherein the cytokine is IFN? and/or IL-2.
43. The method of claim 41 or 42, wherein the level of the cytokine is increased by at least about 5% after administration of the anti-PLA2G2D construct.
Description
BRIEF DESCRIPTION OF FIGURES
[0182]
[0183]
[0184]
DETAILED DESCRIPTION OF THE INVENTION
[0185] The present application provides novel anti-PLA2G2D constructs that specifically bind to PLA2G2D (such as anti-PLA2G2D monoclonal or multispecific antibodies), methods of preparing the anti-PLA2G2D constructs, and methods of using the constructs (e.g., methods of treating a disease or condition).
I. Definitions
[0186] It is understood that embodiments of the application described terms of comprising herein include consisting and/or consisting essentially of embodiments.
[0187] Unless specifically indicated otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by those of ordinary skill in the art to which this application belongs. In addition, any method or material similar or equivalent to a method or material described herein can be used in the practice of the present application. For purposes of the present application, the following terms are defined.
[0188] The term antibody is used in its broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), full-length antibodies and antigen-binding fragments thereof, so long as they exhibit the desired antigen-binding activity. The term antibody moiety refers to a full-length antibody or an antigen-binding fragment thereof.
[0189] A full-length antibody comprises two heavy chains and two light chains. The variable regions of the light and heavy chains are responsible for antigen binding. The variable domains of the heavy chain and light chain may be referred to as V.sub.H and V.sub.L, respectively. The variable regions in both chains generally contain three highly variable loops called the complementarity determining regions (CDRs) (light chain (LC) CDRs including LC-CDR1, LC-CDR2, and LC-CDR3, heavy chain (HC) CDRs including HC-CDR1, HC-CDR2, and HC-CDR3). CDR boundaries for the antibodies and antigen-binding fragments disclosed herein may be defined or identified by the conventions of Kabat, Chothia, or Al-Lazikani (Al-Lazikani 1997; Chothia 1985; Chothia 1987; Chothia 1989; Kabat 1987; Kabat 1991). The three CDRs of the heavy or light chains are interposed between flanking stretches known as framework regions (FRs), which are more highly conserved than the CDRs and form a scaffold to support the hypervariable loops. The constant regions of the heavy and light chains are not involved in antigen binding, but exhibit various effector functions. Antibodies are assigned to classes based on the amino acid sequence of the constant region of their heavy chain. The five major classes or isotypes of antibodies are IgA, IgD, IgE, IgG, and IgM, which are characterized by the presence of ?, ?, ?, ?, and ? heavy chains, respectively. Several of the major antibody classes are divided into subclasses such as lgG1 (?1 heavy chain), lgG2 (?2 heavy chain), lgG3 (?3 heavy chain), lgG4 (?4 heavy chain), lgA1 (?1 heavy chain), or lgA2 (?2 heavy chain).
[0190] The term antigen-binding fragment as used herein refers to an antibody fragment including, for example, a diabody, a Fab, a Fab, a F(ab)2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv)2, a bispecific dsFv (dsFv-dsFv), a disulfide stabilized diabody (ds diabody), a single-chain Fv (scFv), an scFv dimer (bivalent diabody), a multispecific antibody formed from a portion of an antibody comprising one or more CDRs, a camelid single domain antibody, a nanobody, a domain antibody, a bivalent domain antibody, or any other antibody fragment that binds to an antigen but does not comprise a complete antibody structure. An antigen-binding fragment is capable of binding to the same antigen to which the parent antibody or a parent antibody fragment (e.g., a parent scFv) binds. In some embodiments, an antigen-binding fragment may comprise one or more CDRs from a particular human antibody grafted to a framework region from one or more different human antibodies.
[0191] Fv is the minimum antibody fragment, which contains a complete antigen-recognition and-binding site. This fragment consists of a dimer of one heavy- and one light-chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (3 loops each from the heavy and light chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although often at a lower affinity than the entire binding site.
[0192] Single-chain Fv, also abbreviated as sFv or scFv, are antibody fragments that comprise the V.sub.H and V.sub.L antibody domains connected into a single polypeptide chain. In some embodiments, the scFv polypeptide further comprises a polypeptide linker between the V.sub.H and V.sub.L domains which enables the scFv to form the desired structure for antigen binding. For a review of scFv, see Pluckthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994).
[0193] As used herein, the term CDR or complementarity determining region is intended to mean the non-contiguous antigen combining sites found within the variable region of both heavy and light chain polypeptides. These particular regions have been described by Kabat et al., J. Biol. Chem. 252:6609-6616 (1977); Kabat et al., U.S. Dept. of Health and Human Services, Sequences of proteins of immunological interest (1991); Chothia et al., J. Mol. Biol. 196:901-917 (1987); Al-Lazikani B. et al., J. Mol. Biol., 273:927-948 (1997); MacCallum et al., J. Mol. Biol. 262:732-745 (1996); Abhinandan and Martin, Mol. Immunol., 45:3832-3839 (2008); Lefranc M. P. et al., Dev. Comp. Immunol., 27:55-77 (2003); and Honegger and Pluckthun, J. Mol. Biol., 309:657-670 (2001), where the definitions include overlapping or subsets of amino acid residues when compared against each other. Nevertheless, application of either definition to refer to a CDR of an antibody or grafted antibodies or variants thereof is intended to be within the scope of the term as defined and used herein. The amino acid residues which encompass the CDRs as defined by each of the above-cited references are set forth below in Table 1 as a comparison. CDR prediction algorithms and interfaces are known in the art, including, for example, Abhinandan and Martin, Mol. Immunol., 45:3832-3839 (2008); Ehrenmann F. et al., Nucleic Acids Res., 38: D301-D307 (2010); and Adolf-Bryfogle J. et al., Nucleic Acids Res., 43: D432-D438 (2015). The contents of the references cited in this paragraph are incorporated herein by reference in their entireties for use in the present application and for possible inclusion in one or more claims herein. In some embodiments, the CDR sequences provided herein are based on IMGT definition. For example, the CDR sequences may be determined by the VBASE2 tool (http://www.vbase2.org/vbase2.php, see also Retter I, Althaus H H, M?nch R, M?ller W: VBASE2, an integrative V gene database. Nucleic Acids Res. 2005 Jan. 1; 33 (Database issue): D671-4, which is incorporated herein by reference in its entirety).
TABLE-US-00001 TABLE 1 CDR DEFINITIONS Kabat.sup.1 Chothia.sup.2 MacCallum.sup.3 IMGT.sup.4 AHo.sup.5 VH CDR1 31-35 26-32 30-35 27-38 25-40 VH CDR2 50-65 53-55 47-58 56-65 58-77 VH CDR3 95-102 96-101 93-101 105-117 109-137 VL CDR1 24-34 26-32 30-36 27-38 25-40 VL CDR2 50-56 50-52 46-55 56-65 58-77 VL CDR3 89-97 91-96 89-96 105-117 109-137 .sup.1Residue numbering follows the nomenclature of Kabat et al., supra .sup.2Residue numbering follows the nomenclature of Chothia et al., supra .sup.3Residue numbering follows the nomenclature of MacCallum et al., supra .sup.4Residue numbering follows the nomenclature of Lefranc et al., supra .sup.5Residue numbering follows the nomenclature of Honegger and Pl?ckthun, supra
[0194] The expression variable-domain residue-numbering as in Kabat or amino-acid-position numbering as in Kabat, and variations thereof, refers to the numbering system used for heavy-chain variable domains or light-chain variable domains of the compilation of antibodies in Kabat et al., supra. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or hypervariable region (HVR) of the variable domain. For example, a heavy-chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g. residues 82a, 82b, and 82c, etc. according to Kabat) after heavy-chain FR residue 82. The Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a standard Kabat numbered sequence.
[0195] Unless indicated otherwise herein, the numbering of the residues in an immunoglobulin heavy chain is that of the EU index as in Kabat et al., supra. The EU index as in Kabat refers to the residue numbering of the human IgG1 EU antibody.
[0196] Framework or FR residues are those variable-domain residues other than the CDR residues as herein defined.
[0197] Humanized forms of non-human (e.g., rodent) antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region (HVR) of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or non-human primate having the desired antibody specificity, affinity, and capability. In some instances, framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, humanized antibodies can comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. For further details, See Jones et al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol. 2:593-596 (1992).
[0198] A human antibody is an antibody that possesses an amino-acid sequence corresponding to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues. Human antibodies can be produced using various techniques known in the art, including phage-display libraries. Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991). Also available for the preparation of human monoclonal antibodies are methods described in Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boerner et al., J. Immunol., 147 (1): 86-95 (1991). See also van Dijk and van de Winkel, Curr. Opin. Pharmacol., 5:368-74 (2001). Human antibodies can be prepared by administering the antigen to a transgenic animal that has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled, e.g., immunized xenomice (see, e.g., U.S. Pat. Nos. 6,075,181 and 6,150,584 regarding XENOMOUSE? technology). See also, for example, Li et al., Proc. Natl. Acad. Sci. USA, 103:3557-3562 (2006) regarding human antibodies generated via a human B-cell hybridoma technology.
[0199] Percent (%) amino acid sequence identity or homology with respect to the polypeptide and antibody sequences identified herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the polypeptide being compared, after aligning the sequences considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, Megalign (DNASTAR), or MUSCLE software.
[0200] Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared. For purposes herein, however, % amino acid sequence identity values are generated using the sequence comparison computer program MUSCLE (Edgar, R. C., Nucleic Acids Research 32 (5): 1792-1797, 2004; Edgar, R. C., BMC Bioinformatics 5 (1): 113, 2004).
[0201] Homologous refers to the sequence similarity or sequence identity between two polypeptides or between two nucleic acid molecules. When a position in both of the two compared sequences is occupied by the same base or amino acid monomer subunit, e.g., if a position in each of two protein molecules is occupied by lysine, or if a position in each of two DNA molecules is occupied by adenine, then the molecules are homologous at that position. The percent of homology between two sequences is a function of the number of matching or homologous positions shared by the two sequences divided by the number of positions compared times 100. For example, if 6 of 10 of the positions in two sequences are matched or homologous then the two sequences are 60% homologous. By way of example, the protein sequences SGTSTD and TGTSDA share 50% homology. Generally, a comparison is made when two sequences are aligned to give maximum homology.
[0202] The term constant domain refers to the portion of an immunoglobulin molecule having a more conserved amino acid sequence relative to the other portion of the immunoglobulin, the variable domain, which contains the antigen-binding site. The constant domain contains the C.sub.H1, C.sub.H2 and C.sub.H3 domains (collectively, C.sub.H) of the heavy chain and the CHL (or C.sub.L) domain of the light chain.
[0203] The light chains of antibodies (immunoglobulins) from any mammalian species can be assigned to one of two clearly distinct types, called kappa (?) and lambda (?), based on the amino acid sequences of their constant domains.
[0204] The CH1 domain (also referred to as C1 of H1 domain) usually extends from about amino acid 118 to about amino acid 215 (EU numbering system).
[0205] Hinge region is generally defined as a region in IgG corresponding to Glu216 to Pro230 of human IgG1 (Burton, Molec. Immunol. 22:161-206 (1985)). Hinge regions of other IgG isotypes may be aligned with the IgG1 sequence by placing the first and last cysteine residues forming inter-heavy chain SS bonds in the same positions.
[0206] The CH2 domain of a human IgG Fc region (also referred to as C2 domain) usually extends from about amino acid 231 to about amino acid 340. The CH2 domain is unique in that it is not closely paired with another domain. Rather, two N-linked branched carbohydrate chains are interposed between the two CH2 domains of an intact native IgG molecule. It has been speculated that the carbohydrate may provide a substitute for the domain-domain pairing and help stabilize the CH2 domain. Burton, Molec Immunol. 22:161-206 (1985).
[0207] The CH3 domain (also referred to as C2 domain) comprises the stretch of residues C-terminal to a CH2 domain in an Fc region (i.e. from about amino acid residue 341 to the C-terminal end of an antibody sequence, typically at amino acid residue 446 or 447 of an IgG).
[0208] The term Fc region or fragment crystallizable region herein is used to define a C-terminal region of an immunoglobulin heavy chain, including native-sequence Fc regions and variant Fc regions. Although the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy-chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof. The C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody. Accordingly, a composition of intact antibodies may comprise antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations having a mixture of antibodies with and without the K447 residue. Suitable native-sequence Fc regions for use in the antibodies described herein include human IgG1, IgG2 (IgG2A, IgG2B), IgG3 and IgG4.
[0209] Fc receptor or FcR describes a receptor that binds the Fc region of an antibody. The preferred FcR is a native sequence human FcR. Moreover, a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the Fc?RI, Fc?RII, FcRN, and Fc?RIII subclasses, including allelic variants and alternatively spliced forms of these receptors, Fc?RII receptors include Fc?RIIA (an activating receptor) and Fc?RIIB (an inhibiting receptor), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof. Activating receptor Fc?RIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. Inhibiting receptor Fc?RIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain. (See M. Da?ron, Annu. Rev. Immunol. 15:203-234 (1997). FcRN is critical to the recycling of an antibody to the blood allowing for increased serum half-life of the antibodies. FcRs are reviewed in Ravetch and Kinet, Annu. Rev. Immunol. 9:457-92 (1991); Capel et al., Immunomethods 4:25-34 (1994); and de Haas et al., J. Lab. Clin. Med. 126:330-41 (1995). Other FcRs, including those to be identified in the future, are encompassed by the term FcR herein.
[0210] The term epitope as used herein refers to the specific group of atoms or amino acids on an antigen to which an antibody or antibody moiety binds. Two antibodies or antibody moieties may bind the same epitope within an antigen if they exhibit competitive binding for the antigen.
[0211] As used herein, a first antibody or fragment thereof competes for binding to a target antigen with a second antibody or fragment thereof when the first antibody or fragment thereof inhibits the target antigen binding of the second antibody of fragment thereof by at least about 50% (such as at least about any one of 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%) in the presence of an equimolar concentration of the first antibody or fragment thereof, or vice versa. A high throughput process for binning antibodies based upon their cross-competition is described in PCT Publication No. WO 03/48731.
[0212] As used herein, the terms specifically binds, specifically recognizing, and is specific for refer to measurable and reproducible interactions, such as binding between a target and an antibody or antibody moiety, which is determinative of the presence of the target in the presence of a heterogeneous population of molecules, including biological molecules. For example, an antibody or antibody moiety that specifically recognizes a target (which can be an epitope) is an antibody or antibody moiety that binds this target with greater affinity, avidity, more readily, and/or with greater duration than its bindings to other targets. In some embodiments, the extent of binding of an antibody to an unrelated target is less than about 10% of the binding of the antibody to the target as measured, e.g., by a radioimmunoassay (RIA). In some embodiments, an antibody that specifically binds a target has a dissociation constant (K.sub.D) of ?10.sup.?5 M, ?10.sup.?6 M, ?10.sup.?7 M, ?10.sup.?8 M, ?10.sup.?9 M, ?10.sup.?10 M, ?10.sup.?11 M, or ?10.sup.?12 M. In some embodiments, an antibody specifically binds an epitope on a protein that is conserved among the protein from different species. In some embodiments, specific binding can include, but does not require exclusive binding. Binding specificity of the antibody or antigen-binding domain can be determined experimentally by methods known in the art. Such methods comprise, but are not limited to Western blots, ELISA-, BLI, RIA-, ECL-, IRMA-, EIA-, BIACORE?-tests and peptide scans.
[0213] An isolated or purified antibody (or construct) is one that has been identified, separated and/or recovered from a component of its production environment (e.g., natural or recombinant). Preferably, the isolated polypeptide is free of association with all other components from its production environment.
[0214] An isolated nucleic acid molecule encoding a construct, antibody, or antigen-binding fragment thereof described herein is a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is ordinarily associated in the environment in which it was produced. Preferably, the isolated nucleic acid is free of association with all components associated with the production environment. The isolated nucleic acid molecules encoding the polypeptides and antibodies described herein is in a form other than in the form or setting in which it is found in nature. Isolated nucleic acid molecules therefore are distinguished from nucleic acid encoding the polypeptides and antibodies described herein existing naturally in cells. An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
[0215] The term control sequences refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism. The control sequences that are suitable for prokaryotes, for example, include a promoter, optionally an operator sequence, and a ribosome binding site. Eukaryotic cells are known to utilize promoters, polyadenylation signals, and enhancers.
[0216] Nucleic acid is operably linked when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation. Generally, operably linked means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading frame. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
[0217] The term vector, as used herein, refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked. The term includes the vector as a self-replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced. Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as expression vectors.
[0218] The term transfected or transformed or transduced as used herein refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell. A transfected or transformed or transduced cell is one which has been transfected, transformed or transduced with exogenous nucleic acid. The cell includes the primary subject cell and its progeny.
[0219] The terms host cell, host cell line, and host cell culture are used interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells. Host cells include transformants and transformed cells, which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, and may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
[0220] The term immunoconjugate includes reference to a covalent linkage of a therapeutic agent or a detectable label to an antibody such as an antibody moiety described herein. The linkage can be direct or indirect through a linker (such as a peptide linker).
[0221] As used herein, treatment or treating is an approach for obtaining beneficial or desired results, including clinical results. For purposes of this application, beneficial or desired clinical results include, but are not limited to, one or more of the following: alleviating one or more symptoms resulting from the disease, diminishing the extent of the disease, stabilizing the disease (e.g., preventing or delaying the worsening of the disease), preventing or delaying the spread (e.g., metastasis) of the disease, preventing or delaying the recurrence of the disease, delaying or slowing the progression of the disease, ameliorating the disease state, providing a remission (partial or total) of the disease, decreasing the dose of one or more other medications required to treat the disease, delaying the progression of the disease, increasing or improving the quality of life, increasing weight gain, and/or prolonging survival. Also encompassed by treatment is a reduction of pathological consequence of cancer (such as, for example, tumor volume). The methods of the application contemplate any one or more of these aspects of treatment.
[0222] In the context of cancer, the term treating includes any or all of: inhibiting growth of cancer cells, inhibiting replication of cancer cells, lessening of overall tumor burden and ameliorating one or more symptoms associated with the disease.
[0223] The terms inhibition or inhibit refer to a decrease or cessation of any phenotypic characteristic or to the decrease or cessation in the incidence, degree, or likelihood of that characteristic. To reduce or inhibit is to decrease, reduce or arrest an activity, function, and/or amount as compared to that of a reference. In certain embodiments, by reduce or inhibit is meant the ability to cause an overall decrease of 20% or greater. In another embodiment, by reduce or inhibit is meant the ability to cause an overall decrease of 50% or greater. In yet another embodiment, by reduce or inhibit is meant the ability to cause an overall decrease of 75%, 85%, 90%, 95%, or greater.
[0224] A reference as used herein, refers to any sample, standard, or level that is used for comparison purposes. A reference may be obtained from a healthy and/or non-diseased sample. In some examples, a reference may be obtained from an untreated sample. In some examples, a reference is obtained from a non-diseased or non-treated sample of an individual. In some examples, a reference is obtained from one or more healthy individuals who are not the individual or patient.
[0225] As used herein, delaying development of a disease means to defer, hinder, slow, retard, stabilize, suppress and/or postpone development of the disease (such as cancer). This delay can be of varying lengths of time, depending on the history of the disease and/or individual being treated. As is evident to one skilled in the art, a sufficient or significant delay can, in effect, encompass prevention, in that the individual does not develop the disease. For example, a late stage cancer, such as development of metastasis, may be delayed.
[0226] Preventing as used herein, includes providing prophylaxis with respect to the occurrence or recurrence of a disease in an individual that may be predisposed to the disease but has not yet been diagnosed with the disease.
[0227] As used herein, to suppress a function or activity is to reduce the function or activity when compared to otherwise same conditions except for a condition or parameter of interest, or alternatively, as compared to another condition. For example, an antibody which suppresses tumor growth reduces the rate of growth of the tumor compared to the rate of growth of the tumor in the absence of the antibody.
[0228] The terms subject, individual, and patient are used interchangeably herein to refer to a mammal, including, but not limited to, human, bovine, horse, feline, canine, rodent, or primate. In some embodiments, the individual is a human.
[0229] An effective amount of an agent refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result. The specific dose may vary depending on one or more of: the particular agent chosen, the dosing regimen to be followed, whether it is administered in combination with other compounds, timing of administration, the tissue to be imaged, and the physical delivery system in which it is carried.
[0230] A therapeutically effective amount of a substance/molecule of the application, agonist or antagonist may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the substance/molecule, agonist or antagonist to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the substance/molecule, agonist or antagonist are outweighed by the therapeutically beneficial effects. A therapeutically effective amount may be delivered in one or more administrations.
[0231] A prophylactically effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically, but not necessarily, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
[0232] The terms pharmaceutical formulation and pharmaceutical composition refer to a preparation which is in such form as to permit the biological activity of the active ingredient(s) to be effective, and which contains no additional components which are unacceptably toxic to an individual to which the formulation would be administered. Such formulations may be sterile.
[0233] A pharmaceutically acceptable carrier refers to a non-toxic solid, semisolid, or liquid filler, diluent, encapsulating material, formulation auxiliary, or carrier conventional in the art for use with a therapeutic agent that together comprise a pharmaceutical composition for administration to an individual. A pharmaceutically acceptable carrier is non-toxic to recipients at the dosages and concentrations employed and is compatible with other ingredients of the formulation. The pharmaceutically acceptable carrier is appropriate for the formulation employed.
[0234] A sterile formulation is aseptic or essentially free from living microorganisms and their spores.
[0235] Administration in combination with one or more further therapeutic agents includes simultaneous (concurrent) and consecutive or sequential administration in any order.
[0236] The term concurrently is used herein to refer to administration of two or more therapeutic agents, where at least part of the administration overlaps in time or where the administration of one therapeutic agent falls within a short period of time relative to administration of the other therapeutic agent. For example, the two or more therapeutic agents are administered with a time separation of no more than about 60 minutes, such as no more than about any of 30, 15, 10, 5, or 1 minutes.
[0237] The term sequentially is used herein to refer to administration of two or more therapeutic agents where the administration of one or more agent(s) continues after discontinuing the administration of one or more other agent(s). For example, administration of the two or more therapeutic agents are administered with a time separation of more than about 15 minutes, such as about any of 20, 30, 40, 50, or 60 minutes, 1 day, 2 days, 3 days, 1 week, 2 weeks, or 1 month, or longer.
[0238] As used herein, in conjunction with refers to administration of one treatment modality in addition to another treatment modality. As such, in conjunction with refers to administration of one treatment modality before, during or after administration of the other treatment modality to the individual.
[0239] The term package insert is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic products.
[0240] An article of manufacture is any manufacture (e.g., a package or container) or kit comprising at least one reagent, e.g., a medicament for treatment of a disease or disorder (e.g., cancer), or a probe for specifically detecting a biomarker described herein. In certain embodiments, the manufacture or kit is promoted, distributed, or sold as a unit for performing the methods described herein.
[0241] Reference to about a value or parameter herein includes (and describes) variations that are directed to that value or parameter per se. For example, description referring to about X includes description of X.
[0242] As used herein, reference to not a value or parameter generally means and describes other than a value or parameter. For example, the method is not used to treat cancer of type X means the method is used to treat cancer of types other than X.
[0243] The term about X-Y used herein has the same meaning as about X to about Y.
[0244] As used herein and in the appended claims, the singular forms a, or, and the include plural referents unless the context clearly dictates otherwise.
II. Anti-PLA2G2D Constructs
[0245] The present application in one aspect provides anti-PLA2G2D constructs comprising an anti-PLA2G2D antibody moiety that specifically binds to PLA2G2D as described herein.
[0246] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 131, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 133, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 134, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0247] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 131, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 133; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 134, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136.
[0248] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 137; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 138.
[0249] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 137, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 138, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0250] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 139, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 140, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 141, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 142, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0251] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 139, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 140; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 141, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 142.
[0252] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 143; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 144.
[0253] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 143, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 144, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0254] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 150, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 151, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0255] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 150, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 151; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136.
[0256] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 153; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 154.
[0257] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 153, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 154, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0258] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 139, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 145, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 146, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0259] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 139, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 145; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 146, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147.
[0260] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 148; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 149.
[0261] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 148, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 149, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0262] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprise the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 157, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 145, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0263] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 157, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 145; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147.
[0264] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 158; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 159.
[0265] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 158, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 159, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0266] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 160, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 145, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0267] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 160, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 145; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147.
[0268] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 155; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 156.
[0269] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 155, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 156, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0270] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 162, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0271] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 162; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147.
[0272] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 163; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 164.
[0273] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 163, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 164, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0274] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 165, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0275] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 165; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136.
[0276] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 168; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 169.
[0277] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 168, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 169, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0278] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 17, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 278, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 19, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 20, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 22, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0279] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 17, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 278, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 19; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 20, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 22.
[0280] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO:166; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 167.
[0281] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 166, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 167, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0282] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 170, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 171, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0283] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 170; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 171, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136.
[0284] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 172; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 173.
[0285] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 172, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 173, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0286] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 174, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 175, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0287] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 174; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 175.
[0288] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 176; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 177.
[0289] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 176, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 177, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0290] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 188, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 189, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0291] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 188; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 189.
[0292] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 190; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 191.
[0293] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 190, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 191, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0294] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 178, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 181, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0295] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 178; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 181, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182.
[0296] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 183; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 184.
[0297] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 183, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 184, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0298] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 178, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0299] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 178; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147.
[0300] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 179; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 180.
[0301] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 179, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 180, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0302] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 192, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0303] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 192; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136.
[0304] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 193; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 194.
[0305] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 193, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 194, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0306] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 192, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 200, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0307] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 192; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 200, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136.
[0308] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 201; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 202.
[0309] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 201, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 202, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0310] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 203, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0311] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 203; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136.
[0312] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 204; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 205.
[0313] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 204, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 205, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0314] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 185, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0315] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 185; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136.
[0316] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 186; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 187.
[0317] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 186, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 187, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0318] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 206, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 207, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 208, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0319] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 206; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 207, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 208.
[0320] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 209; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 210.
[0321] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 209, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 210, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0322] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 195, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 196, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 197, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0323] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 195, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 196; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 197, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136.
[0324] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 198; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 199.
[0325] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 198, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 199, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0326] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 211, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0327] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 211; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 147.
[0328] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 212; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 213.
[0329] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 212, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 213, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0330] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 214, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 215, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 216, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 217, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 218, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 219, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0331] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 214, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 215, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 216; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 217, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 218, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 219.
[0332] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 220; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 221.
[0333] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 220, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 221, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0334] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 222, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 223, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 224, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0335] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 222, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 223; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 224.
[0336] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 225; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 226.
[0337] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 225, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 226, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0338] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 227, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 228, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0339] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 227, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 228; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182.
[0340] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 229; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 230.
[0341] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 229, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 230, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0342] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 227, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 231, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 232, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 233, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 234, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0343] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 227, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 231, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 232; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 233, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 234, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182.
[0344] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 235; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 236.
[0345] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 235, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 236, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0346] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 237, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 238, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 189, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0347] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 237, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 238; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 189.
[0348] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 239; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 240.
[0349] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 239, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 240, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0350] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 241, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 242, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0351] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 241, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 132, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 242; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 152, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 136.
[0352] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 243; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 244.
[0353] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 243, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 244, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0354] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 261, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 262, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 263, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 264, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0355] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 261, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 262; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 263, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 135, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 264.
[0356] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 265; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 266.
[0357] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 265, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 266, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0358] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 267, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 268, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 269, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 270, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0359] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 161, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 267, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 268; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 269, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 270, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 182.
[0360] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 271; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 272.
[0361] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 271, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 272, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0362] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 45, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 46, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 47, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 48, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 22, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0363] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 45, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 46, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 47; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 48, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 22.
[0364] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 49; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 50.
[0365] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 49, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 50, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0366] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 17, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 18, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 19, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 20, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 22, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0367] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 17, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 18, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 19; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 20, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 22.
[0368] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 23; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 24.
[0369] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 23, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 24, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0370] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 25, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 26, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 27, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 28, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 29, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0371] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 25, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 26, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 27; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 28, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 29.
[0372] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 30; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 31.
[0373] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 30, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 31, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0374] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 77, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 78, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 27, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 28, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 79, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0375] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 77, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 78, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 27; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 28, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 79.
[0376] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 80; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 81.
[0377] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 80, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 81, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0378] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 82, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 83, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 84, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 85, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 86, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0379] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 82, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 83, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 84; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 85, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 86.
[0380] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 87; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 88.
[0381] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 87, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 88, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0382] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 124, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 125, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 126, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 127, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 128, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0383] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 124, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 125, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 126; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 127, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 128.
[0384] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 129; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 130.
[0385] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 129, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 130, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0386] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 89, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 90, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 91, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 92, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 93, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 94, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0387] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 89, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 90, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 91; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 92, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 93, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 94.
[0388] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 95; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 96.
[0389] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 95, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 96, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0390] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 97, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 99, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 105, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 93, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 106, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0391] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 97, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 99; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 105, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 93, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 106.
[0392] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 103; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 107.
[0393] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 103, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 107, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0394] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 245, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 246, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 247, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 248, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 249, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 250, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0395] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 245, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 246, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 247; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 248, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 249, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 250.
[0396] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 251; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 252.
[0397] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 251, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 252, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0398] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 253, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 254, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 255, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 256, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 257, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 258, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0399] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 253, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 254, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 255; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 256, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 257, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 258.
[0400] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 259; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 260.
[0401] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 259, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 260, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0402] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 9, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 10, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 11, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 13, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 14, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0403] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 9, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 10, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 11; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 13, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 14.
[0404] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 15; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 16.
[0405] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 15, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 16, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0406] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 67, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 68, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 69, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 13, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 273, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0407] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 67, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 68, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 69; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 13, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 273.
[0408] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 75; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 76.
[0409] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 75, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 76, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0410] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 1, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 2, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 3, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 4, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 6, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0411] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 1, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 2, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 3; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 4, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 6.
[0412] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 7; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 8.
[0413] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 7, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 8, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0414] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 51, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 52, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 53, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 54, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 55, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 56, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0415] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 51, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 52, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 53; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 54, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 55, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 56.
[0416] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 57; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 58.
[0417] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 57, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 58, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0418] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 116, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 117, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 118, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 119, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 120, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 121, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0419] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 116, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 117, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 118; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 119, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 120, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 121.
[0420] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 122; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 123.
[0421] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 122, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 123, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0422] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 59, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 60, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 61, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 62, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 63, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 64, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0423] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 59, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 60, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 61; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 62, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 63, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 64.
[0424] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 65; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 66.
[0425] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 65, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 66, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0426] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 108, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 109, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 110, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 111, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 112, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 113, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0427] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 108, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 109, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 110; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 111, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 112, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 113.
[0428] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 114; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 115.
[0429] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 114, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 115, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0430] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 37, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 38, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 39, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 40, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 41, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 42, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0431] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 37, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 38, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 39; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 40, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 41, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 42.
[0432] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 43; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 44.
[0433] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 43, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 44, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0434] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 67, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 274, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 69, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 275, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 273, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0435] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 67, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 274, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 69; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 275, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 273.
[0436] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 276; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 277.
[0437] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 276, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 277, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0438] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 97, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 99, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the HC-CDRs; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 100, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 101, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 102, or a variant thereof comprising up to 5, 4, 3, 2, or 1 amino acid substitutions in the LC-CDRs. In some embodiments, the amino acid substitutions described above are limited to exemplary substitutions shown in Table 2 of this application. In some embodiments, the amino acid substitutions are limited to preferred substitutions shown in Table 2 of this application.
[0439] In some embodiments, the anti-PLA2G2D antibody moiety is a humanized antibody derived from an anti-PLA2G2D antibody comprising comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 97, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 98, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 99; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 100, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 101, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 102.
[0440] In some embodiments, the antibody moiety comprises a HC-CDR1, a HC-CDR2, and a HC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.H chain region having the sequence set forth in SEQ ID NO: 103; and a LC-CDR1, a LC-CDR2, and a LC-CDR3, respectively comprising the amino acid sequences of a CDR1, a CDR2, and a CDR3 within a V.sub.L chain region having the sequence set forth in SEQ ID NO: 104.
[0441] In some embodiments, the V.sub.H comprises an amino acid sequence of SEQ ID NO: 103, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity; and the V.sub.L comprises an amino acid sequence of SEQ ID NO: 104, or a variant comprising an amino acid sequence having at least about 80% (such as at least about any one of 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity.
[0442] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 279, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 280, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 133, 140, 145, 151, 162, 165, 170, 174, 178, 185, 188, 192, 196, 203, 206, 216, 223, 228, 232, 238, 242, 262, or 268; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 281, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 282, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 283.
[0443] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 284 or 285, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 286 or 287, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 288, 47, or 19; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 289, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 21, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 290.
[0444] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 291, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 292, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 293; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 295, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 295, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 250, 258, 94, or 106.
[0445] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 294, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 246 or 254, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 247 or 255; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 295, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 295, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 250, 258, 94, or 106.
[0446] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 9, 32, or 67, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 10, 33, 68, or 274, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 11, 34, or 69; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 297, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 298.
[0447] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 1, 51, or 116, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 2, 52, 117, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 3, 53, or 118; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 299, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 300, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 6, 56, or 121.
[0448] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 59 or 108, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 60 or 109, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 61 or 110; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 301, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 302, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 303.
[0449] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 67, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 68, 274, or 304, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 69; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 12, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 305, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 273.
[0450] In some embodiments, the anti-PLA2G2D construct comprises a heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), wherein the V.sub.H comprises the HC-CDR1 comprising the amino acid sequence of SEQ ID NO: 306 or 97, the HC-CDR2 comprising the amino acid sequence of SEQ ID NO: 307 or 98, and the HC-CDR3 comprising the amino acid sequence of SEQ ID NO: 39, 99, or 53; and the V.sub.L comprises the LC-CDR1 comprising the amino acid sequence of SEQ ID NO: 308 or 54, the LC-CDR2 comprising the amino acid sequence of SEQ ID NO: 41, 101, or 55, and the LC-CDR3 comprising the amino acid sequence of SEQ ID NO: 309 or 102.
[0451] In some embodiments, the V.sub.H and/or the V.sub.L further comprises a signaling peptide. In some embodiments, the signaling peptide is fused to the N-terminus of the V.sub.H and/or the V.sub.L. In some embodiments, the signaling peptide has an amino acid sequence set forth in any of the SEQ ID Nos: 310-340.
[0452] In some embodiments, the construct comprises or is an antibody or antigen-binding fragment thereof selected from the group consisting of a full-length antibody, a bispecific antibody, a single-chain Fv (scFv) fragment, a Fab fragment, a Fab fragment, a F (ab) 2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv).sub.2, a V.sub.HH, a Fv-Fc fusion, a scFv-Fc fusion, a scFv-Fv fusion, a diabody, a tribody, and a tetrabody.
[0453] In some embodiments, the anti-PLA2G2D antibody moiety is a full-length antibody. In some embodiments, the anti-PLA2G2D antibody moiety is a scFv.
[0454] In some embodiments, the anti-PLA2G2D antibody moiety described above comprises an Fc fragment of an immunoglobulin selected from the group consisting of IgG, IgA, IgD, IgE, IgM, and combinations and hybrids thereof. In some embodiments, the anti-PLA2G2D antibody moiety or the full-length antibody described above comprises an Fc fragment of an immunoglobulin selected from the group consisting of IgG1, IgG2, IgG3, IgG4, and combinations and hybrids thereof. In some embodiments, the Fc fragment has a reduced effector function as compared to the corresponding wildtype Fc fragment. In some embodiments, the Fc fragment has an enhanced effector function as compared to the corresponding wildtype Fc fragment. In some embodiments the Fc fragment has been altered for increased serum half-life compared to the corresponding wildtype Fc fragment. In some embodiments the Fc fragment has been altered for decreased serum half life compared to the corresponding wildtype Fc fragment.
[0455] In some embodiments, the antibody moiety comprises a humanized antibody of any of the antibody moiety described herein.
[0456] In some embodiments, the anti-PLA2G2D construct comprises or is an anti-PLA2G2D fusion protein.
[0457] In some embodiments, the anti-PLA2G2D construct comprises or is a multispecific anti-PLA2G2D construct (such as a bispecific antibody).
[0458] In some embodiments, the anti-PLA2G2D construct comprises or is an anti-PLA2G2D immunoconjugate.
[0459] In some embodiments, the PLA2G2D is a human PLA2G2D.
PLA2G2D
[0460] PLA2G2D (phospholipase A2 group IID, sPLA2-IID) is a secreted member of the phospholipase A2 family. Phospholipase A2 family members hydrolyze the sn-2 fatty acid ester bond of glycerophospholipids to produce lysophospholipids and free fatty acid. To date, 10 sPLA2isoforms (IB, IIA, IIC, IID, IIE, IIF, III, V, X, and XII) have been identified in mammals. These isoforms, except for group III isoforms, have a highly conserved catalytic site, a Ca 2+ binding loop, and a common molecular weight of 14-19 kDa. Of these sPLA2isoforms, sPLA2-IIA, sPLA2-IIC, sPLA2-IID, sPLA2-IIE, sPLA2-IIF, and sPLA 2-V have the same chromosomal locus (1p34-p36), which are often referred to as group II subfamily sPLA2. The biological feature of the group II subfamily sPLA2 is that almost all isoforms, except sPLA 2-IIC (a pseudogene in humans), are associated with inflammatory and immune processes.
[0461] Human PLA2G2D is a basic protein (pI?8.7) with 14 cysteines at exactly conserved positions. Likely because of its cationic nature, PLA2G2D binds to heparin in vitro or heparin sulfate on the cell surface when overexpressed in cultured cells.
[0462] In some embodiments, the PLA2G2D comprises an amino acid sequence set forth in SEQ ID NO: 349 or 350. In some embodiments, the PLA2G2D comprises an amino acid sequence set forth in SEQ ID NO: 353 or 354.
a) Antibody Affinity
[0463] Binding specificity of the antibody moieties can be determined experimentally by methods known in the art. Such methods comprise, but are not limited to Western blots, ELISA-, RIA-, ECL-, IRMA-, EIA-, BLI, BIACORE?-tests, flow cytometry and peptide scans.
[0464] In some embodiments, the K.sub.D of the binding between the antibody moiety and PLA2G2D is about 10.sup.?7 M to about 10.sup.?12 M, about 10.sup.?7 M to about 10.sup.?8 M, about 10.sup.?8 M to about 10.sup.?9 M, about 10.sup.?9 M to about 10.sup.?10 M, about 10.sup.?10 M to about 10.sup.?11 M, about 10.sup.?11 M to about 10.sup.?12 M, about 10.sup.?7 M to about 10.sup.?12 M, about 10.sup.?8 M to about 10.sup.?12 M, about 10.sup.?9 M to about 10.sup.?12 M, about 10.sup.?10 M to about 10.sup.?12 M, about 10.sup.?7 M to about 10.sup.?11 M, about 10.sup.?8 M to about 10.sup.?11 M, about 10.sup.?9 M to about 10.sup.?11 M, about 10.sup.?7 M to about 10.sup.?10 M, about 10.sup.?8 M to about 10.sup.?10 M, or about 10.sup.?7 M to about 10.sup.?9 M. In some embodiments, the K.sub.D of the binding between the antibody moiety and PLA2G2D is stronger than about any one of 10.sup.?7 M, 10.sup.?8 M, 10.sup.?9 M, 10.sup.?10 M, 10.sup.?11 M, or 10.sup.?12 M. In some embodiments, the PLA2G2D is a human PLA2G2D.
[0465] In some embodiments, the K.sub.on of the binding between the antibody moiety and PLA2G2D is about 10.sup.3 M.sup.?1s.sup.?1 to about 10.sup.8 M.sup.?1s.sup.?1, about 10.sup.3 M.sup.?1s.sup.?1 to about 10.sup.4 M.sup.?1s.sup.?1, about 10.sup.4 M.sup.?1s.sup.?1 to about 10.sup.5 M.sup.?1s.sup.?1, about 10.sup.5 M.sup.?1s.sup.?1 to about 10.sup.6 M.sup.?1s.sup.?1, about 10.sup.6 M.sup.?1s.sup.?1 to about 10.sup.7 M.sup.?1s.sup.?1, or about 10.sup.7 M.sup.?1s.sup.?1 to about 10.sup.8 M.sup.?1s.sup.?1. In some embodiments, the K.sub.on of the binding between the antibody moiety and PLA2G2D is about 10.sup.3 M.sup.?1s.sup.?1 to about 10.sup.5 M.sup.?1s.sup.?1, about 10.sup.4 M.sup.?1s.sup.?1 to about 10.sup.6 M.sup.?1s.sup.?1, about 10.sup.5 M.sup.?1s.sup.?1 to about 10.sup.7 M.sup.?1s.sup.?1, about 10.sup.6 M.sup.?1s.sup.?1 to about 10.sup.8 M.sup.?1s.sup.?1, about 10.sup.4 M.sup.?1s.sup.?1 to about 10.sup.7 M.sup.?1s.sup.?1, or about 10.sup.5 M.sup.?1s.sup.?1 to about 10.sup.8 M.sup.?1s.sup.?1. In some embodiments, the K.sub.on of the binding between the antibody moiety and PLA2G2D is no more than about any one of 10.sup.3 M.sup.?1s.sup.?1, 10+M.sup.?1s.sup.?1, 10.sup.5 M.sup.?1s.sup.?1, 10.sup.6 M.sup.?1s.sup.?1, 10.sup.7 M.sup.?1s.sup.?1 or 10.sup.8 M.sup.?1s.sup.?1. In some embodiments, PLA2G2D is human PLA2G2D.
[0466] In some embodiments, the K.sub.off of the binding between the antibody moiety and PLA2G2D is about 1 s.sup.?1 to about 10.sup.?6 s.sup.?1, about 1 s.sup.?1 to about 10.sup.?2 s.sup.?1, about 10.sup.?2 s.sup.?1 to about 10.sup.?3 s.sup.?1, about 10.sup.?3 s.sup.?1 to about 10.sup.?4 s.sup.?1, about 10.sup.?4 s.sup.?1 to about 10.sup.?5 s.sup.?1, about 10.sup.?5 s.sup.?1 to about 10.sup.?6 s.sup.?1, about 1 s.sup.?1 to about 10.sup.?5 s.sup.?1, about 10.sup.?2 s.sup.?1 to about 10.sup.?6 s.sup.?1, about 10.sup.?3 s.sup.?1 to about 10.sup.?6 s.sup.?1, about 10.sup.?4 s.sup.?1 to about 10.sup.?6 s.sup.?1, about 10.sup.?2 s.sup.?1 to about 10.sup.?5 s.sup.?1, or about 10.sup.?3 s.sup.?1 to about 10.sup.?5 s.sup.?1. In some embodiments, the K.sub.off of the binding between the antibody moiety and PLA2G2D is at least about any one of 1 s.sup.?1, 10.sup.?2 s.sup.?1, 10.sup.?3 s.sup.?1, 10.sup.?4 s.sup.?1, 10.sup.?5 s.sup.?1 or 10.sup.?6 s.sup.?1. In some embodiments, PLA2G2D is human PLA2G2D.
[0467] In some embodiments, the binding affinity of the anti-PLA2G2D antibody moiety or anti-PLA2G2D construct are higher (for example, has a smaller K.sub.D value) than an existing anti-PLA2G2D antibody (e.g., anti-human PLA2G2D antibody).
b) Chimeric or Humanized Antibodies
[0468] In some embodiments, the anti-PLA2G2D antibody moiety is a chimeric antibody. Certain chimeric antibodies are described, e.g., in U.S. Pat. No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984)). In some embodiments, a chimeric antibody comprises a non-human variable region (e.g., a variable region derived from mouse) and a human constant region. In some embodiments, a chimeric antibody is a class switched antibody in which the class or subclass has been changed from that of the parent antibody. Chimeric antibodies include antigen-binding fragments thereof.
[0469] In some embodiments, the anti-PLA2G2D antibody is a humanized antibody. Typically, a non-human antibody is humanized to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody. Generally, a humanized antibody comprises one or more variable domains in which HVRs, e.g., CDRs, (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences. A humanized antibody optionally will also comprise at least a portion of a human constant region. In some embodiments, some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g., the antibody from which the HVR residues are derived), e.g., to restore or improve antibody specificity or affinity.
[0470] Humanized antibodies and methods of making them are reviewed, e.g., in Almagro and Fransson, Front. Biosci. 13:1619-1633 (2008), and are further described, e.g., in Riechmann et al., Nature 332:323-329 (1988); Queen et al., Proc. Nat'l Acad. Sci. USA 86:10029-10033 (1989); U.S. Pat. Nos. 5,821,337, 7,527,791, 6,982,321, and 7,087,409; Kashmiri et al., Methods 36:25-34 (2005) (describing SDR (a-CDR) grafting); Padlan, Mol. Immunol. 28:489-498 (1991) (describing resurfacing); Dall'Acqua et al., Methods 36:43-60 (2005) (describing FR shuffling); and Osbourn et al., Methods 36:61-68 (2005) and Klimka et al., Br. J. Cancer, 83:252-260 (2000) (describing the guided selection approach to FR shuffling).
[0471] Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the best-fit method (see, e.g., Sims et al. J. Immunol. 151:2296 (1993)); Framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions (see, e.g., Carter et al. Proc. Natl. Acad. Sci. USA, 89:4285 (1992); and Presta et al. J. Immunol., 151:2623 (1993)); human mature (somatically mutated) framework regions or human germline framework regions (see, e.g., Almagro and Fransson, Front. Biosci. 13:1619-1633 (2008)); and framework regions derived from screening FR libraries (see, e.g., Baca et al., J. Biol. Chem. 272:10678-10684 (1997) and Rosok et al., J. Biol. Chem. 271:22611-22618 (1996)).
[0472] It is understood that the humanization of mouse derived antibodies is a common and routinely used art. It is therefore understood that a humanized format of any and all of the anti-PLA2G2D antibodies disclosed in Sequence Table can be used in a preclinical or clinical setting. In cases where a humanized format of any of the referenced anti-PLA2G2D antibodies or their antigen-binding regions thereof is used in such a preclinical or clinical setting, the then humanized format is expected to bear the same or similar biological activities and profiles as the original non-humanized format.
c) Human Antibodies
[0473] In some embodiments, the anti-PLA2G2D antibody moiety is a human antibody (known as human domain antibody, or human DAb). Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk and van de Winkel, Curr. Opin. Pharmacol. 5:368-74 (2001), Lonberg, Curr. Opin. Immunol. 20:450-459 (2008), and Chen, Mol. Immunol. 47 (4): 912-21 (2010). Transgenic mice or rats capable of producing fully human single-domain antibodies (or DAb) are known in the art. See, e.g., US20090307787A1, U.S. Pat. No. 8,754,287, US20150289489A1, US20100122358A1, and WO2004049794.
[0474] Human antibodies (e.g., human DAbs) may be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge. Such animals typically contain all or a portion of the human immunoglobulin loci, which replace the endogenous immunoglobulin loci, or which are present extrachromosomally or integrated randomly into the animal's chromosomes. In such transgenic mice, the endogenous immunoglobulin loci have generally been inactivated. For review of methods for obtaining human antibodies from transgenic animals, see Lonberg, Nat. Biotech. 23:1117-1125 (2005). See also, e.g., U.S. Pat. Nos. 6,075,181 and 6,150,584 describing XENOMOUSE? technology; U.S. Pat. No. 5,770,429 describing H
[0475] Human antibodies (e.g., human DAbs) can also be made by hybridoma-based methods. Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described (See, e.g., Kozbor J. Immunol., 133:3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987); and Boerner et al., J. Immunol., 147:86 (1991)). Human antibodies generated via human B-cell hybridoma technology are also described in Li et al., Proc. Natl. Acad. Sci. USA, 103:3557-3562 (2006). Additional methods include those described, for example, in U.S. Pat. No. 7,189,826 (describing production of monoclonal human IgM antibodies from hybridoma cell lines) and Ni, Xiandai Mianyixue, 26 (4): 265-268 (2006) (describing human-human hybridomas). Human hybridoma technology (Trioma technology) is also described in Vollmers and Brandlein, Histology and Histopathology, 20 (3): 927-937 (2005) and Vollmers and Brandlein, Methods and Findings in Experimental and Clinical Pharmacology, 27 (3): 185-91 (2005).
[0476] Human antibodies (e.g., human DAbs) may also be generated by isolating Fv clone variable domain sequences selected from human-derived phage display libraries. Such variable domain sequences may then be combined with a desired human constant domain. Techniques for selecting human antibodies from antibody libraries are described below.
d) Library-Derived Antibodies
[0477] The anti-PLA2G2D antibody moieties described herein may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities. For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178:1-37 (O'Brien et al., ed., Human Press, Totowa, N J, 2001) and further described, e.g., in the McCafferty et al., Nature 348:552-554; Clackson et al., Nature 352:624-628 (1991); Marks et al., J. Mol. Biol. 222:581-597 (1992); Marks and Bradbury, in Methods in Molecular Biology 248:161-175 (Lo, ed., Human Press, Totowa, N J, 2003); Sidhu et al., J. Mol. Biol. 338 (2): 299-310 (2004); Lee et al., J. Mol. Biol. 340 (5): 1073-1093 (2004); Fellouse, Proc. Natl. Acad. Sci. USA 101 (34): 12467-12472 (2004); and Lee et al., J. Immunol. Methods 284 (1-2): 119-132 (2004). Methods for constructing single-domain antibody libraries have been described, for example, See U.S. Pat. No. 7,371,849.
[0478] In certain phage display methods, repertoires of V.sub.H and V.sub.L genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et al., Ann. Rev. Immunol., 12:433-455 (1994). Phage typically displays antibody fragments, either as scFv fragments or as Fab fragments. Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas. Alternatively, the naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self-antigens without any immunization as described by Griffiths et al., EMBO J, 12:725-734 (1993). Finally, naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom and Winter, J. Mol. Biol., 227:381-388 (1992). Patent publications describing human antibody phage libraries include, for example: U.S. Pat. No. 5,750,373, and US Patent Publication Nos. 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126, 2007/0160598, 2007/0237764, 2007/0292936, and 2009/0002360.
[0479] Antibodies or antibody fragments isolated from human antibody libraries are considered human antibodies or human antibody fragments herein.
e) Substitution, Insertion, Deletion and Variants
[0480] In some embodiments, antibody variants having one or more amino acid substitutions are provided. Sites of interest for substitutional mutagenesis include the HVRs (or CDRs) and FRs. Conservative substitutions are shown in Table 2 under the heading of Preferred substitutions. More substantial changes are provided in Table 2 under the heading of exemplary substitutions, and as further described below in reference to amino acid side chain classes. Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.
TABLE-US-00002 TABLE 2 Amino acid substitutions Original Preferred Residue Exemplary Substitutions Substitutions Ala (A) Val; Leu; Ile Val Arg (R) Lys; Gln; Asn Lys Asn (N) Gln; His; Asp, Lys; Arg Gln Asp (D) Glu; Asn Glu Cys (C) Ser; Ala Ser Gln (Q) Asn; Glu Asn Glu (E) Asp; Gln Asp Gly (G) Ala Ala His (H) Asn; Gln; Lys; Arg Arg Ile (I) Leu; Val; Met; Ala; Phe; Norleucine Leu Leu (L) Norleucine; Ile; Val; Met; Ala; Phe Ile Lys (K) Arg; Gln; Asn Arg Met (M) Leu; Phe; Ile Leu Phe (F) Trp; Leu; Val; Ile; Ala; Tyr Tyr Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Val; Ser Ser Trp (W) Tyr; Phe Tyr Tyr (Y) Trp; Phe; Thr; Ser Phe Val (V) Ile; Leu; Met; Phe; Ala; Norleucine Leu
[0481] Amino acids may be grouped according to common side-chain properties: (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile; (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; and (6) aromatic: Trp, Tyr, Phe.
[0482] Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
[0483] One type of substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g., a humanized or human antibody). Generally, the resulting variant(s) selected for further study will have modifications (e.g., improvements) in certain biological properties (e.g., increased affinity, reduced immunogenicity) relative to the parent antibody and/or will have substantially retained certain biological properties of the parent antibody. An exemplary substitutional variant is an affinity matured antibody, which may be conveniently generated, e.g., using phage display-based affinity maturation techniques such as those described herein. Briefly, one or more HVR residues are mutated and the variant antibodies displayed on phage and screened for a particular biological activity (e.g. binding affinity).
[0484] Alterations (e.g., substitutions) may be made in HVRs, e.g., to improve antibody affinity. Such alterations may be made in HVR hotspots, i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g., Chowdhury, Methods Mol. Biol. 207:179-196 (2008)), and/or SDRs (a-CDRs), with the resulting variant V.sub.H or V.sub.L being tested for binding affinity. Affinity maturation by constructing and reselecting from secondary libraries has been described, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178:1-37 (O'Brien et al., ed., Human Press, Totowa, NJ, (2001)). In some embodiments of affinity maturation, diversity is introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis). A secondary library is then created. The library is then screened to identify any antibody variants with the desired affinity or molecular behavior. Another method to introduce diversity involves HVR-directed approaches, in which several HVR residues (e.g., 4-6 residues at a time) are randomized. HVR residues involved in antigen binding may be specifically identified, e.g., using alanine or histidine scanning mutagenesis or modeling. HC-CDR3 and LC-CDR3 in particular are often targeted.
[0485] In some embodiments, substitutions, insertions, or deletions may occur within one or more HVRs so long as such alterations do not substantially reduce the ability of the antibody to bind antigen. For example, conservative alterations (e.g., conservative substitutions as provided herein) that do not substantially reduce binding affinity may be made in HVRs. Such alterations may be outside of HVR hotspots or CDRs.
[0486] A useful method for identification of residues or regions of an antibody that may be targeted for mutagenesis is called alanine scanning mutagenesis as described by Cunningham and Wells (1989) Science, 244:1081-1085. In this method, a residue or group of target residues (e.g., charged residues such as Arg, Asp, His, Lys, and Glu) are identified and replaced by a neutral or negatively charged amino acid (e.g., alanine or polyalanine) to determine whether the interaction of the antibody with antigen is affected. Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions. Alternatively, or additionally, a crystal structure of an antigen-antibody complex to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution. Variants may be screened to determine whether they contain the desired properties for the antibody.
[0487] Amino acid sequence insertions include amino-and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an antibody with an N-terminal methionyl residue. Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme (e.g., for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
f) Glycosylation Variants
[0488] In some embodiments, the anti-PLA2G2D antibody moiety is altered to increase or decrease the extent to which the construct is glycosylated. Addition or deletion of glycosylation sites to an antibody may be conveniently accomplished by altering the amino acid sequence such that one or more glycosylation sites is created or removed.
[0489] Where the antibody moiety comprises an Fc region, the carbohydrate attached thereto may be altered. Native antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 of the C.sub.H2 domain of the Fc region. See, e.g., Wright et al. TIBTECH 15:26-32 (1997). The oligosaccharide may include various carbohydrates, e.g., mannose, N-acetyl glucosamine (GlcNAc), galactose, and sialic acid, as well as a fucose attached to a GlcNAc in the stem of the biantennary oligosaccharide structure. In some embodiments, modifications of the oligosaccharide in the antibody moiety may be made in order to create antibody variants with certain improved properties.
[0490] In some embodiments, the anti-PLA2G2D antibody moiety has a carbohydrate structure that lacks fucose attached (directly or indirectly) to an Fc region. For example, the amount of fucose in such antibody may be from 1% to 80%, from 1% to 65%, from 5% to 65% or from 20% to 40%. The amount of fucose is determined by calculating the average amount of fucose within the sugar chain at Asn297, relative to the sum of all glycostructures attached to Asn 297 (e.g., complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2008/077546, for example. Asn297 refers to the asparagine residue located at about position 297 in the Fc region (EU numbering of Fc region residues); however, Asn297 may also be located about ?3 amino acids upstream or downstream of position 297, i.e., between positions 294 and 300, due to minor sequence variations in antibodies. Such fucosylation variants may have improved ADCC function. See, e.g., US Patent Publication Nos. US 2003/0157108 (Presta, L.); US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd). Examples of publications related to defucosylated or fucose-deficient antibody variants include: US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/0115614; US 2002/0164328; US 2004/0093621; US 2004/0132140; US 2004/0110704; US 2004/0110282; US 2004/0109865; WO 2003/085119; WO 2003/084570; WO 2005/035586; WO 2005/035778; WO2005/053742; WO2002/031140; Okazaki et al. J. Mol. Biol. 336:1239-1249 (2004); Yamane-Ohnuki et al. Biotech. Bioeng. 87:614 (2004). Examples of cell lines capable of producing defucosylated antibodies include Lec13 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); US Patent Application No. US 2003/0157108 A1, Presta, L; and WO 2004/056312 A1, Adams et al., especially at Example 11), and knockout cell lines, such as alpha-1,6-fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g., Yamane-Ohnuki et al. Biotech. Bioeng. 87:614 (2004); Kanda, Y. et al., Biotechnol. Bioeng., 94 (4): 680-688 (2006); and WO2003/085107).
[0491] In some embodiments, the anti-PLA2G2D antibody moiety has bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to the Fc region of the antibody is bisected by GlcNAc. Such antibody variants may have reduced fucosylation and/or improved ADCC function. Examples of such antibody variants are described, e.g., in WO 2003/011878 (Jean-Mairet et al.); U.S. Pat. No. 6,602,684 (Umana et al.); and US 2005/0123546 (Umana et al.). Antibody variants with at least one galactose residue in the oligosaccharide attached to the Fc region are also provided. Such antibody variants may have improved CDC function. Such antibody variants are described, e.g., in WO 1997/30087 (Patel et al.); WO 1998/58964 (Raju, S.); and WO 1999/22764 (Raju, S.).
g) Fc region Variants
[0492] In some embodiments, the anti-PLA2G2D antibody moiety comprises an Fc fragment.
[0493] The term Fc region, Fc domain, Fc fragment or Fc refers to a C-terminal non-antigen binding region of an immunoglobulin heavy chain that contains at least a portion of the constant region. The term includes native Fc regions and variant Fc regions. In some embodiments, a human IgG heavy chain Fc region extends from Cys226 to the carboxyl-terminus of the heavy chain. However, the C-terminal lysine (Lys447) of the Fc region may or may not be present, without affecting the structure or stability of the Fc region. Unless otherwise specified herein, numbering of amino acid residues in the IgG or Fc region is according to the EU numbering system for antibodies, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.
[0494] In some embodiments, the Fc fragment is from an immunoglobulin selected from the group consisting of IgG, IgA, IgD, IgE, IgM, and combinations and hybrids thereof. In some embodiments, the Fc fragment is from an immunoglobulin selected from the group consisting of IgG1, IgG2, IgG3, IgG4, and combinations and hybrids thereof.
[0495] In some embodiments, the Fc fragment has a reduced effector function as compared to corresponding wildtype Fc fragment (such as at least about 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, or 95% reduced effector function as measured by the level of antibody-dependent cellular cytotoxicity (ADCC)).
[0496] In some embodiments, the Fc fragment is an IgG1 Fc fragment. In some embodiments, the IgG1 Fc fragment comprises a L234A mutation and/or a L235A mutation. In some embodiments, the Fc fragment is an IgG2 or IgG4 Fc fragment. In some embodiments, the Fc fragment is an IgG4 Fc fragment comprising a S228P, F234A, and/or a L235A mutation. In some embodiments, the Fc fragment comprises a N297A mutation. In some embodiments, the Fc fragment comprises a N297G mutation.
[0497] In some embodiments, one or more amino acid modifications may be introduced into the Fc region of the antibody moiety, thereby generating an Fc region variant. The Fc region variant may comprise a human Fc region sequence (e.g., a human IgG1, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g. a substitution) at one or more amino acid positions.
[0498] In some embodiments, the Fc fragment possesses some but not all effector functions, which make it a desirable candidate for applications in which the half-life of the antibody moiety in vivo is important yet certain effector functions (such as complement and ADCC) are unnecessary or deleterious. In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities. For example, Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks Fc?R binding (hence likely lacking ADCC activity), but retains FcRn binding ability. The primary cells for mediating ADCC, NK cells, express Fc?RIII only, whereas monocytes express Fc?RI, Fc?RII and Fc?RIII. FcR expression on hematopoietic cells is summarized in Table 2 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol. 9:457-492 (1991). Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest is described in U.S. Pat. No. 5,500,362 (see, e.g. Hellstrom, I. et al. Proc. Nat'l Acad. Sci. USA 83:7059-7063 (1986)) and Hellstrom, I et al., Proc. Nat'l Acad. Sci. USA 82:1499-1502 (1985); U.S. Pat. No. 5,821,337 (See Bruggemann, M. et al., J. Exp. Med. 166:1351-1361 (1987)). Alternatively, non-radioactive assays methods may be employed (see, for example, ACTI? non-radioactive cytotoxicity assay for flow cytometry (CellTechnology, Inc. Mountain View, CA; and CytoTox 96? non-radioactive cytotoxicity assay (Promega, Madison, WI). Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al. Proc. Nat'l Acad. Sci. USA 95:652-656 (1998). C1q binding assays may also be carried out to confirm that the antibody is unable to bind C1q and hence lacks CDC activity. See, e.g., C1q and C3c binding ELISA in WO 2006/029879 and WO 2005/100402. To assess complement activation, a CDC assay may be performed (see, for example, Gazzano-Santoro et al., J. Immunol. Methods 202:163 (1996); Cragg, M. S. et al., Blood 101:1045-1052 (2003); and Cragg, M. S. and M. J. Glennie, Blood 103:2738-2743 (2004)). FcRn binding and in vivo clearance/half-life determinations can also be performed using methods known in the art (see, e.g., Petkova, S. B. et al., Int'l. Immunol. 18 (12): 1759-1769 (2006)).
[0499] Antibodies with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Pat. No. 6,737,056). Such Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called DANA Fc mutant with substitution of residues 265 and 297 to alanine (U.S. Pat. No. 7,332,581). In some embodiments, the Fc fragment comprises a N297A mutation. In some embodiments, the Fc fragment comprises a N297G mutation.
[0500] Certain antibody variants with improved or diminished binding to FcRs are described. (See, e.g., U.S. Pat. No. 6,737,056; WO 2004/056312, and Shields et al., J. Biol. Chem. 9 (2): 6591-6604 (2001).)
[0501] In some embodiments, the Fc fragment is an IgG1 Fc fragment. In some embodiments, the IgG1 Fc fragment comprises a L234A mutation and/or a L235A mutation. In some embodiments, the IgG1 Fc fragment comprises a L235A mutation and/or a G237A mutation. In some embodiments, the Fc fragment is an IgG2 or IgG4 Fc fragment. In some embodiments, the Fc fragment is an IgG4 Fc fragment comprising a S228P, F234A, and/or a L235A mutation.
[0502] In some embodiments, the antibody moiety comprises an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering of residues).
[0503] In some embodiments, alterations are made in the Fc region that result in altered (i.e., either improved or diminished) C1q binding and/or Complement Dependent Cytotoxicity (CDC), e.g., as described in U.S. Pat. No. 6,194,551, WO 99/51642, and Idusogie et al. J. Immunol. 164:4178-4184 (2000).
[0504] In some embodiments, the antibody moiety variant comprising a variant Fc region comprising one or more amino acid substitutions which alters half-life and/or changes binding to the neonatal Fc receptor (FcRn). Antibodies with increased half-lives and improved binding to the neonatal Fc receptor (FcRn), which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al., J. Immunol. 117:587 (1976) and Kim et al., J. Immunol. 24:249 (1994)), are described in US2005/0014934A1 (Hinton et al.). Those antibodies comprise an Fc region with one or more substitutions therein which alters binding of the Fc region to FcRn. Such Fc variants include those with substitutions at one or more of Fc region residues, e.g., substitution of Fc region residue 434 (U.S. Pat. No. 7,371,826).
[0505] See also Duncan & Winter, Nature 322:738-40 (1988); U.S. Pat. Nos. 5,648,260; 5,624,821; and WO 94/29351 concerning other examples of Fc region variants.
h) Cysteine Engineered Antibody Variants
[0506] In some embodiments, it may be desirable to create cysteine engineered antibody moieties, e.g., thioMAbs, in which one or more residues of an antibody are substituted with cysteine residues. In particular embodiments, the substituted residues occur at accessible sites of the antibody. By substituting those residues with cysteine, reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein. In some embodiments, any one or more of the following residues may be substituted with cysteine: A118 (EU numbering) of the heavy chain; and S400 (EU numbering) of the heavy chain Fc region. Cysteine engineered antibody moieties may be generated as described, e.g., in U.S. Pat. No. 7,521,541.
i) Antibody Derivatives
[0507] In some embodiments, the antibody moiety described herein may be further modified to comprise additional nonproteinaceous moieties that are known in the art and readily available. The moieties suitable for derivatization of the antibody include but are not limited to water soluble polymers. Non-limiting examples of water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1, 3-dioxolane, poly-1,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly (n-vinyl pyrrolidone) polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof. Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water. The polymer may be of any molecular weight, and may be branched or unbranched. The number of polymers attached to the antibody may vary, and if more than one polymer are attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in diagnosis under defined conditions, etc.
[0508] In some embodiments, the antibody moiety may be further modified to comprise one or more biologically active protein, polypeptides or fragments thereof. Bioactive or biologically active, as used herein interchangeably, means showing biological activity in the body to carry out a specific function. For example, it may mean the combination with a particular biomolecule such as protein, DNA, etc., and then promotion or inhibition of the activity of such biomolecule. In some embodiments, the bioactive protein or fragments thereof include proteins and polypeptides that are administered to patients as the active drug substance for prevention of or treatment of a disease or condition, as well as proteins and polypeptides that are used for diagnostic purposes, such as enzymes used in diagnostic tests or in vitro assays, as well as proteins and polypeptides that are administered to a patient to prevent a disease such as a vaccine.
Anti-PLA2G2D Fusion Proteins
[0509] The anti-PLA2G2D constructs in some embodiments comprise an anti-PLA2G2D antibody moiety (e.g., an anti-PLA2G2D scFv) and a second moiety.
[0510] In some embodiments, the second moiety comprises a half-life extending moiety. In some embodiments, the half-life extending moiety is an albumin binding moiety (e.g., an albumin binding antibody moiety). In some embodiments, the anti-PLA2G2D antibody moiety and the half-life extending moiety is linked via a linker (such as any of the linkers described in the Linkers section).
Anti-PLA2G2D Immunoconjugates
[0511] In some embodiments, the anti-PLA2G2D construct described herein further comprises a second moiety. In some embodiments, the second moiety comprises a therapeutic agent. In some embodiments, the second moiety comprises a label. In some embodiments, the anti-PLA2G2D antibody moiety and the second moiety is linked via a linker (such as any of the linkers described in the Linkers section).
[0512] In some embodiments, the second agent is a cytotoxic agent. In some embodiments, the cytotoxic agent is a chemotherapeutic agent. In some embodiments, the cytotoxic agent is a growth inhibitory agent. In some embodiments, the cytotoxic agent is a toxin (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof). In some embodiments, the cytotoxic agent is a radioactive isotype (i.e., a radioconjugage).
[0513] Immunoconjugates allow for the targeted delivery of a drug moiety to a tissues (such as a tumor), and, in some embodiments intracellular accumulation therein, where systemic administration of unconjugated drugs may result in unacceptable levels of toxicity to normal cells (Polakis P. (2005) Current Opinion in Pharmacology 5:382-387).
[0514] Antibody-drug conjugates (ADC) are targeted chemo therapeutic molecules which combine properties of both antibodies and cytotoxic drugs by targeting potent cytotoxic drugs to antigen-expressing tumor cells (Teicher, B. A. (2009) Current Cancer Drug Targets 9:982-1004), thereby enhancing the therapeutic index by maximizing efficacy and minimizing off-target toxicity (Carter, P. J. and Senter P. D. (2008) The Cancer Jour: 14 (3): 154-169; Chari, R. V. (2008) ACC. Chen. Res. 41.98-107.
[0515] In the context of treating cancer, the ADC compounds of the application include those with anticancer activity. In some embodiments, the ADC compounds include an antibody conjugated, i.e. covalently attached, to the drug moiety. In some embodiments, the antibody is covalently attached to the drug moiety through a linker. In some embodiments, the second agent is connected to the anti-PLA2G2D antibody moiety via a linker (such as a linker described herein). In some embodiments, the linker is a cleavable. In some embodiments, the linker is non-cleavable.
[0516] The antibody-drug conjugates (ADC) of the application selectively deliver an effective dose of a drug to tumor tissue whereby greater selectivity, i.e. a lower efficacious dose, may be achieved while increasing the therapeutic index (therapeutic window). The drug moiety of the antibody-drug conjugates (ADC) may include any compound, moiety or group that has a cytotoxic or cytostatic effect. Drug moieties may impart their cytotoxic and cytostatic effects by mechanisms including but not limited to tubulin binding, DNA binding or intercalation, and inhibition of RNA polymerase, protein synthesis, and/or topoisomerase. Exemplary drug moieties include, but are not limited to, a maytansinoid, dolastatin, auristatin, calicheamicin, pyrrolobenzodiazepine (PBD), nemorubicin and its derivatives, PNU-159682, anthracy cline, duocarmycin, Vinca alkaloid, taxane, trichothecene, CC1065, camptothecin, elinafide, and stereoisomers, isosteres, analogs, and derivatives thereof that have cytotoxic activity.
[0517] Production of immunoconjugates described herein can be found in, for example, U.S. Pat. Nos. 9,562,099 and 7,541,034, which are hereby incorporated by references in their entirety.
Linkers
[0518] In some embodiments, the anti-PLA2G2D constructs described herein comprise one or more linkers between two moieties (e.g., the anti-PLA2G2D antibody moiety and the half-life extending moiety, the anti-PLA2G2D antibody moiety and the second binding moiety in the constructs described above). The length, the degree of flexibility and/or other properties of the linker(s) used in the anti-PLA2G2D constructs may have some influence on properties, including but not limited to the affinity, specificity or avidity for one or more particular antigens or epitopes. For example, longer linkers may be selected to ensure that two adjacent domains do not sterically interfere with one another. In some embodiment, a linker (such as peptide linker) comprises flexible residues (such as glycine and serine) so that the adjacent domains are free to move relative to each other. For example, a glycine-serine doublet can be a suitable peptide linker. In some embodiments, the linker is a non-peptide linker. In some embodiments, the linker is a peptide linker. In some embodiments, the linker is a non-cleavable linker. In some embodiments, the linker is a cleavable linker.
[0519] Other linker considerations include the effect on physical or pharmacokinetic properties of the resulting compound, such as solubility, lipophilicity, hydrophilicity, hydrophobicity, stability (more or less stable as well as planned degradation), rigidity, flexibility, immunogenicity, modulation of antibody binding, the ability to be incorporated into a micelle or liposome, and the like.
a) Peptide Linkers
[0520] The peptide linker may have a naturally occurring sequence, or a non-naturally occurring sequence. For example, a sequence derived from the hinge region of heavy chain only antibodies may be used as the linker. See, for example, WO1996/34103.
[0521] The peptide linker can be of any suitable length. In some embodiments, the peptide linker is at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 50, 75, 100 or more amino acids long. In some embodiments, the peptide linker is no more than about any of 100, 75, 50, 40, 35, 30, 25, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5 or fewer amino acids long. In some embodiments, the length of the peptide linker is any of about 1 amino acid to about 10 amino acids, about 1 amino acid to about 20 amino acids, about 1 amino acid to about 30 amino acids, about 5 amino acids to about 15 amino acids, about 10 amino acids to about 25 amino acids, about 5 amino acids to about 30 amino acids, about 10 amino acids to about 30 amino acids long, about 30 amino acids to about 50 amino acids, about 50 amino acids to about 100 amino acids, or about 1 amino acid to about 100 amino acids.
[0522] An essential technical feature of such peptide linker is that said peptide linker does not comprise any polymerization activity. The characteristics of a peptide linker, which comprise the absence of the promotion of secondary structures, are known in the art and described, e.g., in Dall'Acqua et al. (Biochem. (1998) 37, 9266-9273), Cheadle et al. (Mol Immunol (1992) 29, 21-30) and Raag and Whitlow (FASEB (1995) 9 (1), 73-80). A particularly preferred amino acid in context of the peptide linker is Gly. Furthermore, peptide linkers that also do not promote any secondary structures are preferred. The linkage of the domains to each other can be provided by, e.g., genetic engineering. Methods for preparing fused and operatively linked bispecific single chain constructs and expressing them in mammalian cells or bacteria are well-known in the art (e.g. WO 99/54440, Ausubel, Current Protocols in Molecular Biology, Green Publishing Associates and Wiley Interscience, N. Y. 1989 and 1994 or Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N. Y., 2001).
[0523] The peptide linker can be a stable linker, which is not cleavable by proteases, especially by Matrix metalloproteinases (MMPs).
[0524] The linker can also be a flexible linker. Exemplary flexible linkers include glycine polymers (G).sub.n (SEQ ID NO: 341), glycine-serine polymers (including, for example, (GS).sub.n (SEQ ID NO: 342), (GSGGS).sub.n (SEQ ID NO: 343), (GGGGS).sub.n (SEQ ID NO: 344), and (GGGS).sub.n (SEQ ID NO: 345), where n is an integer of at least one), glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art. Glycine and glycine-serine polymers are relatively unstructured, and therefore may be able to serve as a neutral tether between components. Glycine accesses significantly more phi-psi space than even alanine, and is much less restricted than residues with longer side chains (See Scheraga, Rev. Computational Chem. 11 173-142 (1992)). The ordinarily skilled artisan will recognize that design of an antibody fusion protein can include linkers that are all or partially flexible, such that the linker can include a flexible linker portion as well as one or more portions that confer less flexible structure to provide a desired antibody fusion protein structure.
[0525] Furthermore, exemplary linkers also include the amino acid sequence of such as (GGGGS).sub.n (SEQ ID NO: 344), wherein n is an integer between 1 and 8, e.g. (GGGGS) 3 (SEQ ID NO: 346; hereinafter referred to as (G4S) 3 or GS3), or (GGGGS) 6 (SEQ ID NO: 347; hereinafter referred to as (G4S) 6 or GS6). In some embodiments, the peptide linker comprises the amino acid sequence of (GSTSGSGKPGSGEGS).sub.n (SEQ ID NO: 348), wherein n is an integer between 1 and 3.
b) Non-Peptide Linkers
[0526] Coupling of two moieties may be accomplished by any chemical reaction that will bind the two molecules so long as both components retain their respective activities, e.g., binding to PLA2G2D and a second agent in an anti-PLA2G2D multispecific antibody, respectively. This linkage can include many chemical mechanisms, for instance covalent binding, affinity binding, intercalation, coordinate binding and complexation. In some embodiments, the binding is covalent binding. Covalent binding can be achieved either by direct condensation of existing side chains or by the incorporation of external bridging molecules. Many bivalent or polyvalent linking agents may be useful in coupling protein molecules in this context. For example, representative coupling agents can include organic compounds such as thioesters, carbodiimides, succinimide esters, diisocyanates, glutaraldehyde, diazobenzenes and hexamethylene diamines. This listing is not intended to be exhaustive of the various classes of coupling agents known in the art but, rather, is exemplary of the more common coupling agents (See Killen and Lindstrom, Jour. Immun. 133:1335-2549 (1984); Jansen et al., Immunological Reviews 62:185-216 (1982); and Vitetta et al., Science 238:1098 (1987)).
[0527] Linkers that can be applied in the present application are described in the literature (see, for example, Ramakrishnan, S. et al., Cancer Res. 44:201-208 (1984) describing use of MBS (M-maleimidobenzoyl-N-hydroxysuccinimide ester). In some embodiments, non-peptide linkers used herein include: (i) EDC (1-ethyl-3-(3-dimethylamino-propyl) carbodiimide hydrochloride; (ii) SMPT (4-succinimidyloxycarbonyl-alpha-methyl-alpha-(2-pridyl-dithio)-toluene (Pierce Chem. Co., Cat. (21558G); (iii) SPDP (succinimidyl-6 [3-(2-pyridyldithio) propionamido] hexanoate (Pierce Chem. Co., Cat #21651G); (iv) Sulfo-LC-SPDP (sulfosuccinimidyl 6 [3-(2-pyridyldithio)-propianamide] hexanoate (Pierce Chem. Co. Cat. #2165-G); and (v) sulfo-NHS (N-hydroxysulfo-succinimide: Pierce Chem. Co., Cat. #24510) conjugated to EDC. In some embodiments, the linker is a PEG containing linker.
[0528] The linkers described above contain components that have different attributes, thus may lead to bispecific antibodies with differing physio-chemical properties. For example, sulfo-NHS esters of alkyl carboxylates are more stable than sulfo-NHS esters of aromatic carboxylates. NHS-ester containing linkers are less soluble than sulfo-NHS esters. Further, the linker SMPT contains a sterically hindered disulfide bond, and can form antibody fusion protein with increased stability. Disulfide linkages, are in general, less stable than other linkages because the disulfide linkage is cleaved in vitro, resulting in less antibody fusion protein available. Sulfo-NHS, in particular, can enhance the stability of carbodimide couplings. Carbodimide couplings (such as EDC) when used in conjunction with sulfo-NHS, forms esters that are more resistant to hydrolysis than the carbodimide coupling reaction alone.
III. Methods of Preparation
[0529] In some embodiments, there is provided a method of preparing an anti-PLA2G2D construct or antibody moiety that specifically binds to PLA2G2D and a composition such as polynucleotide, nucleic acid construct, vector, host cell, or culture medium that is produced during the preparation of the anti-PLA2G2D construct or antibody moiety. The anti-PLA2G2D construct or antibody moiety or composition described herein may be prepared by a number of processes as generally described below and more specifically in the Examples.
1. Antibody Expression and Production
[0530] The antibodies (including anti-PLA2G2D monoclonal antibodies, anti-PLA2G2D bispecific antibodies, and anti-PLA2G2D antibody moieties) described herein can be prepared using any known methods in the art, including those described below and in the Examples.
c) Monoclonal Antibodies
[0531] Monoclonal antibodies are obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations and/or post-translational modifications (e.g., isomerizations, amidations) that may be present in minor amounts. Thus, the modifier monoclonal indicates the character of the antibody as not being a mixture of discrete antibodies. For example, the monoclonal antibodies may be made using the hybridoma method first described by Kohler et al., Nature, 256:495 (1975), or may be made by recombinant DNA methods (U.S. Pat. No. 4,816,567). In the hybridoma method, a mouse or other appropriate host animal, such as a hamster or a llama, is immunized as hereinabove described to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind the protein used for immunization. Alternatively, lymphocytes may be immunized in vitro. Lymphocytes then are fused with myeloma cells using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice, pp. 59-103 (Academic Press, 1986). Also See Example 1 for immunization in Camels.
[0532] The immunizing agent will typically include the antigenic protein or a fusion variant thereof. Generally, either peripheral blood lymphocytes (PBLs) are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired. The lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell. Goding, Monoclonal Antibodies: Principles and Practice, Academic Press (1986), pp. 59-103.
[0533] Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin. Usually, rat or mouse myeloma cell lines are employed. The hybridoma cells thus prepared are seeded and grown in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells. For example, if the parental myeloma cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which are substances that prevent the growth of HGPRT-deficient cells.
[0534] Preferred immortalized myeloma cells are those that fuse efficiently, support stable high-level production of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium. Among these, preferred are murine myeloma lines, such as those derived from MOPC-21 and MPC-11 mouse tumors available from the Salk Institute Cell Distribution Center, San Diego, Calif. USA, and SP-2 cells (and derivatives thereof, e.g., X63-Ag8-653) available from the American Type Culture Collection, Manassas, Va. USA. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies (Kozbor, J. Immunol., 133:3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987)).
[0535] Culture medium in which hybridoma cells are growing is assayed for production of monoclonal antibodies directed against the antigen. Preferably, the binding specificity of monoclonal antibodies produced by hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as flow cytometry, radioimmunoassay (RIA) or enzyme-linked immunosorbent assay (ELISA).
[0536] The culture medium in which the hybridoma cells are cultured can be assayed for the presence of monoclonal antibodies directed against the desired antigen. Preferably, the binding affinity and specificity of the monoclonal antibody can be determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA), enzyme-linked assay (ELISA), or BLI. Such techniques and assays are known in the in art. For example, binding affinity may be determined by the Scatchard analysis of Munson et al., Anal. Biochem., 107:220 (1980).
[0537] After hybridoma cells are identified that produce antibodies of the desired specificity, affinity, and/or activity, the clones may be subcloned by limiting dilution procedures and grown by standard methods (Goding, supra). Suitable culture media for this purpose include, for example, D-MEM or RPMI-1640 medium. In addition, the hybridoma cells may be grown in vivo as tumors in a mammal.
[0538] The monoclonal antibodies secreted by the subclones are suitably separated from the culture medium, ascites fluid, or serum by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, ion exchange chromatography, gel electrophoresis, dialysis, or affinity chromatography.
[0539] Monoclonal antibodies may also be made by recombinant DNA methods, such as those described in U.S. Pat. No. 4,816,567, and as described above. mRNA encoding the monoclonal antibodies is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to cDNA encoding the heavy and light chains of murine antibodies). The hybridoma cells serve as a preferred source of such mRNA. Once isolated, the cDNA may be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, in order to synthesize monoclonal antibodies in such recombinant host cells. Review articles on recombinant expression in bacteria of DNA encoding the antibody include Skerra et al., Curr. Opinion in Immunol., 5:256-262 (1993) and Pluckthun, Immunol. Revs. 130:151-188 (1992).
[0540] In a further embodiment, antibodies can be isolated from antibody phage libraries generated using the techniques described in McCafferty et al., Nature, 348:552-554 (1990). Clackson et al., Nature, 352:624-628 (1991) and Marks et al., J. Mol. Biol., 222:581-597 (1991) describe the isolation of murine and human antibodies, respectively, using phage libraries. Subsequent publications describe the production of high affinity (nM range) human antibodies by chain shuffling (Marks et al., Bio Technology, 10:779-783 (1992)), as well as combinatorial infection and in vivo recombination as a strategy for constructing very large phage libraries (Waterhouse et al., Nucl. Acids Res., 21:2265-2266 (1993)). Thus, these techniques are viable alternatives to traditional monoclonal antibody hybridoma techniques for isolation of monoclonal antibodies.
[0541] The DNA also may be modified, for example, by substituting the coding sequence for human heavy- and light-chain constant domains in place of the homologous murine sequences (U.S. Pat. No. 4,816,567; Morrison, et al., Proc. Natl Acad. Sci. USA, 81:6851 (1984)), or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide. Typically, such non-immunoglobulin polypeptides are substituted for the constant domains of an antibody, or they are substituted for the variable domains of one antigen-combining site of an antibody to create a chimeric bivalent antibody comprising one antigen-combining site having specificity for an antigen and another antigen-combining site having specificity for a different antigen.
[0542] The monoclonal antibodies described herein may by monovalent, the preparation of which is well known in the art. For example, one method involves recombinant expression of immunoglobulin light chain and a modified heavy chain. The heavy chain is truncated generally at any point in the Fc region so as to prevent heavy chain crosslinking. Alternatively, the relevant cysteine residues may be substituted with another amino acid residue or are deleted so as to prevent crosslinking. In vitro methods are also suitable for preparing monovalent antibodies. Digestion of antibodies to produce fragments thereof, particularly Fab fragments, can be accomplished using routine techniques known in the art.
[0543] Chimeric or hybrid antibodies also may be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents. For example, immunotoxins may be constructed using a disulfide-exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include iminothiolate and methyl-4-mercaptobutyrimidate.
2. Nucleic Acid Molecules Encoding Antibody Moieties
[0544] In some embodiments, there is provided a polynucleotide encoding any one of the anti-PLA2G2D constructs or antibody moieties described herein. In some embodiments, there is provided a polynucleotide prepared using any one of the methods as described herein. In some embodiments, a nucleic acid molecule comprises a polynucleotide that encodes a heavy chain or a light chain of an antibody moiety (e.g., anti-PLA2G2D antibody moiety). In some embodiments, a nucleic acid molecule comprises both a polynucleotide that encodes a heavy chain and a polynucleotide that encodes a light chain, of an antibody moiety (e.g., anti-PLA2G2D antibody moiety). In some embodiments, a first nucleic acid molecule comprises a first polynucleotide that encodes a heavy chain and a second nucleic acid molecule comprises a second polynucleotide that encodes a light chain.
[0545] In some such embodiments, the heavy chain and the light chain are expressed from one nucleic acid molecule, or from two separate nucleic acid molecules, as two separate polypeptides. In some embodiments, such as when an antibody is an scFv, a single polynucleotide encodes a single polypeptide comprising both a heavy chain and a light chain linked together.
[0546] In some embodiments, a polynucleotide encoding a heavy chain or light chain of an antibody moiety (e.g., anti-PLA2G2D antibody moiety) comprises a nucleotide sequence that encodes a leader sequence, which, when translated, is located at the N terminus of the heavy chain or light chain. As discussed above, the leader sequence may be the native heavy or light chain leader sequence, or may be another heterologous leader sequence.
[0547] In some embodiments, the polynucleotide is a DNA. In some embodiments, the polynucleotide is an RNA. In some embodiments, the RNA is an mRNA.
[0548] Nucleic acid molecules may be constructed using recombinant DNA techniques conventional in the art. In some embodiments, a nucleic acid molecule is an expression vector that is suitable for expression in a selected host cell.
d) Nucleic Acid Construct
[0549] In some embodiments, there is provided a nucleic acid construct comprising any one of the polynucleotides described herein. In some embodiments, there is provided a nucleic acid construct prepared using any method described herein.
[0550] In some embodiments, the nucleic acid construct further comprises a promoter operably linked to the polynucleotide. In some embodiments, the polynucleotide corresponds to a gene, wherein the promoter is a wild-type promoter for the gene.
3. Vectors
[0551] In some embodiments, there is provided a vector comprising any polynucleotides that encode the heavy chains and/or light chains of any one of the antibody moieties described herein (e.g., anti-PLA2G2D antibody moieties) or nucleic acid construct described herein. In some embodiments, there is provided a vector prepared using any method described herein. Vectors comprising polynucleotides that encode any of anti-PLA2G2D constructs such as antibodies, scFvs, fusion proteins or other forms of constructs described herein (e.g., anti-PLA2G2D scFv) are also provided. Such vectors include, but are not limited to, DNA vectors, phage vectors, viral vectors, retroviral vectors, etc. In some embodiments, a vector comprises a first polynucleotide sequence encoding a heavy chain and a second polynucleotide sequence encoding a light chain. In some embodiments, the heavy chain and light chain are expressed from the vector as two separate polypeptides. In some embodiments, the heavy chain and light chain are expressed as part of a single polypeptide, such as, for example, when the antibody is an scFv.
[0552] In some embodiments, a first vector comprises a polynucleotide that encodes a heavy chain and a second vector comprises a polynucleotide that encodes a light chain. In some embodiments, the first vector and second vector are transfected into host cells in similar amounts (such as similar molar amounts or similar mass amounts). In some embodiments, a mole- or mass-ratio of between 5:1 and 1:5 of the first vector and the second vector is transfected into host cells. In some embodiments, a mass ratio of between 1:1 and 1:5 for the vector encoding the heavy chain and the vector encoding the light chain is used. In some embodiments, a mass ratio of 1:2 for the vector encoding the heavy chain and the vector encoding the light chain is used.
[0553] In some embodiments, a vector is selected that is optimized for expression of polypeptides in CHO or CHO-derived cells, or in NSO cells. Exemplary such vectors are described, e.g., in Running Deer et al., Biotechnol. Prog. 20:880-889 (2004).
4. Host Cells
[0554] In some embodiments, there is provided a host cell comprising any polypeptide, nucleic acid construct and/or vector described herein. In some embodiments, there is provided a host cell prepared using any method described herein. In some embodiments, the host cell is capable of producing any of antibody moieties described herein under a fermentation condition.
[0555] In some embodiments, the antibody moieties described herein (e.g., anti-PLA2G2D antibody moieties) may be expressed in prokaryotic cells, such as bacterial cells; or in eukaryotic cells, such as fungal cells (such as yeast), plant cells, insect cells, and mammalian cells. Such expression may be carried out, for example, according to procedures known in the art. Exemplary eukaryotic cells that may be used to express polypeptides include, but are not limited to, COS cells, including COS 7 cells; 293 cells, including 293-6E cells; CHO cells, including CHO-S, DG44. Lec13 CHO cells, CHOZN? and FUT8 CHO cells; PER.C6? cells (Crucell); and NSO cells. In some embodiments, the antibody moieties described herein (e.g., anti-PLA2G2D antibody moieties) may be expressed in yeast. See, e.g., U.S. Publication No. US 2006/0270045 A1. In some embodiments, a particular eukaryotic host cell is selected based on its ability to make desired post-translational modifications to the heavy chains and/or light chains of the antibody moiety. For example, in some embodiments, CHO cells produce polypeptides that have a higher level of sialylation than the same polypeptide produced in 293 cells.
[0556] Introduction of one or more nucleic acids into a desired host cell may be accomplished by any method, including but not limited to, calcium phosphate transfection, DEAE-dextran mediated transfection, cationic lipid-mediated transfection, electroporation, transduction, infection, etc. Non-limiting exemplary methods are described, e.g., in Sambrook et al., Molecular Cloning, A Laboratory Manual, 3.sup.rd ed. Cold Spring Harbor Laboratory Press (2001). Nucleic acids may be transiently or stably transfected in the desired host cells, according to any suitable method.
[0557] The present application also provides host cells comprising any of the polynucleotides or vectors described herein. In some embodiments, the invention provides a host cell comprising an anti-PLA2G2D antibody. Any host cells capable of over-expressing heterologous DNAs can be used for the purpose of isolating the genes encoding the antibody, polypeptide or protein of interest. Non-limiting examples of mammalian host cells include but not limited to COS, HeLa, and CHO cells. See also PCT Publication No. WO 87/04462. Suitable non-mammalian host cells include prokaryotes (such as E. coli or B. subtillis) and yeast (such as S. cerevisae, S. pombe; or K. lactis).
[0558] In some embodiments, the antibody moiety is produced in a cell-free system. Non-limiting exemplary cell-free systems are described, e.g., in Sitaraman et al., Methods Mol. Biol. 498:229-44 (2009); Spirin, Trends Biotechnol. 22:538-45 (2004); Endo et al., Biotechnol. Adv. 21:695-713 (2003).
5. Culture Medium
[0559] In some embodiments, there is provided a culture medium comprising any antibody moiety, polynucleotide, nucleic acid construct, vector, and/or host cell described herein. In some embodiments, there is provided a culture medium prepared using any method described herein.
[0560] In some embodiments, the medium comprises hypoxanthine, aminopterin, and/or thymidine (e.g., HAT medium). In some embodiments, the medium does not comprise serum. In some embodiments, the medium comprises serum. In some embodiments, the medium is a D-MEM or RPMI-1640 medium. In some embodiments, the medium is a chemically defined medium. In some embodiments, the chemically defined medium is optimized for the host cell line.
6. Purification of Antibody Moieties
[0561] The anti-PLA2G2D constructs (e.g., anti-PLA2G2D monoclonal antibodies or multispecific antibodies) may be purified by any suitable method. Such methods include, but are not limited to, the use of affinity matrices or hydrophobic interaction chromatography. Suitable affinity ligands include the ROR1 ECD and ligands that bind antibody constant regions. For example, a Protein A, Protein G, Protein A/G, or an antibody affinity column may be used to bind the constant region and to purify an anti-PLA2G2D construct comprising an Fc fragment. Hydrophobic interactive chromatography, for example, a butyl or phenyl column, may also suitable for purifying some polypeptides such as antibodies. Ion exchange chromatography (e.g. anion exchange chromatography and/or cation exchange chromatography) may also suitable for purifying some polypeptides such as antibodies. Mixed-mode chromatography (e.g. reversed phase/anion exchange, reversed phase/cation exchange, hydrophilic interaction/anion exchange, hydrophilic interaction/cation exchange, etc.) may also suitable for purifying some polypeptides such as antibodies. Many methods of purifying polypeptides are known in the art.
IV. Methods of Treatment
[0562] The present application in one aspect provides methods of treating a disease or condition (such as cancer or infectious disease) in an individual, comprising administering to the individual an effective amount of an anti-PLA2G2D construct (such as any of the anti-PLA2G2D constructs described herein). Please note that the methods described herein, while described generically for conciseness purposes, is intended to independently apply to each of the anti-anti-PLA2G2D constructs described here.
[0563] In some embodiments, there is provided a method of treating a cancer (such as a solid tumor, a colon cancer, melanoma, or a T cell lymphoma) in an individual, comprising administering into the individual an effective amount of an anti-PLA2G2D construct (such as any of the anti-PLA2G2D constructs described herein). In some embodiments, the anti-PLA2G2D construct is a monoclonal antibody. In some embodiments, the anti-PLA2G2D construct is a fusion protein or immunoconjugate comprising an anti-PLA2G2D antibody moiety and a second moiety, such as a second moiety comprising a cytokine (such as a pro-inflammatory cytokine). In some embodiment, the PLA2G2D is a human PLA2G2D. In some embodiments, the cancer tissue has an increased expression level of PLA2G2D as compared to a reference tissue (such as a corresponding tissue in a healthy individual). In some embodiments, the cancer is an advanced or malignant tumor. In some embodiments, the cancer is selected from the group consisting of lung cancer, breast cancer, liver cancer, gastric cancer, cervical cancer, endometrial cancer, thyroid cancer, colorectal cancer, head and neck cancer, pancreatic cancer, renal cancer, prostate cancer, urothelial cancer, testis cancer, ovarian cancer and melanoma. In some embodiments, the method further comprises administering a second agent. In some embodiments, the second agent is selected from the group consisting of a chemotherapeutic agent, an immunomodulator, an anti-angiogenesis agent, a growth inhibitory agent, and an antineoplastic agent. In some embodiments, the second agent is an immunomodulator. In some embodiments, the immunomodulator is an immune checkpoint inhibitor. In some embodiments, the immune checkpoint inhibitor specifically target PD-L1, PD-L2, CTLA4, PD-L2, PD-1, CD47, TIGIT, GITR, TIM3, LAG3, CD27, 4-1BB, or B7H4. In some embodiments, the second agent comprises a cell comprising a chimeric antigen receptor that specifically binds to a tumor antigen. In some embodiments, the anti-PLA2G2D construct and the second agent is administered simultaneously or concurrently. In some embodiments, the anti-PLA2G2D construct and the second agent is administered sequentially. In some embodiments, the anti-PLA2G2D construct and/or the second agent is administered parentally. In some embodiments, the anti-PLA2G2D construct is administered to diseased tissue directly.
[0564] In some embodiments, there is provided a method of treating an infectious disease (such as a viral infectious disease) in an individual, comprising administering into the individual an effective amount of an anti-PLA2G2D construct (such as any of the anti-PLA2G2D constructs described herein). In some embodiments, the anti-PLA2G2D construct comprises an anti-PLA2G2D antibody. In some embodiments, the anti-PLA2G2D antibody is a monoclonal antibody. In some embodiments, the anti-PLA2G2D construct is a fusion protein or immunoconjugate comprising an anti-PLA2G2D antibody moiety and a second moiety. In some embodiments, the second moiety comprises a cytokine (such as a pro-inflammatory cytokine). In some embodiment, the PLA2G2D is a human PLA2G2D. In some embodiments, the infection site has an increased expression level of PLA2G2D as compared to a reference tissue (such as a corresponding tissue in a healthy individual). In some embodiments, the method further comprises administering a second agent. In some embodiments, the second agent comprises an immune therapy. In some embodiments, the anti-PLA2G2D construct and the second agent is administered simultaneously or concurrently. In some embodiments, the anti-PLA2G2D construct and the second agent is administered sequentially. In some embodiments, the anti-PLA2G2D construct and/or the second agent is administered parentally. In some embodiments, the anti-PLA2G2D construct is administered to diseased tissue directly.
[0565] The administration of the anti-PLA2G2D constructs described herein can also be useful for promoting local immune response, promoting proliferation and/or activation of immune cells (such as T cells), and promoting a favorable tumor microenvironment. In some embodiments, there is provided a method of promoting local immune response in a cancer tissue in an individual having a cancer (such as a solid tumor), comprising administering any of the anti-PLA2G2D constructs described herein. In some embodiments, there is provided a method of promoting local immune response in an infection site in an individual having an infection (such as a virus infection), comprising administering any of the anti-PLA2G2D constructs described herein.
[0566] In some embodiments, there is provided a method of promoting proliferation and/or activation of T cells in a cancer tissue in an individual having a cancer (such as a solid tumor), comprising administering any of the anti-PLA2G2D constructs described herein. In some embodiments, there is provided a method of promoting proliferation and/or activation of T cells in an infection site in an individual having an infection (such as a virus infection), comprising administering any of the anti-PLA2G2D constructs described herein. In some embodiments, the T cells are CD4+ T cells. In some embodiments, the T cells are CD8+ T cells.
[0567] In some embodiments, there is provided a method of promoting a favorable tumor microenvironment in a cancer tissue in an individual having a cancer (such as a solid tumor), comprising administering any of the anti-PLA2G2D constructs described herein. In some embodiments, there is provided a method of promoting a favorable microenvironment in an infection site in an individual having an infection (such as a virus infection), comprising administering any of the anti-PLA2G2D constructs described herein. Promoting favorable tumor microenvironment generally refers to or comprises conversion of a tumor tissue that is resistant to a cancer therapy (such as an immunotherapy) to a tumor tissue that is less resistant to the cancer therapy.
A. Disease or Condition
[0568] The methods described herein are applicable to diseases and conditions for which there are suppressed immune responses in the body that at least partly contribute to the less effective treating of the disease. Exemplary diseases include cancer or infectious disease (such as viral infectious disease).
7. Cancer
[0569] In some embodiments, the disease or condition described herein is a cancer. Cancers that may be treated using any of the methods described herein include any types of cancers. Types of cancers to be treated with the agent as described in this application include, but are not limited to, carcinoma, blastoma, sarcoma, benign and malignant tumors, and malignancies e.g., sarcomas, carcinomas, and melanomas. Adult tumors/cancers and pediatric tumors/cancers are also included.
[0570] In various embodiments, the cancer is early stage cancer, non-metastatic cancer, primary cancer, advanced cancer, locally advanced cancer, metastatic cancer, cancer in remission, recurrent cancer, cancer in an adjuvant setting, cancer in a neoadjuvant setting, or cancer substantially refractory to a therapy.
[0571] In some embodiments, the cancer is a solid tumor.
[0572] In some embodiments, the cancer is a liquid tumor.
[0573] In some embodiments, the cancer tissue has a high expression level of PLA2G2D when the expression level of PLA2G2D (e.g., assessed by immunohistochemistry) is at least about 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95% higher than the expression level of PLA2G2D in a reference tissue. In some embodiments, the cancer tissue has a high expression level of PLA2G2D when the expression level of PLA2G2D (e.g., assessed by immunohistochemistry) is at least about 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 30-fold, 40-fold, or 50-fold higher than the expression level of PLA2G2D in a reference tissue. In some embodiments, the reference tissue is the corresponding tissue in a healthy individual. In some embodiments, the expression level of PLA2G2D in a reference tissue is the average expression level of PLA2G2D in the same tissue in a group of individuals (such as 10, 30, 50, 100 individuals) with same or similar cancer. In some embodiments, the reference tissue is the corresponding tissue in an individual who also has a cancer but has a less suppressed immune response in the cancer tissue as indicated by a biomarker (such as high M2 macrophages, or high expression of an immune checkpoint agent such as PD-1 or PD-L1).
[0574] In some embodiments, the cancer tissue has a high T cell infiltration (e.g., high CD3 T cells, high CD8 T cells, high CD4 T cells, activated T cells, activated CD8 T cells, or activated CD4 T cells) in the cancer tissue. In some embodiments, the cancer tissue has a high T cell infiltration when the number of the T cells in the cancer is at least about 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95% more than the number of the corresponding T cells in a reference tissue. In some embodiments, the high T cell infiltration is present when the number of the T cells in the cancer is at least about 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, or 10-fold more than the number of the corresponding T cells in a reference tissue. In some embodiments, the reference tissue is the corresponding tissue in a healthy individual. In some embodiments, the number of the corresponding T cells in a reference tissue is the average number of the corresponding T cells in the same tissue in a group of individuals (such as 10, 30, 50, 100 individuals) with same or similar cancer. In some embodiments, the reference tissue is the corresponding tissue in an individual who also has a cancer but has a less suppressed immune response in the cancer tissue as indicated by a biomarker (such as high M2 macrophages, high expression of an immune checkpoint agent such as PD-1 or PD-L1, high expression level of PLA2G2D).
[0575] In some embodiments, the cancer has a decreased number (such as a decrease by at least 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95%) of immune cells (such as activated T cells, activated CD4+ T cells, or activated CD8+ T cells) in the cancer tissue as compared to that of a reference tissue. In some embodiments, the cancer has a decreased number (such as a decrease by at least 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95%) of activated immune cells (such as activated T cells, activated CD4+ T cells, or activated CD8+ T cells) in the cancer tissue as compared to that of a reference tissue. In some embodiments, the cancer tissue has a decreased level (such as a decrease by at least 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95%) of a cytokine (such as a pro-inflammatory cytokine, such as IFN? or IL-2) as compared to that of a reference tissue.
[0576] In some embodiments, the reference tissue is the corresponding tissue in a healthy individual. In some embodiments, the reference tissue is the corresponding tissue in an individual who also has a cancer but has a less suppressed immune response in the cancer tissue. The suppression of immune response can be assessed by measuring a) the number of immune cells (e.g., CD3+ cells); b) the proliferating/expanding status of immune cells; c) the activation status of immune cells; and/or d) the cytokine level. In some embodiments, any one or more of the a)-d) is measured in the cancer tissue. In some embodiments, the immune cells are T cells. In some embodiments, the immune cells are CD8+ T cells (such as activated CD8+ T cells). In some embodiments, the immune cells are CD4+ T cells (such as activated CD4+ T cells).
[0577] Examples of cancers that may be treated by the methods of this application include, but are not limited to, anal cancer, astrocytoma (e.g., cerebellar and cerebral), basal cell carcinoma, bladder cancer, bone cancer, (osteosarcoma and malignant fibrous histiocytoma), brain tumor (e.g., glioma, brain stem glioma, cerebellar or cerebral astrocytoma (e.g., astrocytoma, malignant glioma, medulloblastoma, and glioblastoma), breast cancer, cervical cancer, colon cancer, colorectal cancer, endometrial cancer (e.g., uterine cancer), esophageal cancer, eye cancer (e.g., intraocular melanoma and retinoblastoma), gastric (stomach) cancer, gastrointestinal stromal tumor (GIST), head and neck cancer, hepatocellular (liver) cancer (e.g., hepatic carcinoma and heptoma), liver cancer, lung cancer (e.g., small cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, and squamous carcinoma of the lung), medulloblastoma, melanoma, mesothelioma, myelodysplastic syndromes, nasopharyngeal cancer, neuroblastoma, ovarian cancer, pancreatic cancer, parathyroid cancer, cancer of the peritoneal, pituitary tumor, rectal cancer, renal cancer, renal pelvis and ureter cancer (transitional cell cancer), rhabdomyosarcoma, skin cancer (e.g., non-melanoma (e.g., squamous cell carcinoma), melanoma, and Merkel cell carcinoma), small intestine cancer, squamous cell cancer, testicular cancer, thyroid cancer, and tuberous sclerosis. Additional examples of cancers can be found in The Merck Manual of Diagnosis and Therapy, 19th Edition, ? on Hematology and Oncology, published by Merck Sharp & Dohme Corp., 2011 (ISBN 978-0-911910-19-3); The Merck Manual of Diagnosis and Therapy, 20th Edition, ? on Hematology and Oncology, published by Merck Sharp & Dohme Corp., 2018 (ISBN 978-0-911-91042-1) (2018 digital online edition at internet website of Merck Manuals); and SEER Program Coding and Staging Manual 2016, each of which are incorporated by reference in their entirety for all purposes.
[0578] In some embodiments, the disease or condition is a colon cancer.
[0579] In some embodiments, the disease or condition is melanoma.
[0580] In some embodiments, the disease or condition is a T cell lymphoma.
8. Infectious Disease
[0581] In some embodiments, the disease or condition is an infectious disease. In some embodiments, the infectious disease is a viral infectious disease.
[0582] In some embodiments, the viral infectious disease is characterized by infection with hepatitis virus, human immunodeficiency virus (HIV), picornavirus, poliovirus, enterovirus, human Coxsackie virus, influenza virus, rhinovirus, echovirus, rubella virus, encephalitis virus, rabies virus, herpes virus, papillomavirus, polyoma virus, RSV, adenovirus, yellow fever virus, dengue virus, parainfluenza virus, hemorrhagic virus, pox virus, varicella zoster virus, parainfluenza virus, reovirus, orbivirus, rotavirus, parvovirus, African swine fever virus, measles, coronavirus (such as SARS-COV, MERS-COV, 2019-nCOV), Ebola virus, mumps or Norwalk virus. In some embodiments, the viral infectious disease is characterized by infection with an oncogenic virus such as CMV, EBV, HBV, KSHV, HPV, MCV, HTLV-1, HIV-1, or HCV. In some embodiments, the one or more genes encoding proteins involved in the viral infectious disease development and/or progression include, but are not limited to, genes encoding RSV nucleocapsid, Pre-gen/Pre-C, Pre-S1, Pre-S2/S, X, HBV conserved sequences, HIV Gag polyprotein (p55), HIV Pol polyprotein, HIV Gag-Pol precursor (p160), HIV matrix protein (MA, p17), HIV capsid protein (CA, p24), HIV spacer peptide 1 (SP1, p2), HIV nucleocapsid protein (NC, p9), HIV spacer peptide 2 (SP2, p1), HIV P6 protein, HIV reverse transcriptase (RT, p50), HIV RNase H (p15), HIV integrase (IN, p31), HIV protease (PR, p10), HIV Env (gp160), gp120, gp41, HIV transactivator (Tat), HIV regulator of expression of virion proteins (Rev), HIV lentivirus protein R (Vpr), HIV Vif, HIV negative factor (Nef), HIV virus protein U (Vpu), human CCR5, miR-122, EBOV polymerase L, VP24, VP40, GP/sGP, VP30, VP35, NPC1, and TIM-1, including mutants thereof.
[0583] In some embodiments, the viral infectious disease is characterized by infection with coronavirus. In some embodiments, the viral infectious disease is characterized by infection with influenza virus.
[0584] An infection site refers to a tissue in the body where virus appear in a significant number and/or causes significant damages. In some embodiments, the infection site comprises has an increased expression level of PLA2G2D as compared to a reference tissue. In some embodiments, the PLA2G2D expression level in the infection site is increased by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% as compared to that of the reference tissue. In some embodiments, the PLA2G2D expression level in the infection site is increased by at least about 1-fold, 2-fold, 3-fold, 4-fold, or 5-fold as compared to that of the reference tissue.
[0585] In some embodiments, the infection site has a decreased number (such as a decrease by at least 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95%) of immune cells (such as activated T cells, activated CD4+ T cells, or activated CD8+ T cells) in the infection site as compared to that of a reference tissue. In some embodiments, the infection site has a decreased number (such as a decrease by at least 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95%) of activated immune cells (such as activated T cells, activated CD4+ T cells, or activated CD8+ T cells) in the infection site as compared to that of a reference tissue. In some embodiments, the infection site has a decreased level (such as a decrease by at least 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95%) of a cytokine (such as a pro-inflammatory cytokine, such as IFN? or IL-2) as compared to that of a reference tissue.
[0586] In some embodiments, the reference tissue is the corresponding tissue in a healthy individual. In some embodiments, the reference tissue is the corresponding tissue in an individual who also has a virus infection (such as a virus infection of the same type) but has a less suppressed immune response in the infection site. The suppression of immune response can be assessed by measuring a) the number of immune cells; b) the proliferating/expanding status of immune cells; c) the activation status of immune cells; and/or d) the cytokine level. In some embodiments, the immune cells in circulation are assessed. In some embodiments, the immune cells in diseased tissue are assessed. In some embodiments, the immune cells in lymph tissue (such as lymph node) are assessed. In some embodiments, the immune cells are T cells. In some embodiments, the immune cells are CD8+ T cells (such as activated CD8+ T cells). In some embodiments, the immune cells are CD4+ T cells (such as activated CD4+ T cells).
B. Individual
[0587] In some embodiments, the individual is a mammal (such as a human).
[0588] In some embodiments, the individual is selected for treatment based upon a high expression of PLA2G2D in a diseased tissue. In some embodiments, the tissue is a cancer tissue. In some embodiments, the tissue is an infection site.
[0589] In some embodiments, the PLA2G2D expression level in the infection site is increased by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% as compared to that of the reference tissue. In some embodiments, the PLA2G2D expression level in the infection site is increased by at least about 1-fold, 2-fold, 3-fold, 4-fold, or 5-fold as compared to that of the reference tissue.
[0590] In some embodiments, the individual is selected for treatment based upon the indication of a suppressed immune response. In some embodiments, the individual has a suppressed immune response in a diseased tissue. In some embodiments, the tissue is a cancer tissue. In some embodiments, the tissue is an infection site.
[0591] As described above, the suppression of immune response can be assessed by measuring a) the number of immune cells; b) the proliferating/expanding status of immune cells; c) the activation status of immune cells; and/or d) the cytokine level. In some embodiments, the immune cells in circulation are assessed. In some embodiments, the immune cells in diseased tissue are assessed. In some embodiments, the immune cells in lymph tissue (such as lymph node) are assessed. In some embodiments, the immune cells are T cells. In some embodiments, the immune cells are CD8+ T cells (such as activated CD8+ T cells). In some embodiments, the immune cells are CD4+ T cells (such as activated CD4+ T cells).
[0592] In some embodiments, the individual has a decreased number (such as a decrease by at least 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95%) of immune cells (such as activated T cells, activated CD4+ T cells, or activated CD8+ T cells) in the tissue (such as the cancer tissue or infection site) as compared to that of a reference tissue. In some embodiments, the individual has a decreased number (such as a decrease by at least 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95%) of activated immune cells (such as activated T cells, activated CD4+ T cells, or activated CD8+ T cells) in the tissue (such as the cancer tissue or infection site) as compared to that of a reference tissue. In some embodiments, the individual has a decreased level (such as a decrease by at least 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95%) of a cytokine (such as a pro-inflammatory cytokine, such as IFN? or IL-2) in the tissue (such as the cancer tissue or infection site) as compared to that of a reference tissue.
[0593] In some embodiments, the reference tissue is the corresponding tissue in a healthy individual. In some embodiments, the reference tissue is the corresponding tissue in an individual who also has a same or similar disease or condition but has a less suppressed immune response in the cancer tissue.
[0594] In some embodiments, the individual has a compromised immune system.
[0595] In some embodiments, the individual is at least about 60, 65, 70, 75, 80, 85, or 90 years old.
[0596] In some embodiments, the individual has at least one prior therapy. In some embodiments, the prior therapy comprises a radiation therapy, a chemotherapy and/or an immunotherapy. In some embodiments, the individual is resistant, refractory, or recurrent to the prior therapy.
C. Combination Therapy
[0597] The present application also provides methods administering an effective amount of an anti-PLA2G2D construct into an individual for treating a disease or condition (such as cancer or infectious disease), wherein the method further comprises administering a second agent or therapy. In some embodiments, the second agent or therapy is a standard or commonly used agent or therapy for treating the disease or condition.
[0598] In some embodiments, the anti-PLA2G2D construct is administered simultaneously with the second agent or therapy. In some embodiments, the anti-PLA2G2D construct is administered concurrently with the second agent or therapy. In some embodiments, the anti-PLA2G2D construct is administered sequentially with the second agent or therapy.
Exemplary Combination Therapies for Cancer
[0599] In some embodiments, the second agent or therapy comprises a chemotherapeutic agent. In some embodiments, the second agent or therapy comprises a surgery. In some embodiments, the second agent or therapy comprises a radiation therapy. In some embodiments, the second agent or therapy comprises an immunotherapy. In some embodiments, the second agent or therapy comprises a cell therapy (such as a cell therapy comprising an immune cell (e.g., CAR T cell)). In some embodiments, the second agent or therapy comprises an angiogenesis inhibitor.
[0600] In some embodiments, the second agent is selected from the group consisting of a chemotherapeutic agent, an immunomodulator, an anti-angiogenesis agent, a growth inhibitory agent, and an antineoplastic agent.
[0601] In some embodiments, the second agent is a chemotherapeutic agent. In some embodiments, the second agent is antimetabolite agent. In some embodiments, the antimetabolite agent is 5-FU.
[0602] In some embodiments, the second agent is an immunomodulator. In some embodiments, the immunomodulatory is an immune checkpoint inhibitor. In some embodiments, the checkpoint inhibitor specifically targets PD-L1, PD-L2, CTLA4, PD-L2, PD-1, CD47, TIGIT, GITR, TIM3, LAG3, CD27, 4-1BB, or B7H4. In some embodiments, the second agent is an anti-PD-1 antibody or fragment thereof. In some embodiments, the second agent is an anti-PD-L1 antibody or fragment thereof.
[0603] In some embodiments, the second agent comprises a cell (such as an immune cell, such as a T cell) comprising a chimeric antigen receptor that specifically binds to a tumor antigen.
Exemplary Combination Therapies for Infectious Disease (Such as Viral Infectious Disease).
[0604] In some embodiments, the second agent or therapy comprises a nucleotide analogue.
[0605] In some embodiments, the second agent or therapy comprises a nucleoside analogue.
[0606] In some embodiments, the second agent or therapy comprises a protease inhibitor. In some embodiments, the second agent or therapy comprises Lopinavir. In some embodiments, the second agent or therapy comprises ritonavir.
[0607] In some embodiments, the second agent or therapy comprises a neuraminidase inhibitor. In some embodiments, the second agent or therapy comprises zanamivir. In some embodiments, the second agent or therapy comprises oseltamivir. In some embodiments, the second agent or therapy comprises peramivir.
[0608] In some embodiments, the second agent or therapy comprises a Cap-dependent endonuclease inhibitor. In some embodiments, the second agent or therapy comprises baloxavir.
[0609] In some embodiments, the second agent or therapy comprises a sialidase.
[0610] The second agent and the anti-PLA2G2D construct can be administered sequentially, concurrently, or simultaneously. In some embodiments, the second agent is administered prior to the anti-PLA2G2D construct. In some embodiments, the second agent is administered after the anti-PLA2G2D construct.
D. Dosing Regimen and Routes of Administration
[0611] The dose of the anti-PLA2G2D construct and, in some embodiments, the second agent as described herein, administered to an individual (such as a human) may vary with the particular composition, the method of administration, and the particular kind and stage of disease or condition being treated. The amount should be sufficient to produce a desirable response, such as a therapeutic response against the disease or condition. In some embodiments, the amount of the anti-PLA2G2D construct and/or the second agent is a therapeutically effective amount.
[0612] In some embodiments, the amount of the anti-PLA2G2D construct is an amount sufficient to decrease the suppression of the immune response in the individual. Whether there is a decrease in the suppression of the immune response and the extent of the decrease in suppression can be indicated by any of the following.
[0613] In some embodiments, the amount of the anti-PLA2G2D construct is an amount sufficient to increase the number of immune cells (such as T cells, such as CD4+ and/or CD8+ T cells) by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% post administration of the anti-PLA2G2D construct. In some embodiments, the immune cells in circulation are assessed. In some embodiments, the immune cells in diseased tissue are assessed. In some embodiments, the immune cells in lymph tissue (such as lymph node) are assessed. In some embodiments, the immune cells comprises myeloid cells (such as dendritic cells). In some embodiments, the immune cells comprises NK cells. In some embodiments, the immune cells comprises T cells, such as CD4+ and/or CD8+ T cells. In some embodiments, the number of immune cells is assessed about 1, 2, 3, 4, 5, 6, or 7 days post administration of the anti-PLA2G2D construct.
[0614] In some embodiments, the amount of the anti-PLA2G2D construct is an amount sufficient to increase the number of activated immune cells (such as activated CD4+ and/or CD8+ T cells) by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% post administration of the anti-PLA2G2D construct. In some embodiments, the activated immune cells in circulation are assessed. In some embodiments, the activated immune cells in diseased tissue are assessed. In some embodiments, the activated immune cells in lymph tissue (such as lymph node) are assessed. In some embodiments, the immune cells comprises myeloid cells (such as dendritic cells). In some embodiments, the immune cells comprises NK cells. In some embodiments, the immune cells comprises T cells, such as CD4+ and/or CD8+ T cells. In some embodiments, the number of activated immune cells is assessed about 1, 2, 3, 4, 5, 6, or 7 days post administration of the anti-PLA2G2D construct.
[0615] In some embodiments, the amount of the anti-PLA2G2D construct is an amount sufficient to increase the proliferation of immune cells or activated immune cells by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% post administration of the anti-PLA2G2D construct. In some embodiments, the immune cells or the activated immune cells in circulation are assessed. In some embodiments, the immune cells or the activated immune cells in diseased tissue are assessed. In some embodiments, the immune cells or the activated immune cells in lymph tissue (such as lymph node) are assessed. In some embodiments, the immune cells comprises myeloid cells (such as dendritic cells). In some embodiments, the immune cells comprises NK cells. In some embodiments, the immune cells comprises T cells, such as CD4+ and/or CD8+ T cells. In some embodiments, the proliferation of immune cells or activated immune cells is assessed about 1, 2, 3, 4, 5, 6, or 7 days post administration of the anti-PLA2G2D construct.
[0616] In some embodiments, the amount of the anti-PLA2G2D construct is an amount sufficient to increase the cytokine level (such as a pro-inflammatory cytokine, such as IFN? or IL-2) by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% post administration of the anti-PLA2G2D construct. In some embodiments, the cytokine level in diseased tissue is assessed. In some embodiments, the level of cytokine is assessed about 1, 2, 3, 4, 5, 6, or 7 days post administration of the anti-PLA2G2D construct.
[0617] In some embodiments, the amount of the anti-PLA2G2D construct is an amount sufficient to decrease the suppressive immune cells by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% post administration. In some embodiments, the suppressive immune cells comprise regulatory T cells. In some embodiments, the suppressive immune cells comprise myeloid derived suppressor cells. In some embodiments, the suppressive immune cells in circulation are assessed. In some embodiments, the suppressive immune cells in diseased tissue are assessed. In some embodiments, the suppressive immune cells in lymph tissue (such as lymph node) are assessed. In some embodiments, the number of suppressive immune cells is assessed about 1, 2, 3, 4, 5, 6, or 7 days post administration of the anti-PLA2G2D construct.
[0618] In some embodiments, the amount of the anti-PLA2G2D construct is an amount sufficient to increase humoral immune response in the individual by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% post administration of the anti-PLA2G2D construct. The humoral immune response can be assessed by measuring antibodies (such as IgG antibodies) that target a disease-associated antigen or plasmablasts that produce such antibodies in circulation. In some embodiments, the humoral immune response is assessed about 7-28 days (such as about 7-14 days) post administration of the anti-PLA2G2D construct.
[0619] In some embodiments, the amount of the anti-PLA2G2D construct is an amount sufficient to produce a decrease of the size of a tumor, decrease the number of cancer cells, or decrease the growth rate of a tumor by at least about any of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 100% compared to the corresponding tumor size, number of cancer cells, or tumor growth rate in the same individual prior to treatment or compared to the corresponding activity in other individuals not receiving the treatment.
[0620] In some embodiments, the anti-PLA2G2D construct is administered at a dose of about 0.001 ?g/kg to about 100 mg/kg of total body weight, for example, about 0.005 ?g/kg to about 50 mg/kg, about 0.01 ?g/kg to about 10 mg/kg, or about 0.01 ?g/kg to about 1 mg/kg.
[0621] In some embodiments according to any one of the methods described herein, the anti-PLA2G2D construct and/or the second agent composition is administered intravenously, intraarterially, intraperitoneally, intravesicularly, subcutaneously, intrathecally, intrapulmonarily, intramuscularly, intratracheally, intraocularly, topically, transdermally, orally, or by inhalation. In some embodiments, the anti-PLA2G2D construct and/or the second agent is administered intravenously.
[0622] In some embodiments, the anti-PLA2G2D construct is administered directly to the diseased tissue.
V. Compositions, Kits and Articles of Manufacture
[0623] Also provided herein are compositions (such as formulations) comprising any one of the anti-PLA2G2D construct or anti-PLA2G2D antibody moiety described herein, nucleic acid encoding the antibody moieties, vector comprising the nucleic acid encoding the antibody moieties, or host cells comprising the nucleic acid or vector.
[0624] Suitable formulations of the anti-PLA2G2D construct described herein can be obtained by mixing the anti-PLA2G2D construct or anti-PLA2G2D antibody moiety having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions. Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propylparaben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as olyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as TWEEN?, PLURONICS? or polyethylene glycol (PEG). Lyophilized formulations adapted for subcutaneous administration are described in WO97/04801. Such lyophilized formulations may be reconstituted with a suitable diluent to a high protein concentration and the reconstituted formulation may be administered subcutaneously to the individual to be imaged, diagnosed, or treated herein.
[0625] The formulations to be used for in vivo administration must be sterile. This is readily accomplished by, e.g., filtration through sterile filtration membranes.
[0626] Also provided are kits comprising any one of the anti-PLA2G2D construct or anti-PLA2G2D antibody moiety described herein. The kits may be useful for any of the methods of modulating cell composition or treatment described herein.
[0627] In some embodiments, there is provided a kit comprising an anti-PLA2G2D construct specifically binding to PLA2G2D.
[0628] In some embodiments, the kit further comprises a device capable of delivering the anti-PLA2G2D construct into an individual. One type of device, for applications such as parenteral delivery, is a syringe that is used to inject the composition into the body of a subject. Inhalation devices may also be used for certain applications.
[0629] In some embodiments, the kit further comprises a therapeutic agent for treating a disease or condition, e.g., cancer, infectious disease, autoimmune disease, or transplantation.
[0630] The kits of the present application are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like. Kits may optionally provide additional components such as buffers and interpretative information.
[0631] The present application thus also provides articles of manufacture. The article of manufacture can comprise a container and a label or package insert on or associated with the container. Suitable containers include vials (such as sealed vials), bottles, jars, flexible packaging, and the like. Generally, the container holds a composition, and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). The label or package insert indicates that the composition is used for imaging, diagnosing, or treating a particular condition in an individual. The label or package insert will further comprise instructions for administering the composition to the individual and for imaging the individual. The label may indicate directions for reconstitution and/or use. The container holding the composition may be a multi-use vial, which allows for repeat administrations (e.g. from 2-6 administrations) of the reconstituted formulation. Package insert refers to instructions customarily included in commercial packages of diagnostic products that contain information about the indications, usage, dosage, administration, contraindications and/or warnings concerning the use of such diagnostic products. Additionally, the article of manufacture may further comprise a second container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
[0632] The kits or article of manufacture may include multiple unit doses of the compositions and instructions for use, packaged in quantities sufficient for storage and use in pharmacies, for example, hospital pharmacies and compounding pharmacies.
[0633] Those skilled in the art will recognize that several embodiments are possible within the scope and spirit of this invention. The invention will now be described in greater detail by reference to the following non-limiting examples. The following examples further illustrate the invention but, of course, should not be construed as in any way limiting its scope.
EXAMPLES
[0634] The examples below are intended to be purely exemplary of the application and should therefore not be considered to limit the application in any way. The following examples and detailed description are offered by way of illustration and not by way of limitation.
Example 1. Generation of Anti-PLA2G2D Antibodies
Hybridoma Generation
[0635] To generate antibodies against PLA2G2D, Balb/c mice or NZB/W mice, PLA2G2D KO mice, or Lewis Rats were immunized with either recombinant human or mouse PLA2G2D Fc-tagged proteins or HEK293T cells ectopically expressing human PLA2G2D on the cell surface (PLA2G2D-TM, in which human PLA2G2D is fused on the C-terminus with the transmembrane region of meprin A beta subunit). Mice were immunized at multiple sites using Freund's complete adjuvant (CFA) or RIBI adjuvant for multiple boosts. Test bleeds were done by saphenous vein lancing seven days after the last boost. When antibody titer was high enough, mice were given a final IV boost via lateral tail vein. Four days after the final boost, immunized animals were sacrificed and spleens isolated. Hybridomas were generated by electrofusion of splenocytes with Sp2/0 myeloma cells. Fused cells were plated into 96-well plates in HAT selective medium and grown for 10-14 days to generate hybridoma clones.
Enzyme-Linked Immunosorbent Assays (ELISA)
[0636] Hybridoma clones were assayed for binding to human PLA2G2D protein by ELISA. 96-well hi-binding plates were coated with recombinant human or mouse PLA2G2D protein in PBS and incubated overnight at 4? C. Wells were washed twice in PBS containing 0.5% Tween-20 (PBST) and blocked with PBST containing 0.5% FCS for one hour at room temperature. After washing, supernatant was added and incubated for 1 hour at room temperature. Supernatants were then removed and wells washed three times with PBST, followed by addition of horseradish peroxidase-conjugated goat anti-mouse IgG or goat anti-rat IgG antibodies (Jackson Immuno) at an optimized dilution in PBST containing 0.5% FBS for one hour. Wells were washed three times with PBST, developed with 50 ?l ABTS substrate (Sigma Aldrich) for 15-30 minutes at room temperature and read at 405 nm. Parental hybridomas reactive to PLA2G2D were subcloned by limiting dilution and their binding to PLA2G2D reconfirmed by ELISA. Positive binders were expanded and antibodies in the supernatants were purified by protein G (HiTrap Protein G HP, GE Healthcare).
Flow Cytometry
[0637] Supernatants from ELISA-positive clones or purified antibodies were further tested for their ability to bind to human and mouse PLA2G2D expressed on the cell surface of HEK-293T cells (PLA2G2D-TM fusion protein as described above) by flow cytometry. PLA2G2D-TM expressing 293T cells were harvested and 1?10.sup.5 cells per well plated in 96-well U-bottom plates and the supernatant removed. 50 ?l of hybridoma supernatant or purified antibody at the specified dilution or concentration was added to each well and incubated at 4? C. for 30 minutes. Assay plates were washed 2 times with PBS and antibody binding detected using a PE-labeled goat anti-mouse or anti-rat antibody (Biolegend) at 1:400 dilution in PBS for 30 minutes at 4? C. Plates were washed 2 times and analyzed on a BD LSRFortessa X-20 flow cytometer (Becton Dickinson).
[0638] All antibodies harboring sequences shown in Tables 3-5As were capable of binding to human PLA2G2D.
Sequence Analysis
[0639] Sequence data from all constructs were analyzed and consensus sequences for heavy and light chain were determined. See Tables 3-5 that list V.sub.H, V.sub.L, and CDRs sequences of the various anti-PLA2G2D antibodies and consensus sequences.
TABLE-US-00003 TABLE3 VHCDRsofvariousantibodiesandconsensussequences. CDRH1 CDRH2 CDRH3 GroupA 44.110G5.B6 TSGLGVS HIYWDDDKRYNPSLKS RRSLYFYFDV (SEQIDNO:131) (SEQIDNO:132) (SEQIDNO:133) 44.20H2.A8 TSGMAVS HIYWDDDKRYNPSLKS REGDWYFDV (SEQIDNO:139) (SEQIDNO:132) (SEQIDNO:140) 44.14G5.F1 TSGMCVS HIYWDDDKRYNPSLKS KGRDYGFDY (SEQIDNO:150) (SEQIDNO:132) (SEQIDNO:151) 44.25D8.D4 TSGMAVS HIYWDDDKRYNPSLKS RGPGTWYFDV (SEQIDNO:139) (SEQIDNO:132) (SEQIDNO:145) 44.7A3.E10 TSGMGVA HIYWDDDKRYNPSLKS RGPGTWYFDV (SEQIDNO:157) (SEQIDNO:132) (SEQIDNO:145) 44.19A6.A10 TSGMGVG HIYWDDDKRYNPSLKS RGPGTWYFDV (SEQIDNO:160) (SEQIDNO:132) (SEQIDNO:145) 44.7A10.A5 TSGMGVS HIYWDDDKRYNPSLKS PAYYSNHLFAY (SEQIDNO:161) (SEQIDNO:132) (SEQIDNO:162) 44.7F10.F2 TSGMGVS HIYWDDDKRYNPSLKS RAVKDWYFDV (SEQIDNO:161) (SEQIDNO:132) (SEQIDNO:165) 44.8A6.A9 TSGMGVS HIYWDDDKRYNPSLKS RASGDYSNFGFA (SEQIDNO:161) (SEQIDNO:132) Y (SEQIDNO:170) 44.16H2.A4 TSGMGVS HIYWDDDKRYNPSLKS RYGSLYFDY (SEQIDNO:161) (SEQIDNO:132) (SEQIDNO:174) 44.94G5.A2 TSGMGVS HIYWDDDKRYNPSLKS RPEAPYYDYDGF (SEQIDNO:161) (SEQIDNO:132) AY (SEQIDNO:188) 44.18G6.F2. TSGMGVS HIYWDDDKRYNPSLKS KHSDYWFAY C8 (SEQIDNO:161) (SEQIDNO:132) (SEQIDNO:178) 44.91D9.C9 TSGMGVS HIYWDDDKRYNPSLKS KHSDYWFAY (SEQIDNO:161) (SEQIDNO:132) (SEQIDNO:178) 44.96D4.C4 TSGMGVS HIYWDDDKRYNPSLKS RESKYFYFDY (SEQIDNO:161) (SEQIDNO:132) (SEQIDNO:192) 44.100H6.E1. TSGMGVS HIYWDDDKRYNPSLKS RESKYFYFDY C3 (SEQIDNO:161) (SEQIDNO:132) (SEQIDNO:192) 44.101H5.B4 TSGMGVS HIYWDDDKRYNPSLKS RESRYFYFDY (SEQIDNO:161) (SEQIDNO:132) (SEQIDNO:203) 44.25E8.E6. TSGMGVS HIYWDDDKRYNPSLKS RASVEFYFDY D1 (SEQIDNO:161) (SEQIDNO:132) (SEQIDNO:185) 44.102H3. TSGMGVS HIYWDDDKRYNPSLKS RASVDFYFDY E12 (SEQIDNO:161) (SEQIDNO:132) (SEQIDNO:206) 44.99G5.A10 TSGMGVS HIYWDNDKRYNPSLKS RASLKFFFDY (SEQIDNO:161) (SEQIDNO:195) (SEQIDNO:196) 44.111C11.F7 TSGMGVS HIYWDDDKRYNPSLKS PAFYSNHLFAY (SEQIDNO:161) (SEQIDNO:132) (SEQIDNO:211) 47.17B2 TSPLGVS HIYWDDDKRYNPSLQN RDGSNFYFDY (SEQIDNO:214) (SEQIDNO:215) (SEQIDNO:216) 44.92F6.C9 TSPMGVS HIYWDDDKRYNPSLKS RRGDSFYFDY (SEQIDNO:222) (SEQIDNO:132) (SEQIDNO:223) 47.17G1.E12 TSRMGVS HIYWDDDKRYNPSLKS RALYDYGADFYF (SEQIDNO:227) (SEQIDNO:132) DV (SEQIDNO:228) 47.25C3.C5 TSRMGVS HIYWDDDKRYDPSLKS RALSDYGSDFYF (SEQIDNO:227) (SEQIDNO:231) DV (SEQIDNO:232) 44.19B8.H11 TSSMGVS HIYWDDDKRYNPSLKS RAGNFFYFDV (SEQIDNO:237) (SEQIDNO:132) (SEQIDNO:238) 44.91D1.E4 TSTMGVS HIYWDDDKRYNPSLKS RRVYDFDFDY (SEQIDNO:241) (SEQIDNO:132) (SEQIDNO:242) 47.62F9.G1 TSGMGVS HIYWDDDNRYNASLKS RTPFDFGFDY (SEQIDNO:161) (SEQIDNO:261) (SEQIDNO:262) 47.34G6.H6 TSGMGVS HIYWDDANRYNPSLES RSGDWYFDV (SEQIDNO:161) (SEQIDNO:267) (SEQIDNO:268) GroupA TSX.sub.1X.sub.2X.sub.3VX.sub.4 HIYWDX.sub.1X.sub.2X.sub.3RYX.sub.4X.sub.5SLX.sub.6 SEQIDNO:133, consensus X.sub.1X.sub.2X.sub.3=GLG, X.sub.7 140,145,151,162, sequence GMA,GMC, X.sub.1X.sub.2X.sub.3=DDK,NDK,DDN, 165,170,174,178, GMG,PLG,PMG, orDAN;X.sub.4X.sub.5=NP,DP,or 185,188,192,196, RMG,TMG,or NA;X.sub.6X.sub.7=KS,QN,orES. 203,206,216,223, SMG,X.sub.4=A,G, (SEQIDNO:280) 228,232,238,242, orS 262,or268 (SEQIDNO:279) GroupB 48.73A4.B6 NYWMT SITDTGGITYYPDSVKG RDLPGYQWDY (SEQIDNO:45) (SEQIDNO:46) (SEQIDNO:47) 48.9C4.E4 DYNMA SISTGGDNTYCRDSVKG HDTIRVDA (SEQIDNO:17) (SEQIDNO:18) (SEQIDNO:19) 48.55A7.A10 DYNMA SISTGGANTYCRDSVKG HDTIRVDA (SEQIDNO:17) (SEQIDNO:278) (SEQIDNO:19) 48.4B12.F8 NNGVS AISSGGSTYYNSDLKS VGDDRFDY (SEQIDNO:25) (SEQIDNO:26) (SEQIDNO:27) 48.33E9.B12 SKGVS AISSSGSTYYDSPLKS VGDDRFDY (SEQIDNO:77) (SEQIDNO:78) (SEQIDNO:27) 48.34F9.E10. SNGVT AISSGGTTYYDSALKS VGGDRFDY C5 (SEQIDNO:82) (SEQIDNO:83) (SEQIDNO:84) 48.60E11.A7 TNGVS AISSGGSTYYNSALKT AGGNRFAY (SEQIDNO:124) (SEQIDNO:125) (SEQIDNO:126) GroupB X.sub.1X.sub.2GVX.sub.3 SIX.sub.1X.sub.2X.sub.3GGX.sub.4X.sub.5TYX.sub.6X.sub.7DS X.sub.1GX.sub.2X.sub.3RFX.sub.4Y consensus X.sub.1X.sub.2=NN,SK, VKG X.sub.1=AorV,X.sub.2X.sub.3= sequence SN,orTN;X.sub.3=S X.sub.1X.sub.2X.sub.3=TDT,SA,orST, DD,GD,orGN, orT X.sub.4X.sub.5=I,DD,DN,orAN, X.sub.4=DorA. (SEQIDNO:284) X.sub.6X.sub.7=YP,YR,orCR. (SEQIDNO:288) Or (SEQIDNO:286) OrSEQIDNO:47, X.sub.1YX.sub.2MX.sub.3 Or or19 X.sub.1=NorD,X.sub.2= AISSX.sub.1GX.sub.2TYYX.sub.3SX.sub.4LKX.sub.5 W,V,orN,X.sub.3= X.sub.1=SorG, T,V,orA X.sub.2=SorT, (SEQIDNO:285) X.sub.3=NorD, X.sub.4=D,P,orA, X.sub.5=SorT (SEQIDNO:287) GroupC 48.15C1.A6 SYDMH VIWSNGNTHYNSTLKS YPFAY (SEQIDNO:89) (SEQIDNO:90) (SEQIDNO:91) 48.29H4.A5 SYDMQ AIWANGNIQYNSILKS FRFDY (SEQIDNO:97) (SEQIDNO:98) (SEQIDNO:99) 48.51A2.B12 TYAMGVG NIWWDDDKFYNPSLKN LGVRWSHYFDY (SEQIDNO:245) (SEQIDNO:246) (SEQIDNO:247) 48.26G10.A9 TYAMH YIGPGSGSTWYNENFKG GGYSGDDWFAY (SEQIDNO:253) (SEQIDNO:254) (SEQIDNO:255) GroupC-1 SYDMX.sub.1 X.sub.1IWX.sub.2NGNX.sub.3X.sub.4YNSX.sub.5LK X.sub.1X.sub.2FX.sub.3Y consensus X.sub.1=HorQ S X.sub.1X.sub.2=YPorFR, sequence (SEQIDNO:291) X.sub.1=VorA,X.sub.2=SorA,X.sub.3 X.sub.3=AorD. X.sub.4=THorIQ,X.sub.5=TorI. (SEQIDNO:293) (SEQIDNO:292) GroupC-2 TYAMX.sub.1X.sub.2X.sub.3 SEQIDNO:246or254 SEQIDNO:247or consensus X.sub.1X.sub.2X.sub.3=GVGor 255 sequence H (SEQIDNO:294) GroupD 44.93D1.E7 DYDMH AIDPETGGTTYNQKFKG LAWFAY (SEQIDNO:9) (SEQIDNO:10) (SEQIDNO:11) 44.64E1.B12 SGYYWN YISYDGSNNYNPSLKS WGYYDSRIDY (SEQIDNO:67) (SEQIDNO:68) (SEQIDNO:69) 44.18E2.G12 SGYYWN YISYDGSKNYNPSLKS WGYYDSRIDY (SEQIDNO:67) (SEQIDNO:274) (SEQIDNO:69) 44.66C9.H2 SGYYWN YISYDGSNNYNPSLKS WGYYDSRIDY (SEQIDNO:67) (SEQIDNO:68) (SEQIDNO:69) GroupE 34.58E8.E10. DSLMH WIDPEDGETKYAPKFQD GTGTDY E7 (SEQIDNO:1) (SEQIDNO:2) (SEQIDNO:3) 48.7C11.D10. NYYMA SISTGGGITYFRDSVKG HDYGGSYWYFD D2 (SEQIDNO:51) (SEQIDNO:52) F (SEQIDNO:53) 44.11E7.E11 TFGMGVG HIWWDDDKYYNPALKS DIGNYFDY (SEQIDNO:116) (SEQIDNO:117) (SEQIDNO:118) GroupF 44.91E11.H9 RYWMH RIHPSDSDTNYNQKFKD NWDGAWFNY (SEQIDNO:59) (SEQIDNO:60) (SEQIDNO:61) 48.25B3.A6 SYHVH VMWSDGDTSHKSALKS DSSTEGIPFDY (SEQIDNO:108) (SEQIDNO:109) (SEQIDNO:110) GroupG 44.64E1.B12 SGYYWN YISYDGSNNYNPSLKS WGYYDSRIDY (SEQIDNO:67) (SEQIDNO:68) (SEQIDNO:69) 44.18E2.G12 SGYYWN YISYDGSKNYNPSLKS WGYYDSRIDY (SEQIDNO:67) (SEQIDNO:274) (SEQIDNO:69) GroupG SGYYWN YISYDGSX.sub.1NYNPSLKS WGYYDSRIDY consensus (SEQIDNO:67) X.sub.1=KorN (SEQIDNO:69) sequence (SEQIDNO:304) GroupH 48.74C11.G4 NYVMV SISAGGDDTYYRDSVKG DMGNSGSYCFDY (SEQIDNO:37) (SEQIDNO:38) (SEQIDNO:39) 48.29H4.A5 SYDMQ AIWANGNIQYNSILKS FRFDY (SEQIDNO:97) (SEQIDNO:98) (SEQIDNO:99) 48.7C11.D10. NYYMA SISTGGGITYFRDSVKG HDYGGSYWYFD D2 (SEQIDNO:51) (SEQIDNO:52) F (SEQIDNO:53) GroupH NYX.sub.1MX.sub.2 SISX.sub.1GGX.sub.2X.sub.3TYX.sub.4RDSVK SEQIDNO:39,99, consensus X.sub.1=VorY, G or53 sequence X.sub.2=VorA X.sub.1=AorT,X.sub.2X.sub.3=DDor (SEQIDNO:306) GI,X.sub.4=YorF. OrSEQIDNO:97 (SEQIDNO:307) OrSEQIDNO:98
TABLE-US-00004 TABLE4 VLCDRsofvariousantibodiesandconsensussequences. CDRL1 CDRL2 CDRL3 GroupA 44.110G5.B6 SAISSVSYMY RTSNLAS QQYHSYPPT (SEQIDNO:134) (SEQIDNO:135) (SEQIDNO:136) 44.20H2.A8 SASSRISYMY RTSNLAS QQYHTSPLT (SEQIDNO:141) (SEQIDNO:135) (SEQIDNO:142) 44.14G5.F1 SASSSVSYMY RTSNLAS QQYHSYPPT (SEQIDNO:152) (SEQIDNO:135) (SEQIDNO:136) 44.25D8.D4 SASSSVVYMY RTSNLAS QQYHSSPLT (SEQIDNO:146) (SEQIDNO:135) (SEQIDNO:147) 44.7A3.E10 SASSSVSYMY RTSNLAS QQYHSSPLT (SEQIDNO:152) (SEQIDNO:135) (SEQIDNO:147) 44.19A6.A10 SASSSVSYMY RTSNLAS QQYHSSPLT (SEQIDNO:152) (SEQIDNO:135) (SEQIDNO:147) 44.7A10.A5 SASSSVSYMY RTSNLAS QQYHSSPLT (SEQIDNO:152) (SEQIDNO:135) (SEQIDNO:147) 44.7F10.F2 SASSSVSYMY RTSNLAS QQYHSYPPT (SEQIDNO:152) (SEQIDNO:135) (SEQIDNO:136) 44.8A6.A9 SASSSVSYMY RTSILAS QQYHSYPPT (SEQIDNO:152) (SEQIDNO:171) (SEQIDNO:136) 44.16H2.A4 SASSSVSYMY RTSNLAS QQYHTYPPM (SEQIDNO:152) (SEQIDNO:135) (SEQIDNO:175) 44.94G5.A2 SASSSVSYMY RTSNLAS QQYHTYPPT (SEQIDNO:152) (SEQIDNO:135) (SEQIDNO:189) 44.18G6.F2. SASSRVRYIY RTSNLAS QQYHTYPLT C8 (SEQIDNO:181) (SEQIDNO:135) (SEQIDNO:182) 44.91D9.C9 SASSSVSYMY RTSNLAS QQYHSSPLT (SEQIDNO:152) (SEQIDNO:135) (SEQIDNO:147) 44.96D4.C4 SASSSVSYMY RTSNLAS QQYHSYPPT (SEQIDNO:152) (SEQIDNO:135) (SEQIDNO:136) 44.100H6. SASSSVSYMY DTSKLAS QQYHSYPPT E1.C3 (SEQIDNO:152) (SEQIDNO:200) (SEQIDNO:136) 44.101H5.B4 SASSSVSYMY RTSNLAS QQYHSYPPT (SEQIDNO:152) (SEQIDNO:135) (SEQIDNO:136) 44.25E8.E6. SASSSVSYMY RTSNLAS QQYHSYPPT D1 (SEQIDNO:152) (SEQIDNO:135) (SEQIDNO:136) 44.102H3.E1 SAGSSVSFMY RTSNLAS QHYHSYPPT 2 (SEQIDNO:207) (SEQIDNO:135) (SEQIDNO:208) 44.99G5.A10 SATSTISYMY RTSNLAS QQYHSYPPT (SEQIDNO:197) (SEQIDNO:135) (SEQIDNO:136) 44.111C11. SASSSVSYMY RTSNLAS QQYHSSPLT F7 (SEQIDNO:152) (SEQIDNO:135) (SEQIDNO:147) 47.17B2 SASSTVRYIY RTSNLAF QQYHSFPLT (SEQIDNO:217) (SEQIDNO:218) (SEQIDNO:219) 44.92F6.C9 SASSSVSYMY RTSNLAS QQYHSYPLT (SEQIDNO:152) (SEQIDNO:135) (SEQIDNO:224) 47.17G1.E12 SASSSVSYMY RTSNLAS QQYHTYPLT (SEQIDNO:152) (SEQIDNO:135) (SEQIDNO:182) 47.25C3.C5 SASSIVSYMY RTSTLAS QQYHTYPLT (SEQIDNO:233) (SEQIDNO:234) (SEQIDNO:182) 44.19B8.H11 SASSSVSYMY RTSNLAS QQYHTYPPT (SEQIDNO:152) (SEQIDNO:135) (SEQIDNO:189) 44.91D1.E4 SASSSVSYMY RTSNLAS QQYHSYPPT (SEQIDNO:152) (SEQIDNO:135) (SEQIDNO:136) 47.62F9.G1 SASSRVSYMY RTSNLAS QQYHTFPLT (SEQIDNO:263) (SEQIDNO:135) (SEQIDNO:264) 47.34G6.H6 SASSIVRYIY RTFNLAS QQYHTYPLT (SEQIDNO:269) (SEQIDNO:270) (SEQIDNO:182) GroupA SAX.sub.1SX.sub.2X.sub.3X.sub.4YX.sub.5 X.sub.1TX.sub.2X.sub.3LAX.sub.4 QX.sub.1YHX.sub.2X.sub.3PX.sub.4X.sub.5 Consensus Y X.sub.1=RorD, X.sub.1=QorH,X.sub.2X.sub.3= sequence X.sub.1=I,S,T,orG, X.sub.2X.sub.3=SN,SI, SY,TS,SS,TY,SF, X.sub.2X.sub.3X.sub.4=SVS,RIS, SK,ST,orFN, orTF,X.sub.4X.sub.5=PT,LT, SVV,RVR,TIS, X.sub.4=SorF. orPM TVR,IVS,RVS,or (SEQIDNO:282) (SEQIDNO:283) IVR,X.sub.5=MorI. (SEQIDNO:281) GroupB 48.73A4.B6 SGDELSNKYAL KDSERPS LSTYSDDDLPV (SEQIDNO:48) (SEQIDNO:21) (SEQIDNO:22) 48.9C4.E4 SGDELSNKYAH KDSERPS LSTYSDDDLPV (SEQIDNO:20) (SEQIDNO:21) (SEQIDNO:22) 48.55A7.A10 SGDELSNKYAH KDSERPS LSTYSDDDLPV (SEQIDNO:20) (SEQIDNO:21) (SEQIDNO:22) 48.4B12.F8 SGDELSNKYVH KDSERPS LSTYCDDDLPV (SEQIDNO:28) (SEQIDNO:21) (SEQIDNO:29) 48.33E9.B12 SGDELSNKYVH KDSERPS LSTFNDDDLPV (SEQIDNO:28) (SEQIDNO:21) (SEQIDNO:79) 48.34F9.E10. SGDELSRKYVH KDSERPS LSTYGVDDLPV C5 (SEQIDNO:85) (SEQIDNO:21) (SEQIDNO:86) 48.60E11.A7 SGDELSNKYTH KDSERPS LSSYTDDDILV (SEQIDNO:127) (SEQIDNO:21) (SEQIDNO:128) GroupB SGDELSX.sub.1KYX.sub.2X.sub.3 KDSERPS LSX.sub.1X.sub.2X.sub.3X.sub.4DDX.sub.5X.sub.6 consensus a)X.sub.1=NorR,and (SEQIDNO:21) V sequence b1)X.sub.2=A,V,orT, X.sub.1X.sub.2X.sub.3X.sub.4=TYSD, andX.sub.3=HorL,or TFND,TYGV, b2)X.sub.2X.sub.3=AL,VH, TYSD,TYCD,or AH,orTH. SYTD,X.sub.5X.sub.6=LPor (SEQIDNO:289) IL (SEQIDNO:290) GroupC 48.15C1.A6 RASQDIGDYLR GATNLAN LQHKEYFPT (SEQIDNO:92) (SEQIDNO:93) (SEQIDNO:94) 48.29H4.A5 RASQDIGNYLR GATNLAN LQHNEYPLT (LC2) (SEQIDNO:105) (SEQIDNO:93) (SEQIDNO:106) 48.51A2.B12 RASQDIGNFLS GATNLED LQYEKYFT (SEQIDNO:248) (SEQIDNO:249) (SEQIDNO:250) 48.26G10.A9 QASQDIGNNLI YATNLAN LQYKQSPLT (SEQIDNO:256) (SEQIDNO:257) (SEQIDNO:258) GroupC X.sub.1ASQDIGX.sub.2X.sub.3L X.sub.1ATNLX.sub.2X.sub.3 SEQIDNO:250,258, consensus X.sub.4 X.sub.1=GorY, 94,or106 sequence X.sub.1=RorQ,X.sub.2X.sub.3= X.sub.2X.sub.3=EDorAN NF,NN,DY,orNY, (SEQIDNO:296) X.sub.4=S,I,orR. (SEQIDNO:295) GroupD 44.93D1.E7 ITSTDIDDDMN EGNTLRP LQSDNLPLT (SEQIDNO:12) (SEQIDNO:13) (SEQIDNO:14) 44.66C9.H2 ITSTDIDDDMN EGNTLRP LQSDNLPFT (SEQIDNO:12) (SEQIDNO:13) (SEQIDNO:273) 44.64E1.B12 ITSTDIDDDMN EGNTLRP LQSDNLPFT (SEQIDNO:12) (SEQIDNO:13) (SEQIDNO:273) 44.18E2.G12 ITSTDIDDDMN EGNTFRP LQSDNLPFT (SEQIDNO:12) (SEQIDNO:275) (SEQIDNO:273) GroupD ITSTDIDDDMN EGNTX.sub.1RP LQSDNLPXIT consensus (SEQIDNO:12) X.sub.1=LorF X.sub.1=LorF sequence (SEQIDNO:297) (SEQIDNO:298) GroupE 34.58E8.E10. KSSQSLLNSSNQK FASTRES QQHYSTPWT E7 NYLA (SEQIDNO:5) (SEQIDNO:6) (SEQIDNO:4) 48.7C11.D10. KSSQSLLYNENK WASSRES QQYYNFPYT D2 KNYLA (SEQIDNO:55) (SEQIDNO:56) (SEQIDNO:54) 44.11E7.E11 KSSQSVLYSSNQR WASTRES HQYLSSYT NYLA (SEQIDNO:120) (SEQIDNO:121) (SEQIDNO:119) GroupE KSSQSX.sub.1LX.sub.2X.sub.3X.sub.4 X.sub.1ASX.sub.2RES SEQIDNO:6,56,or Consensus NX.sub.5X.sub.6NYLA X.sub.1=ForW, 121 sequence X.sub.1=LorV,X.sub.2X.sub.3X.sub.4 X.sub.2=TorS. =NSS,YNE,or (SEQIDNO:300) YSS,X.sub.5X.sub.6=QK, KK,orQR (SEQIDNO:299) GroupF 44.91E11.H9 RASKSVSTSGYSY LASNLES QHSRELPFT MH (SEQIDNO:63) (SEQIDNO:64) (SEQIDNO:62) 48.25B3.A6 RASQSVSMSRFY RASNLAS QQTRESPRT LMH (SEQIDNO:112) (SEQIDNO:113) (SEQIDNO:111) GroupF RASX.sub.1SVSX.sub.2SX.sub.3X X.sub.1ASNLX.sub.2S QX.sub.1X.sub.2REX.sub.3PX.sub.4T consensus 4X.sub.5X.sub.6MH X.sub.1=LorR, X.sub.1X.sub.2=HSorQT,X.sub.3 sequence X.sub.1=KorQ,X.sub.2=T X.sub.2=EorA. =LorS,X.sub.4=ForR. orM,X.sub.3X.sub.4X.sub.5X.sub.6= (SEQIDNO:302) (SEQIDNO:303) GYSYorRFYL (SEQIDNO:301) GroupG 44.64E1.B12 ITSTDIDDDMN EGNTLRP LQSDNLPFT (SEQIDNO:12) (SEQIDNO:13) (SEQIDNO:273) 44.18E2.G12 ITSTDIDDDMN EGNTFRP LQSDNLPFT (SEQIDNO:12) (SEQIDNO:275) (SEQIDNO:273) GroupG SEQIDNO:12 EGNTX.sub.1RP SEQIDNO:273 consensus X.sub.1=LorF sequence (SEQIDNO:305) GroupH 48.74C11.G4 LASEGISSCLA GGNNLQI QQSYKFPYT (SEQIDNO:40) (SEQIDNO:41) (SEQIDNO:42) 48.29H4.A5 LASEDIYSNLA DASSLQD QHHRDSPLT (LC) (SEQIDNO:100) (SEQIDNO:101) (SEQIDNO:102) 48.7C11.D10. KSSQSLLYNENK WASSRES QQYYNFPYT D2 KNYLA (SEQIDNO:55) (SEQIDNO:56) (SEQIDNO:54) GroupH LASEX.sub.1IX.sub.2SX.sub.3LA SEQIDNO:41, QQX.sub.1YX.sub.2FPYT consensus X.sub.1=GorD,X.sub.2=S 101,or55 X.sub.1=SorY, sequence orY,X.sub.3=CorN. X.sub.2=KorN (SEQIDNO:308) (SEQIDNO:309) OrSEQIDNO:54 OrSEQIDNO:102
TABLE-US-00005 TABLE 5 V.sub.H and V.sub.L amino acid sequences of various antibodies. VH VL 1. 34.58E8.E10.E7 SEQ ID NO: 7 SEQ ID NO: 8 2. 44.93D1.E7 SEQ ID NO: 15 SEQ ID NO: 16 3. 48.9C4.E4 SEQ ID NO: 23 SEQ ID NO: 24 4. 48.4B12.F8 SEQ ID NO: 30 SEQ ID NO: 31 5. 48.74C11.G4 SEQ ID NO: 43 SEQ ID NO: 44 6 48.73A4.B6 SEQ ID NO: 49 SEQ ID NO: 50 7 48.7C11.D10.D2 SEQ ID NO: 57 SEQ ID NO: 58 8. 44.91E11.H9 SEQ ID NO: 65 SEQ ID NO: 66 9. 44.64E1.B12 SEQ ID NO: 70 SEQ ID NO: 71 10. 44.66C9.H2 (HC/LC) SEQ ID NO: 75 SEQ ID NO: 76 11. 48.33E9.B12 SEQ ID NO: 80 SEQ ID NO: 81 12. 48.34F9.E10.C5 SEQ ID NO: 87 SEQ ID NO: 88 13. 48.15C1.A6 SEQ ID NO: 95 SEQ ID NO: 96 14. 48.29H4.A5 SEQ ID NO: 103 SEQ ID NO: 104 15. 48.29H4.A5 (LC2) SEQ ID NO: 103 SEQ ID NO: 107 16. 48.25B3.A6 SEQ ID NO: 114 SEQ ID NO: 115 17. 44.11E7.E11 SEQ ID NO: 122 SEQ ID NO: 123 18. 48.60E11.A7 SEQ ID NO: 129 SEQ ID NO: 130 19. 44.110G5.B6 SEQ ID NO: 137 SEQ ID NO: 138 20. 44.20H2.A8 SEQ ID NO: 143 SEQ ID NO: 144 21. 44.25D8.D4 SEQ ID NO: 148 SEQ ID NO: 149 22. 44.14G5.F1 SEQ ID NO: 153 SEQ ID NO: 154 23. 44.7A3.E10 SEQ ID NO: 158 SEQ ID NO: 159 24. 44.19A6.A10 SEQ ID NO: 155 SEQ ID NO: 156 25. 44.7A10.A5 SEQ ID NO: 163 SEQ ID NO: 164 26. 44.7F10.F2 SEQ ID NO: 168 SEQ ID NO: 169 27. 44.8A6.A9 SEQ ID NO: 172 SEQ ID NO: 173 28. 48.55A7.A10 SEQ ID NO: 166 SEQ ID NO: 167 29. 44.16H2.A4 SEQ ID NO: 176 SEQ ID NO: 177 30. 44.18G6.F2.C8 SEQ ID NO: 183 SEQ ID NO: 184 31. 44.25E8.E6.D1 SEQ ID NO: 186 SEQ ID NO: 187 32. 44.94G5.A2 SEQ ID NO: 190 SEQ ID NO: 191 33. 44.91D9.C9 SEQ ID NO: 179 SEQ ID NO: 180 34. 44.96D4.C4 SEQ ID NO: 193 SEQ ID NO: 194 35. 44.99G5.A10 SEQ ID NO: 198 SEQ ID NO: 199 36. 44.100H6.E1.C3 SEQ ID NO: 201 SEQ ID NO: 202 37. 44.101H5.B4 SEQ ID NO: 204 SEQ ID NO: 205 38. 44.102H3.E12 SEQ ID NO: 209 SEQ ID NO: 210 39. 44.111C11.F7 SEQ ID NO: 212 SEQ ID NO: 213 40. 47.17B2 SEQ ID NO: 220 SEQ ID NO: 221 41. 44.92F6.C9 SEQ ID NO: 225 SEQ ID NO: 226 42. 47.17G1.E12 SEQ ID NO: 229 SEQ ID NO: 230 43. 47.25C3.C5 SEQ ID NO: 235 SEQ ID NO: 236 44. 44.19B8.H11 SEQ ID NO: 239 SEQ ID NO: 240 45. 44.91D1.E4 SEQ ID NO: 243 SEQ ID NO: 244 46. 48.51A2.B12 SEQ ID NO: 251 SEQ ID NO: 252 47. 48.26G10.A9 SEQ ID NO: 259 SEQ ID NO: 260 48. 47.62F9.G1 SEQ ID NO: 265 SEQ ID NO: 266 49 47.34G6.H6 SEQ ID NO: 271 SEQ ID NO: 272 50. 44.18E2.G12 SEQ ID NO: 276 SEQ ID NO: 277
Example 2. In Vitro Functional Characterization of Monoclonal Antibodies
Blocking of PLA2G2D Binding to Activated T Cells by Anti-PLA2G2D Antibodies
[0640] It was previously found that PLA2G2D preferentially binds to activated T cells, but only minimally to resting T cells, suggesting that PLA2G2D can impart suppressive signaling by directly binding T cells upon their activation. Therefore, an assay was devised to determine whether anti-PLA2G2D antibodies could hinder PLA2G2D binding to activated T cells and potentially block immune suppression. T cells within human PBMC cultures were stimulated with anti-CD3 and anti-CD28 antibodies (Invitrogen) for 24 hours at 37? C. PBMC cultures were then harvested, washed, and incubated with 2 ?g/ml of human PLA2G2D-Fc protein or control human IgG1-Fc protein for 30 minutes at 4? C. in the presence of 10 ?g/ml of PLA2G2D antibodies or mouse IgG2a isotype control antibody (Invitrogen). Cells were washed 3 times with PBS and then stained with PE-conjugated goat anti-human IgG1 antibodies (Invitrogen) alongside fluorophore-conjugated anti-CD3, anti-CD4, and anti-CD8 antibodies (Biolegend) and Live/Dead Fixable dead cell stain (Molecular Probes) for 30 minutes at 4? C., washed, then analyzed by FACS.
[0641] As shown in
[0642] Reversal of PLA2G2D-Dependent T Cell Suppression in PBMC Culture by Anti-PLA2G2D Antibodies
[0643] To determine whether PLA2G2D antibodies could neutralize PLA2G2D-dependent suppression of T cell function, an approach similar to the one that was previously shown to demonstrate PLA2G2D suppressive activity (
[0644] The antibodies disclosed in Tables 3-5 not only bind to human PLA2G2 but also reverse PLA2G2D-mediated suppression of IL-2 secretion in T cell-activated PBMC. As shown in
TABLE-US-00006 SEQUENCETABLE SEQID NO. Description NucleotideorAminoAcidSequence Exemplaryanti-PLA2G2Dantibodysequences 1. 34.58E8.E10.E7 DSLMH HC-CDR1(Kabat) 2. 34.58E8.E10.E7 WIDPEDGETKYAPKFQD HCCDR2(Kabat) 3. 34.58E8.E10.E7 GTGTDY HCCDR3(Kabat) 4. 34.58E8.E10.E7 KSSQSLLNSSNQKNYLA LCCDR1(Kabat) 5. 34.58E8.E10.E7 FASTRES LCCDR2(Kabat) 6. 34.58E8.E10.E7 QQHYSTPWT LCCDR3(Kabat) 7. 34.58E8.E10.E7 EVQLQQSGAELVRPGASVKLSCTASGFNIKDSLMH VHAminoacid WVKQRPEQGLEWIGWIDPEDGETKYAPKFQDKAT sequence ITADTSSNTAYLQLSSLTSEDTAIYYCAGGTGTDY WGQGTTLTVSS 8. 34.58E8.E10.E7 DIVMTQSPSSLAMSVGQKVTMSCKSSQSLLNSSNQ VLAminoacid KNYLAWYQQKPGQSPKLLVYFASTRESGVPDRFI sequence GSGSGTDFTLTISSVQAEDLADYFCQQHYSTPWTF GGGTKLEIK 9. 44.93D1.E7 DYDMH HCCDR1(Kabat) 10. 44.93D1.E7 AIDPETGGTTYNQKFKG HCCDR2(Kabat) 11. 44.93D1.E7 LAWFAY HCCDR3(Kabat) 12. 44.93D1.E7 ITSTDIDDDMN LCCDR1(Kabat) [Also,44.66C9.H2 and44.64E1.B12] 13. 44.93D1.E7 EGNTLRP LCCDR2(Kabat) [Also, 44.66C9.H2,and 44.64E1.B12] 14. 44.93D1.E7 LQSDNLPLT LCCDR3(Kabat) 15. 44.93D1.E7 QVQLQQSGAELVRPGASVTLSCKASGYTFTDYDM VHAminoacid HWVKQTPVHGLEWIGAIDPETGGTTYNQKFKGKA sequence ILTADKSSSTAYMELRSLTSEDSAVYYCTRLAWFA YWGQGTLVTVSA 16. 44.93D1.E7 ETTVTQSPASLSMAVGEKVTIRCITSTDIDDDMNW VLAminoacid FHQKPGEPPKLLISEGNTLRPGVPSRFSSSGYGTDF sequence VFTIENMLSEDVADYYCLQSDNLPLTFGAGTKLEL K 17. 48.9C4.E4 DYNMA HCCDR1(Kabat) 18. 48.9C4.E4 SISTGGDNTYCRDSVKG HCCDR2(Kabat) 19. 48.9C4.E4 HDTIRVDA HCCDR3(Kabat) 20. 48.9C4.E4 SGDELSNKYAH LCCDR1(Kabat) 21. 48.9C4.E4 KDSERPS LCCDR2(Kabat) [Also,48.4B12.F8, 48.73A4.B6, 48.33E9.B12, 48.34F9.E10.C5, and48.60E11.A7] 22. 48.9C4.E4 LSTYSDDDLPV LCCDR3(Kabat) [Also, 48.73A4.B61 23. 48.9C4.E4VH EVRLVESGGGLVQPGRSLKLSCAASGFTFNDYNM Aminoacid AWVRHPPTKGLEWVASISTGGDNTYCRDSVKGRF sequence TLSRDNAKNTLYLQMDSLKSEDTATYYCVRHDTI RVDAWGQGASVTVSS 24. 48.9C4.E4VL SYELIQPPSASVTLENTVSITCSGDELSNKYAHWYQ Aminoacid QKPDKTILEVMYKDSERPSGISDRFSGSSSGTTAILT sequence IRDAQAEDEADYYCLSTYSDDDLPVFGGGTKLTV L 25. 48.4B12.F8 NNGVS HCCDR1(Kabat) 26. 48.4B12.F8 AISSGGSTYYNSDLKS HCCDR2(Kabat) 27. 48.4B12.F8 VGDDRFDY HCCDR3[Also, 48.33E9.B12] (Kabat) 28. 48.4B12.F8 SGDELSNKYVH LCCDR1(Kabat) [Also, 48.33E9.B12] 29. 48.4B12.F8 LSTYCDDDLPV LCCDR3(Kabat) 30. 48.4B12.F8VH QVQLKESGPGLVQPSQTLSLTCTVSGFSLTNNGVS Aminoacid WVRQPPGKGLEWIAAISSGGSTYYNSDLKSRLSIG sequence RDTSKSQVFLEMNSLQTEDTAIYFCTRVGDDRFDY WGQGVMVTVSS 31. 48.4B12.F8VL SYELIQPPSASVTLENTVSITCSGDELSNKYVHWYQ Aminoacid QKPDKTILEVMYKDSERPSGISDRFSGSSSGTTAILT sequence IRDAQAEDAADYYCLSTYCDDDLPVFGGGTKLTV L 32. 33. 34. 35. 36. 37. 48.74C11.G4 NYVMV HCCDR1(Kabat) 38. 48.74C11.G4 SISAGGDDTYYRDSVKG HCCDR2(Kabat) 39. 48.74C11.G4 DMGNSGSYCFDY HCCDR3(Kabat) 40. 48.74C11.G4 LASEGISSCLA LCCDR1(Kabat) 41. 48.74C11.G4 GGNNLQI LCCDR2(Kabat) 42. 48.74C11.G4 QQSYKFPYT LCCDR3(Kabat) 43. 48.74C11.G4VH EVOLVESGGGLVQPGRSLKLSCAASGFTYSNYVM Aminoacid VWVRQAPTKGLEWVASISAGGDDTYYRDSVKGR sequence FTISRDNAKNTLYLQMDTLRSEDTATYYCARDMG NSGSYCFDYWGQGVMVTVSS 44. 48.74C11.G4VL DIQMTQSPASLSASLGEIISIECLASEGISSCLAWYQ Aminoacid QKPGKSPQLLIYGGNNLQIGVPSRFSGSGSGTQYSL sequence KISNMQPEDEGDYFCQQSYKFPYTFGAGTKLELK 45. 48.73A4.B6 NYWMT HCCDR1(Kabat) 46. 48.73A4.B6 SITDTGGITYYPDSVKG HCCDR2(Kabat) 47. 48.73A4.B6 RDLPGYQWDY HCCDR3(Kabat) 48. 48.73A4.B6 SGDELSNKYAL LCCDR1(Kabat) 49. 48.73A4.B6VH EVQLVESGGGLVQPGRSLKLSCVASGFTFNNYWM Aminoacid TWIRQAPGKRLEWVASITDTGGITYYPDSVKGRFT sequence ISRDNAKNTLYLQMNSLRSEDTATYYCTRRDLPG YQWDYWGQGVMVTVSS 50. 48.73A4.B6VL SYELIQPPSASVTLENTVSITCSGDELSNKYALWYQ Aminoacid QKPDKTILEVMYKDSERPSGISDRFSGSSSGTTAILT sequence IRDAQAEDEADYYCLSTYSDDDLPVFGGGTKLTV L 51. 48.7C11.D10.D2 NYYMA HCCDR1(Kabat) 52. 48.7C11.D10.D2 SISTGGGITYFRDSVKG HCCDR2(Kabat) 53. 48.7C11.D10.D2 HDYGGSYWYFDF HCCDR3(Kabat) 54. 48.7C11.D10.D2 KSSQSLLYNENKKNYLA LCCDR1(Kabat) 55. 48.7C11.D10.D2 WASSRES LCCDR2(Kabat) 56. 48.7C11.D10.D2 QQYYNFPYT LCCDR3(Kabat) 57. 48.7C11.D10.D2 EVOLVESGGGLVQPGRSMKLSCAALGFTFSNYYM VHAminoacid AWVRQAPTKGLEWVASISTGGGITYFRDSVKGRV sequence TLSRDNEKSTLYLQMDSLRSEDTATYYCARHDYG GSYWYFDFWGPGTMVTVSS 58. 48.7C11.D10.D2 DIVMTQTPSSQAVSAGEKVTMNCKSSQSLLYNEN VLAminoacid KKNYLAWYQQKPGQSPKLLIYWASSRESGAPDRFI sequence GSGSGTDFTLTISSVQAEDLAVYYCQQYYNFPYTF GAGTKLELK 59. 44.91E11.H9 RYWMH HCCDR1(Kabat) 60. 44.91E11.H9 RIHPSDSDTNYNQKFKD HCCDR2(Kabat) 61. 44.91E11.H9 NWDGAWFNY HCCDR3(Kabat) 62. 44.91E11.H9 RASKSVSTSGYSYMH LCCDR1(Kabat) 63. 44.91E11.H9 LASNLES LCCDR2(Kabat) 64. 44.91E11.H9 QHSRELPFT LCCDR3(Kabat) 65. 44.91E11.H9VH QVQLQQPGTELVKPGASVKVSCKASGYTFTRYW Aminoacid MHWVRQRPGQGLEWIGRIHPSDSDTNYNQKFKDK sequence ATLTVDKSSSTAYMQLNSLTSEDSAVYYCASNWD GAWFNYWGQGTLVTVSA 66. 44.91E11.H9VL DIVLTQSPASLAVSLGQRATISCRASKSVSTSGYSY Aminoacid MHWYQQKPGQPPKLLIYLASNLESGVPARFSGSGS sequence GTDFTLNIHPVEEEDAATYYCQHSRELPFTFGSGT KLEIK 67. 44.64E1.B12 SGYYWN HCCDR1 (Kabat)[Also, 44.66C9.H2] 68. 44.64E1.B12 YISYDGSNNYNPSLKS HCCDR2 (Kabat)[Also, 44.66C9.H2] 69. 44.64E1.B12 WGYYDSRIDY HCCDR3 (Kabat)[Also, 44.66C9.H2] 70. 44.64E1.B12 DVQLQESGPGLVKPSQSLSLTCSVTGYSITSGYYW VHAminoacid NWIRQFPGNKLEWMGYISYDGSNNYNPSLKSRISI sequence TRDTSKNQFFLKLNSVTTEDTATYYCARWGYYDS RIDYWGQGTTLTVSS 71. 44.64E1.B12 ETTVTQSPASLSMAIGEKVTIRCITSTDIDDDMNWF VLAminoacid QQKPGEPPKLLISEGNTLRPGVPSRFSSNGSGTDFV sequence FTIENMLSEDVADYYCLQSDNLPFTFGAGTKVELK 72. 73. 74. 75. 44.66C9.H2VH DVQLQESGPGLVKPSQSLSLTCSVTGYSITSGYYW Aminoacid NWIRQFPGNKLEWMGYISYDGSNNYNPSLKSRISI sequence TRDTSKNQFFLKLNSVTTEDTATYYCARWGYYDS RIDYWGQGTTLTVSS 76. 44.66C9.H2VL ETTVTQSPASLSMAIGEKVTIRCITSTDIDDDMNWF Aminoacid QQKPGEPPKLLISEGNTLRPGVPSRFSSNGSGTDFV sequence FTIENMLSEDVADYYCLQSDNLPFTFGAGTKVELK 77. 48.33E9.B12 SKGVS HCCDR1(Kabat) 78. 48.33E9.B12 AISSSGSTYYDSPLKS HCCDR2(Kabat) 79. 48.33E9.B12 LSTFNDDDLPV LCCDR3(Kabat) 80. 48.33E9.B12VH QVQLKESGPGLVQPSQTLSLTCTVSGFSLTSKGVS Aminoacid WVRQPPGKGLEWIAAISSSGSTYYDSPLKSRLSISR sequence DTSKSQVFLKMNSLQTEDTAIYFCTRVGDDRFDY WGQGVMVTVSS 81. 48.33E9.B12VL SYELIQPPSASVTLENTVSITCSGDELSNKYVHWYQ Aminoacid QKPDKTILEVMYKDSERPSGISDRFSGSSSGTTAILT sequence IRDAQAEDEADYYCLSTFNDDDLPVFGGGTKLTV L 82. 48.34F9.E10.C5 SNGVT HCCDR1(Kabat) 83. 48.34F9.E10.C5 AISSGGTTYYDSALKS HCCDR2(Kabat) 84. 48.34F9.E10.C5 VGGDRFDY HCCDR3(Kabat) 85. 48.34F9.E10.C5 SGDELSRKYVH LCCDR1(Kabat) 86. 48.34F9.E10.C5 LSTYGVDDLPV LCCDR3(Kabat) 87. 48.34F9.E10.C5 QVQLKESGPGLVQPSQTLSLTCTVSGFSLTSNGVT VHAminoacid WVRQPPGKGLEWIAAISSGGTTYYDSALKSRLSIS sequence RDTSKSQVFLQMNSLQTEDTATYFCARVGGDRFD YWGQGVMVTVSS 88. 48.34F9.E10.C5 SYELIQPPSASVTLENTVSITCSGDELSRKYVHWYQ VLAminoacid QKPDKTILEVMYKDSERPSGISDRFSGSSSGTTASL sequence TIRDAQAEDEADYYCLSTYGVDDLPVFGGGTKLT VL 89. 48.15C1.A6 SYDMH HCCDR1(Kabat) 90. 48.15C1.A6 VIWSNGNTHYNSTLKS HCCDR2(Kabat) 91. 48.15C1.A6 YPFAY HCCDR3(Kabat) 92. 48.15C1.A6 RASQDIGDYLR LCCDR1(Kabat) 93. 48.15C1.A6 GATNLAN LCCDR2(Kabat) [Also, 48.29H4.A5] 94. 48.15C1.A6 LQHKEYFPT LCCDR3(Kabat) 95. 48.15C1.A6VH QVQLKESGPGLVQPSQTLSLTCTVSGFSLISYDMH Aminoacid WVRQPPGEGLEWMGVIWSNGNTHYNSTLKSRLSI sequence SRDTSKSQVFLEMNSLQTEDTAIYFCSRYPFAYWG QGTLVTVSS 96. 48.15C1.A6VL DIQMTQSPSSLPASLGDRVTITCRASQDIGDYLRWF Aminoacid QQKPGKSPRLMIFGATNLANGVPSRFSGSRSGSDY sequence SLTINSLESEDLAIYYCLQHKEYFPTFGGGTKLELK 97. 48.29H4.A5 SYDMQ HCCDR1(Kabat) 98. 48.29H4.A5 AIWANGNIQYNSILKS HCCDR2(Kabat) 99. 48.29H4.A5 FRFDY HCCDR3(Kabat) 100. 48.29H4.A5 LASEDIYSNLA LCCDR1(Kabat) 101. 48.29H4.A5 DASSLQD LCCDR2(Kabat) 102. 48.29H4.A5 QHHRDSPLT LCCDR3(Kabat) 103. 48.29H4.A5 QVQLKESGPGLVQPSQTLSLTCTVSGFALTSYDMQ VHAminoacid WVRQPPGKGLEWMGAIWANGNIQYNSILKSRLSIS sequence RDTSKSQVFLKMNSLQTEDTAIYFCARFRFDYWG QGVMVTVSS 104. 48.29H4.A5 DIQMTQSPASLSASLGETVTIECLASEDIYSNLAWY VLAminoacid QQKPGKSPQLLIYDASSLQDGVPSRFSGSESGTQYS sequence LEINSLQSEDAVTYFCQHHRDSPLTFGSGTKLEIK 105. 48.29H4.A5 RASQDIGNYLR LC2CDR1 (Kabat) 106. 48.29H4.A5 LOHNEYPLT LC2CDR3 (Kabat) 107. 48.29H4.A5LC2 DIQMTQSPSSLPASLGDRVTITCRASQDIGNYLRWF Aminoacid QQKPGKSPRLMIYGATNLANGVPSRFSGSRSGSDY sequence SLTINSLESEDMAIYYCLQHNEYPLTFGSGTKLEIK 108. 48.25B3.A6 SYHVH HCCDR1(Kabat) 109. 48.25B3.A6 VMWSDGDTSHKSALKS HCCDR2(Kabat) 110. 48.25B3.A6 DSSTEGIPFDY HCCDR3(Kabat) 111. 48.25B3.A6 RASQSVSMSRFYLMH LCCDR1(Kabat) 112. 48.25B3.A6 RASNLAS LCCDR2(Kabat) 113. 48.25B3.A6 QQTRESPRT LCCDR3(Kabat) 114. 48.25B3.A6 QVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHVH VHAminoacid WVRQPPGKGLEWMGVMWSDGDTSHKSALKSRLS sequence ISRDTSKSQVFLKMNSLQTEDTATYYCARDSSTEGI PFDYWGQGAMVTVSS 115. 48.25B3.A6 DIVLTQSPALAVSLGQRATISCRASQSVSMSRFYL VCAminoacid MHWYQQKPGQQPKVLIYRASNLASGIPARFSGSGS sequence GTDFTLTINPVQADDIATYYCQQTRESPRTFGGGT KLELK 116. 44.11E7.E11 TFGMGVG HCCDR1(Kabat) 117. 44.11E7.E11 HIWWDDDKYYNPALKS HCCDR2(Kabat) 118. 44.11E7.E11 DIGNYFDY HCCDR3(Kabat) 119. 44.11E7.E11 KSSQSVLYSSNQRNYLA LCCDR1(Kabat) 120. 44.11E7.E11 WASTRES LCCDR2(Kabat) 121. 44.11E7.E11 HQYLSSYT LCCDR3(Kabat) 122. 44.11E7.E11 QVTLKESGPGILQPSQTLSLTCSFSGFSLSTFGMGV VHAminoacid GWIRQPSGKGLEWLAHIWWDDDKYYNPALKSRL sequence TISKDTSKNQVFLKIANVDTADTATYYCARDIGNY FDYWGQGTTLTVSS 123. 44.11E7.E11 NIMMTQSPSSLAVSAGEKVTMSCKSSQSVLYSSNQ VCAminoacid RNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFT sequence GSGSGTDFTLTISSVQAEDLAVYYCHQYLSSYTFG GGTKLEIK 124. 48.60E11.A7 TNGVS HCCDR1(Kabat) 125. 48.60E11.A7 AISSGGSTYYNSALKT HCCDR2 (Kabat) 126. 48.60E11.A7 AGGNRFAY HCCDR3 127. 48.60E11.A7 SGDELSNKYTH LCCDR1 128. 48.60E11.A7 LSSYTDDDILV LCCDR3(Kabat) 129. 48.60E11.A7VH QVQLKESGPGLVQPSQTLSLTCTASGFSLTTNGVS Aminoacid WVRQPPGKGLEWIAAISSGGSTYYNSALKTRLSIS sequence RDTSKSQVFLKMNSLQTKDTAIYFCTSAGGNRFAY WGQGTLVTVSS 130. 48.60E11.A7VL SYELIQPPSASVTLENTVSITCSGDELSNKYTHWFQ Aminoacid QKPDKTILEVMYKDSERPSGISDRFSGSSSGTTAILT sequence IRDAQAEDEADYYCLSSYTDDDILVFGGGTKLTVL 131. 44.110G5.B6 TSGLGVS HCCDR1(Kabat) 132. 44.110G5.B6HC HIYWDDDKRYNPSLKS CDR2(Kabat) [Also, 44.20H2.A8, 44.25D8.D4, 44.14G5.F1, 44.7A3.E10, 44.19A6.A10, 44.7A10.A5, 44.7F10.F2, 44.8A6.A9, 44.16H2.A4, 44.18G6.F2.C8, 44.25E8.E6.D1, 44.94G5.A2, 44.91D9.C9, 44.96D4.C4, 44.100H6.E1.C3, 44.101H5.B4, 44.102H3.E12, 44.111C11.F7, 44.92F6.C9, 47.17G1.E12, 44.19B8.H11, 44.91D1.E4, 133. 44.110G5.B6 RRSLYFYFDV HCCDR3(Kabat) 134. 44.110G5.B6 SAISSVSYMY LCCDR1(Kabat) 135. 44.110G5.B6 RTSNLAS LCCDR2(Kabat) [Also, 44.20H2.A8, 44.25D8.D4, 44.14G5.F1, 44.7A3.E10F1, 44.19A6.A10, 44.7A10.A5, 44.7F10.F2, 44.16H2.A4, 44.18G6.F2.C8, 44.25E8.E6.D1, 44.94G5.A2, 44.91D9.C9, 44.96D4.C4, 44.99G5.A10, 44.101H5.B4, 44.102H3.E12, 44.111C11.F7, 44.92F6.C9, 47.17G1.E12, 44.19B8.H11, 44.91D1.E4, 47.62F9.G1 136. 44.110G5.B6 QQYHSYPPT LCCDR3(Kabat) [Also,44.14G5.F1 LCCDR3, 44.7F10.F2, 44.8A6.A9, 44.25E8.E6.D1, 44.96D4.C4, 44.99G5.A10, 44.100H6.E1.C3, 44.101H5.B4, 44.91D1.E4] 137. 44.110G5.B6 QVTLKESGPGILQSSQTLSLTCSFSGFSLSTSGLGVS VHAminoacid WIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTIS sequence KDTSRNQVFLKITSVDTADTATYYCARRRSLYFYF DVWGTGTTVTVSS 138. 44.110G5.B6 QIVLTQSPTIMSASPGEKVTISCSAISSVSYMYWYQ VLAminoacid QKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSL sequence TISSMEAEDAATYYCQQYHSYPPTFGSGTKLEIK 139. 44.20H2.A8HC TSGMAVS CDR1(Kabat) [Also,44.25D8.D4 HCCDR1] 140. 44.20H2.A8HC REGDWYFDV CDR3(Kabat) 141. 44.20H2.A8LC SASSRISYMY CDR1(Kabat) 142. 44.20H2.A8LC QQYHTSPLT CDR3(Kabat) 143. 44.20H2.A8VH QVTLKESGPGILQSSQTLSLTCSFSGFSLNTSGMAV Aminoacid SWIRQSSGKGLEWLAHIYWDDDKRYNPSLKSRLTI sequence SKDISRNQVFLKITSVDTADTATYFCARREGDWYF DVWGTGTTVTVSS 144. 44.20H2.A8VL QIVLTQSPAIMSASPGEMVTISCSASSRISYMYWYQ Aminoacid QKPGSSPKPWIFRTSNLASGVPTRFSGSGSGTSYSL sequence TISSMEAEDAATYYCQQYHTSPLTFGAGTKLELK 145. 44.25D8.D4HC RGPGTWYFDV CDR3(Kabat) [44.7A3.E10, 44.19A6.A10] 146. 44.25D8.D4LC SASSSVVYMY CDR1(Kabat) 147. 44.25D8.D4LC QQYHSSPLT CDR3(Kabat) [Also,44.7A3.E10 F1LCCDR3, 44.19A6.A10, 44.7A10.A5, 44.91D9.C9, 44.111C11.F7] 148. 44.25D8.D4VH QVTLKESGPGILQSSQTLSLTCSFSGFSLSTSGMAV SWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTI SKDTSRNQVFLKITSVDTTDTATYYCARRGPGTW YFDVWGTGTTVTVSS 149. 44.25D8.D4VL QIVLTQSPAIMSASPGEKVTISCSASSSVVYMYWY QQQPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYS LTISSMEAEDAATYYCQQYHSSPLTFGAGTKLELK 150. 44.14G5.F1HC TSGMCVS CDR1(Kabat) 151. 44.14G5.F1HC KGRDYGFDY CDR3(Kabat) 152. 44.14G5.F1LC SASSSVSYMY CDR1(Kabat) [Also,44.7A3.E10 F1, 44.19A6.A10, 44.7A10.A5, 44.7F10.F2, 44.8A6.A9, 44.16H2.A4, 44.25E8.E6.D1, 44.94G5.A2, 44.91D9.C9, 44.96D4.C4, 44.100H6.E1.C3, 44.101H5.B4, 44.111C11.F7, 44.92F6.C9, 47.17G1.E12, 44.19B8.H11, 44.91D1.E4] 153. 44.14G5.F1VH QVTLKESGPGILQSSQTLSLTCSFSGFSLSTSGMCV Aminoacid SWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTI sequence SKDTSRNQVFLKITGVDTADTATYYCALKGRDYG FDYWGHGTTLTVSS 154. 44.14G5.F1VL QIVLTQSPAIMSASPGEKVTISCSASSSVSYMYWYQ Aminoacid QKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSL sequence TIGSMEAEDAATYYCQQYHSYPPTFGGGTRLEIK 155. 44.19A6.A10VH QVTLKESGPGILQSSQTLSLTCSFSGFSLTTSGMGV Aminoacid GWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLT sequence ISKDTSRNQVFLKITSVDTTDTATYYCARRGPGTW YFDVWGTGTTVTVSS 156. 44.19A6.A10VL QIVLTQSPAIMSASPGEKVTISCSASSSVSYMYWYQ Aminoacid QKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSL sequence TISSMEAEDAAAYYCQQYHSSPLTFGAGTKLELK 157. 44.7A3.E10HC TSGMGVA CDR1(Kabat) 158. 44.7A3.E10VH QVTLKESGPGILQSSQTLSLTCSFSGFSLSTSGMGV Aminoacid AWIRRPSGKGLEWLAHIYWDDDKRYNPSLKSRLTI sequence SKDTSRNQVFLKITSVDTADTATYYCARRGPGTW YFDVWGTGTTVTVSS 159. 44.7A3.E10VL QIVLTQSPAIMSASPGEKVTISCSASSSVSYMYWYQ Aminoacid QKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSL sequence TISSMEAEDAATYYCQQYHSSPLTFGAGTKLELK 160. 44.19A6.A10HC TSGMGVG CDR1(Kabat) 161. 44.7A10.A5HC TSGMGVS CDR1(Kabat) [also,44.7F10.F2, 44.8A6.A9, 44.16H2.A4, 44.18G6.F2.C8, 44.25E8.E6.D1, 44.94G5.A2, 44.91D9.C9, 44.96D4.C4, 44.99G5.A10, 44.100H6.E1.C3, 44.101H5.B4, 44.102H3.E12, 44.111C11.F7, 47.62F9.G1, 47.34G6.H6,] 162. 44.7A10.A5HC PAYYSNHLFAY CDR3(Kabat) 163. 44.7A10.A5VH QVTLKESGPGILQSSQTLSLTCSFSGFSLSTSGMGV Aminoacid SWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTI sequence SKDTSRNQVFLKITSVDTADTATYYCARPAYYSNH LFAYWGQGTLVTVSA 164. 44.7A10.A5VL QIVLTQSPAIMSASPGEKVTISCSASSSVSYMYWYQ Aminoacid QKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSL sequence TISSMEAEDAATYYCQQYHSSPLTFGAGTKLELK 165. 44.7F10.F2HC RAVKDWYFDV CDR3(Kabat) 166. 48.55A7.A10VH EVOLVESGGGLVQPGRSLKLSCAASGFSFNDYNM Aminoacid AWVRQAPTKGLEWVASISTGGANTYCRDSVKGRF sequence TLSRDNAKNTLYLQMDSLKSEDTATYYCARHDTI RVDAWGQGASVTVSS 167. 48.55A7.A10VL SYELIQPPSASVTLENTVSITCSGDELSNKYAHWYQ Aminoacid QKPDKTILEVMYKDSERPSGISDRFSGSSSGTTAILT sequence IRDAQAEDEADYYCLSTYSDDDLPVFGGGTKLTV L 168. 44.7F10.F2VH QVTLKESGPGILQSSQTLSLTCSFSGFSLSTSGMGV Aminoacid SWIRQPSGKGLEWLTHIYWDDDKRYNPSLKSRLTI sequence SKDTSRNQVFLKITSVDTADTATYYCARRAVKDW YFDVWGTGTTVTVSS 169. 44.7F10.F2VL QIVLTQSPAIMSASPGEKVTISCSASSSVSYMYWYQ Aminoacid QKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSL sequence TISSMEAEDAATYYCQQYHSYPPTFGSGTKLEIK 170. 44.8A6.A9HC RASGDYSNFGFAY CDR3(Kabat) 171. 44.8A6.A9LC RTSILAS CDR3(Kabat) 172. 44.8A6.A9VH QVILKESGPGILQSSQTLSLTCSFSGFSLSTSGMGVS Aminoacid WIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTIS sequence KDTSRNQVFLKVTSVDTTDTATYYCARRASGDYS NFGFAYWGRGTLVTVSA 173. 44.8A6.A9VL QIVLTQSPAIMSASPGEKVTISCSASSSVSYMYWYQ Aminoacid QKPGSSPKPWIYRTSILASGVPARFSGSGSGTSYSL sequence TISSMEAEDAATYYCQQYHSYPPTFGGGTKLEIK 174. 44.16H2.A4HC RYGSLYFDY CDR3(Kabat) 175. 44.16H2.A4LC QQYHTYPPM CDR3(Kabat) 176. 44.16H2.A4VH QVTLKESGPGILQSSQTLSLTCSFSGFSLSTSGMGV Aminoacid SWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTI sequence SKDTSRNQVFLKITSVDTADTATYYCARRYGSLYF DYWGQGTTLTVSS 177. 44.16H2.A4VL QIVLTQSPVIMSASPGEKVTISCSASSSVSYMYWYQ Aminoacid QKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSL sequence TISSMEAEDAATYYCQQYHTYPPMFGGGTKLEIK 178. 44.18G6.F2.C8 KHSDYWFAY HCCDR3(Kabat) [Also, 44.91D9.C9] 179. 44.91D9.C9 QVTLKESGPGILQSSQTLSLTCSFSGFSLSTSGMGV VHAminoacid SWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTI sequence SKDTSRNQVFLKITSVDTADTATYYCARKHSDYW FAYWGQGTLVTVSA 180. 44.91D9.C9 QIVLTQSPAIMSASPGEKVTISCSASSSVSYMYWYQ VLAminoacid QKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSL sequence TISSMEAEDAATYYCQQYHSSPLTFGAGTKLELK 181. 44.18G6.F2.C8LC SASSRVRYIY CDR1(Kabat) 182. 44.18G6.F2.C8LC QQYHTYPLT CDR3(Kabat) [Also, 47.17G1.E12, 47.25C3.C5, 47.34G6.H6] 183. 44.18G6.F2.C8 QVTLKESGPGILQSSQTLSLTCSFSGFSLTTSGMGV VHAminoacid SWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTI sequence SKDTSRNQVFLKITSVDTADTATYYCARKHSDYW FAYWGQGTLVTVSA 184. 44.18G6.F2.C8 QIILTQSPAIMSASPGEKVTISCSASSRVRYIYWYQQ VLAminoacid KPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSLT sequence ISSMEAEDAATYYCQQYHTYPLTFGAGTKLELK 185. 44.25E8.E6.D1 RASVEFYFDY HCCDR3(Kabat) 186. 44.25E8.E6.D1 QVTLKESGPGILQSSQTLSLTCSFSGFSLSTSGMGV VHAminoacid SWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTI sequence SKDTSRNQVFLKITSVDTADTATYYCARRASVEFY FDYWGQGTTLTVSS 187. 44.25E8.E6.D1 QIVLTQSPAIMSASPGEKVTISCSASSSVSYMYWYQ VLAminoacid QKPGSSPKPWIYRTSNLASGVPIRFSGSGSGTSYSL sequence TISSMEAEDAATYYCQQYHSYPPTFGGGTKLEIK 188. 44.94G5.A2HC RPEAPYYDYDGFAY CDR3(Kabat) 189. 44.94G5.A2LC QQYHTYPPT CDR3(Kabat) [Also, 44.19B8.H11] 190. 44.94G5.A2 QVTLKESGPGILQSSQTLSLTCSFSGFSLSTSGMGV VHAminoacid SWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTI sequence SKDTSRNQVFLNITSVDTADTATYYCARRPEAPYY DYDGFAYWGQGTLVTVSA 191. 44.94G5.A2 QIVLTQSPAIMSASPGEKVTISCSASSSVSYMYWYQ VLAminoacid QKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSL sequence TISSMEAEDAATYYCQQYHTYPPTFGGGTKLEIK 192. 44.96D4.C4HC RESKYFYFDY CDR3(Kabat) [Also, 44.100H6.E1.C3, 193. 44.96D4.C4VH QVTLKESGPGILQSSQTLSLTCSFSGFSLSTSGMGV Aminoacid SWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLSI sequence SKDTSRNQVFLKITSVDTVDTATYYCARRESKYFY FDYWGQGTTLTVSS 194. 44.96D4.C4 QIVLTQSPSIMSASPGEKVTISCSASSSVSYMYWYQ VLAminoacid QKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSL sequence TISSMEAEDAATYYCQQYHSYPPTFGSGTKLEIK 195. 44.99G5.A10HC HIYWDNDKRYNPSLKS CDR2(Kabat) 196. 44.99G5.A10HC RASLKFFFDY CDR3(Kabat) 197. 44.99G5.A10LC SATSTISYMY CDR2(Kabat) 198. 44.99G5.A10 QVTLKESGPGILQSSQTLSLTCSFSGFSLSTSGMGV VHAminoacid SWIRQPSGKGLEWLAHIYWDNDKRYNPSLKSRLTI sequence SKDTSRNQVFLKITSVDTADTATYYCARRASLKFF FDYWGQGTTLTVSS 199. 44.99G5.A10 QIVLTQSPAIMSASPGEKVTISCSATSTISYMYWYQ VLAminoacid QKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSL sequence TISSMEAEDAATYYCQQYHSYPPTFGGGTKLEIK 200. 44.100H6.E1.C3 DTSKLAS LCCDR2(Kabat) 201. 44.100H6.E1.C3 QVTLKESGPGILQSSQTLSLTCSFSGFSLSTSGMGV VHAminoacid SWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTI sequence SKDTSRNQVFLKITSVDTADSATYYCARRESKYFY FDYWGQGTTLTVSS 202. 44.100H6.E1.C3 QIVLTQSPAIMSASPGEKVTISCSASSSVSYMYWYQ VLAminoacid QKPGSSPKRWIYDTSKLASGVPARFSGSGSGTSYS sequence LTISSMEAEDAATYYCQQYHSYPPTFGSGTKLEIK 203. 44.101H5.B4HC RESRYFYFDY CDR3(Kabat) 204. 44.101H5.B4VH QVTLKESGPGILQSSQTLSLTCSLSGFSLSTSGMGV Aminoacid SWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTI sequence SKDTSRNQVFLKITSVDTADTATYYCARRESRYFY FDYWGQGATLTVSS 205. 44.101H5.B4VL QIVLTQSPAIMSASPGEKVTISCSASSSVSYMYWYQ Aminoacid QKPGSSPKPWIFRTSNLASGVPARFSGSGSGTSYSL sequence TISSMEAEDAATYYCQQYHSYPPTFGSGTKLEIK 206. 44.102H3.E12HC RASVDFYFDY CDR3(Kabat) 207. 44.102H3.E12LC SAGSSVSFMY CDR1(Kabat) 208. 44.102H3.E12LC QHYHSYPPT CDR3(Kabat) 209. 44.102H3.E12 QVTLKESGPGILQSSQTLSLTCSFSGFSLSTSGMGV VHAminoacid SWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTI sequence SKDTSRNQVFLKITNVDTADTATYFCARRASVDFY FDYWGQGSNLTVSS 210. 44.102H3.E12 QIVLTQSPAIMSASPGEKVTISCSAGSSVSFMYWYQ VLAminoacid QKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSL sequence TISSMEAEDAATYYCQHYHSYPPTFGGGTKLEIK 211. 44.111C11.F7HC PAFYSNHLFAY CDR3(Kabat) 212. 44.111C11.F7 QVTLKESGPGILQSSQTLSLTCSFSGFSLSTSGMGV VHAminoacid SWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTI sequence SKNTSRNQVFLKITDVDTADSATYYCARPAFYSNH LFAYWGQGTLVTVSA 213. 44.111C11.F7 QIVLTQSPAIMSASPGEKVTISCSASSSVSYMYWYQ VLAminoacid QKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSL sequence TISSMEAEDAATYYCQQYHSSPLTFGAGTKLELK 214. 47.17B2HC TSPLGVS CDR1(Kabat) 215. 47.17B2HC HIYWDDDKRYNPSLQN CDR2(Kabat) 216. 47.17B2HC RDGSNFYFDY CDR3(Kabat) 217. 47.17B2LC SASSTVRYIY CDR1(Kabat) 218. 47.17B2LC RTSNLAF CDR2(Kabat) 219. 47.17B2LC QQYHSFPLT CDR3(Kabat) 220. 47.17B2 QVTLKESGPGILQSSQTLSLTCSFSGFSLNTSPLGVS VHAminoacid WIRQPSGKGLEWLAHIYWDDDKRYNPSLQNRLTI sequence SKDTSRNQVFLKISSVDTADTATYYCARRDGSNFY FDYWGQGTTLTVSS 221. 47.17B2 QIVLTQSPAIMSASPGEKVTISCSASSTVRYIYWYY VLAminoacid QKPGSSPTPWIYRTSNLAFGVPARFSGSGSGTSYSL sequence TISSMEAEDAATYYCQQYHSFPLTFGAGTKLELK 222. 44.92F6.C9HC TSPMGVS CDR1(Kabat) 223. 44.92F6.C9HC RRGDSFYFDY CDR3(Kabat) 224. 44.92F6.C9LC QQYHSYPLT CDR3(Kabat) 225. 44.92F6.C9 QVTLKESGPGILQSSQTLSLTCSFSGFSLSTSPMGVS VHAminoacid WIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTIS sequence RDTSRNQVFLKITTVDTADTATYFCARRRGDSFYF DYWGQGTTLTVSS 226. 44.92F6.C9 QIVLTQSPAIMSASPGEKVTISCSASSSVSYMYWYQ VLAminoacid QKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSL sequence TISSMEAEDAATYYCQQYHSYPLTFGAGTKLELK 227. 47.17G1.E12HC TSRMGVS CDR1(Kabat) [47.25C3.C5] 228. 47.17G1.E12HC RALYDYGADFYFDV CDR3(Kabat) 229. 47.17G1.E12 QVTLKESGPGILQSSQTLSLTCSFSGFSLSTSRMGV VHAminoacid SWIRQPSRKGLEWLAHIYWDDDKRYNPSLKSRLTI sequence SKDTSRNQVFLRINNVDTADTATYYCARRALYDY GADFYFDVWGTGTTVTVSS 230. 47.17G1.E12 QIVLTQSPAIMSAFPGEKVTISCSASSSVSYMYWYQ VLAminoacid QKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSL sequence TISSMEAEDAATYYCQQYHTYPLTFGAGTKLELK 231. 47.25C3.C5HC HIYWDDDKRYDPSLKS CDR2(Kabat) 232. 47.25C3.C5HC RALSDYGSDFYFDV CDR3(Kabat) 233. 47.25C3.C5LC SASSIVSYMY CDR1(Kabat) 234. 47.25C3.C5LC RTSTLAS CDR2(Kabat) 235. 47.25C3.C5 QVTLKESGPGILQSSQTLSLTCSFSGFSLSTSRMGV VHAminoacid SWIRQSSRKGLEWLAHIYWDDDKRYDPSLKSRLTI sequence SKDTSRNQVFLKITSVDTADTATYYCARRALSDYG SDFYFDVWGTGTTVTVSS 236. 47.25C3.C5 QIVLTQSPAIMSASPGEKVTISCSASSIVSYMYWYQ VLAminoacid QKPGSSPKPWIYRTSTLASGVPARFSGSGSGTSYSL sequence TISSMEAEDAATYYCQQYHTYPLTFGAGTKLELK 237. 44.19B8.H11HC TSSMGVS CDR1(Kabat) 238. 44.19B8.H11HC RAGNFFYFDV CDR3(Kabat) 239. 44.19B8.H11 QVTLKESGPGILQSSQTLSLTCSFSGFSLSTSSMGV VHAminoacid SWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTIS sequence KDTSRNQVFLKISNVDTADAATYYCARRAGNFFY FDVWGTGTTVTVSS 240. 44.19B8.H11 QIVLTQSPAIMSASPGEKVTISCSASSSVSYMYWYQ VLAminoacid QKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSL sequence TISSMEAEDAATYYCQQYHTYPPTFGGGTKLEIK 241. 44.91D1.E4HC TSTMGVS CDR1(Kabat) 242. 44.91D1.E4HC RRVYDFDFDY CDR3(Kabat) 243. 44.91D1.E4 QVTLKESGPGTLQSSQTLSLTCSFSGFSLNTSTMGV VHAminoacid SWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTI sequence SKDTSRNQVFLKITSVDTADTATYYCARRRVYDF DFDYWGQGTTLTVSS 244. 44.91D1.E4 QIVLTQSPAIMSASPGEKVTISCSASSSVSYMYWYQ VHAminoacid QKPGSSPKPWIYRTSNLASGVPARFSGSGSGTSYSL sequence TISSMEAEDAATYFCQQYHSYPPTFGGGTKLEIK 245. 48.51A2.B12HC TYAMGVG CDR1(Kabat) 246. 48.51A2.B12HC NIWWDDDKFYNPSLKN CDR2(Kabat) 247. 48.51A2.B12HC LGVRWSHYFDY CDR3(Kabat) 248. 48.51A2.B12LC RASQDIGNFLS CDR1(Kabat) 249. 48.51A2.B12LC GATNLED CDR2(Kabat) 250. 48.51A2.B12LC LQYEKYFT CDR3(Kabat) 251. 48.51A2.B12 QVTLKESGPGILQPSQTLSLTCSFSGFSLSTYAMGV VHAminoacid GWIRQPSGKGLEWLANIWWDDDKFYNPSLKNRLT sequence ISRDTSTNQAFLKITNVDSADTATYYCSRLGVRWS HYFDYWGQGVMVTVSS 252. 48.51A2.B12 DIQMTQSPSSLSASLGDRVTITCRASQDIGNFLSWF VLAminoacid QQKPGKSPRLMIYGATNLEDGVPSRFSGSRSGSDY sequence SLTISSLESEDTAIYYCLQYEKYFTFGSGTKLEIK 253. 48.26G10.A9HC TYAMH CDR1(Kabat) 254. 48.26G10.A9HC YIGPGSGSTWYNENFKG CDR2(Kabat) 255. 48.26G10.A9HC GGYSGDDWFAY CDR3(Kabat) 256. 48.26G10.A9LC QASQDIGNNLI CDR1(Kabat) 257. 48.26G10.A9LC YATNLAN CDR2(Kabat) 258. 48.26G10.A9LC LQYKQSPLT CDR3(Kabat) 259. 48.26G10.A9 QVQLQQSGAELAKPGSSVKISCKASGYTFTTYAM VHAminoacid HWIKQTTGQALEWTGYIGPGSGSTWYNENFKGKA sequence TLTVDKSSSTAYMQLSSLTPADTAVYYCARGGYS GDDWFAYWGQGTLVTVSS 260. 48.26G10.A9 DILMTQSPSSMSASLGDRVTITCQASQDIGNNLIWF VLAminoacid QQKPGKSPRRMIYYATNLANGVPSRFSGSRSGSDY sequence SLTIISLESEDMADYHCLQYKQSPLTFGSGTKLEIK 261. 47.62F9.G1HC HIYWDDDNRYNASLKS CDR2(Kabat) 262. 47.62F9.G1HC RTPFDFGFDY CDR3(Kabat) 263. 47.62F9.G1LC SASSRVSYMY CDR1(Kabat) 264. 47.62F9.G1LC QQYHTFPLT CDR3(Kabat) 265. 47.62F9.G1 QVTLKESGPGVLQSSQTLSLTCSFSGFSLSTSGMGV VHAminoacid SWIRQPSGKGLEWLAHIYWDDDNRYNASLKSRLII sequence SKDTSRNQVFLKITSVDTADSATYYCARRTPFDFG FDYWGQGTTLTVSS 266. 47.62F9.G1 QIVLTQSPAIMSAFPGEKVTISCSASSRVSYMYWY VLAminoacid QQKPGSSPKPWIYRTSNLASGVPVRFSGSGSGTSYS sequence LTISSMETEDAATYYWQQYHTFPLTFGSGTKLEIK 267. 47.34G6.H6HC HIYWDDANRYNPSLES CDR2(Kabat) 268. 47.34G6.H6HC RSGDWYFDV CDR3(Kabat) 269. 47.34G6.H6LC SASSIVRYIY CDR1(Kabat) 270. 47.34G6.H6LC RTFNLAS CDR2(Kabat) 271. 47.34G6.H6 QVTLKESGPGILQSSQTLSLTCSFSGFSLSTSGMGV VHAminoacid SWIRQPSGKGLEWLAHIYWDDANRYNPSLESRLTI sequence SKDTSRNQVFLKITSVDTADTATYYCAWRSGDWY FDVWGTGTTVTVSS 272. 47.34G6.H6 QIVLTQSPAIMSASPGEKVTLSCSASSIVRYIYWYQ VLAminoacid QKPGSSPKPWIYRTFNLASGVPARFSGSGSGTSYSL sequence TISTMEAEDAATYYCQQYHTYPLTFGAGTKLELK 273. 44.64E1.B12LC LQSDNLPFT CDR3 [Also, 44.66C9.H2] 274. 44.18E2.G12 YISYDGSKNYNPSLKS CDRH2 275. 44.18E2.G12 EGNTFRP CDRL2 276. 44.18E2.G12VH DVQLQESGPGLVKPSQSLSLTCSVTGYSITSGYYW NWIRQFPGNKLEWMGYISYDGSKNYNPSLKSRISI TRDTSKNQFFLKLNSVTTEDTATYYCARWGYYDS RIDYWGQGTTLTVSS 277. 44.18E2.G12VL ETTVTQSPASLSMAIGEKVTIRCITSTDIDDDMNWY QQKPGEPPKLLISEGNTFRPGVPSRFSSSGYGTDFV FTIENMLSEDVADYYCLQSDNLPFTFGAGTKVELK 278. 48.55A7.A10 SISTGGANTYCRDSVKG CDRH2 279. GroupA TSX.sub.1X.sub.2X.sub.3VX.sub.4 consensus X.sub.1X.sub.2X.sub.3=GLG,GMA,GMC,GMG,PLG,PMG,RMG, sequence- TMG,orSMG,X.sub.4=A,G,orS CDRH1 280. GroupA HIYWDX.sub.1X.sub.2X.sub.3RYX.sub.4X.sub.5SLX.sub.6X.sub.7 consensus X.sub.1X.sub.2X.sub.3=DDK,NDK,DDN,orDAN;X.sub.4X.sub.5=NP,DP, sequence- orNA;X.sub.6X.sub.7=KS,QN,orES. CDRH2 281. GroupA SAX.sub.1SX.sub.2X.sub.3X.sub.4YX.sub.5Y consensus X.sub.1=I,S,T,orG,X.sub.2X.sub.3X.sub.4=SVS,RIS,SVV,RVR,TIS, sequence- TVR,IVS,RVS,orIVR,X.sub.5=MorI. CDRL1 282. GroupA X.sub.1TX.sub.2X.sub.3LAX.sub.4 consensus X.sub.1=RorD,X.sub.2X.sub.3=SN,SI,SK,ST,orFN,X.sub.4=SorF. sequence- CDRL2 283. GroupA QX.sub.1YHX.sub.2X.sub.3PX.sub.4X.sub.5 consensus X.sub.1=QorH,X.sub.2X.sub.3=SY,TS,SS,TY,SF,orTF,X.sub.4X.sub.5= sequence- PT,LT,orPM CDRL3 284. GroupB X.sub.1X.sub.2GVX.sub.3 consensus X.sub.1X.sub.2=NN,SK,SN,orTN;X.sub.3=SorT sequence- CDRH1 285. GroupB X.sub.1YX.sub.2MX.sub.3 consensus X.sub.1=NorD,X.sub.2=W,V,orN,X.sub.3=T,V,orA sequence- CDRH1 286. GroupB SIX.sub.1X.sub.2X.sub.3GGX.sub.4X.sub.5TYX.sub.6X-DSVKG consensus X.sub.1X.sub.2X.sub.3=TDT,SA,orST,X.sub.4X.sub.5=I,DD,DN,orAN, sequence- X.sub.6X.sub.7=YP,YR,orCR. CDRH2 287. GroupB AISSX.sub.1GX.sub.2TYYX.sub.3SX.sub.4LKX.sub.5 consensus X.sub.1=SorG,X.sub.2=SorT,X.sub.3=NorD,X.sub.4=D,P,orA, sequence- X.sub.5=SorT CDRH2 288. GroupB X.sub.1GX.sub.2X.sub.3RFX.sub.4Y consensus X.sub.1=AorV,X.sub.2X.sub.3=DD,GD,orGN,X.sub.4=DorA. sequence- CDRH3 289. GroupB SGDELSX.sub.1KYX.sub.2X.sub.3 consensus a)X.sub.1=NorR,and sequence- b1)X.sub.2=A,V,orT,andX.sub.3=HorL,orb2)X.sub.2X.sub.3=AL, CDRL1 VH,AH,orTH. 290. GroupB LSX.sub.1X.sub.2X.sub.3X.sub.4DDX.sub.5X.sub.6V consensus X.sub.1X.sub.2X.sub.3X.sub.4=TYSD,TFND,TYGV,TYSD,TYCD,or sequence- SYTD,X.sub.5X.sub.6=LPorIL CDRL3 291. GroupC-1 SYDMX.sub.1 consensus X.sub.1=HorQ sequence- CDRH1 292. GroupC-1 X.sub.1IWX.sub.2NGNX.sub.3X.sub.4YNSX.sub.5LKS consensus X.sub.1=VorA,X.sub.2=SorA,X.sub.3X.sub.4=THorIQ,X.sub.5=TorI. sequence- CDRH2 293. GroupC-1 X.sub.1X.sub.2FX.sub.3Y consensus X.sub.1X.sub.2=YPorFR,X.sub.3=AorD. sequence- CDRH3 294. GroupC-2 TYAMX.sub.1X.sub.2X.sub.3 consensus X.sub.1X.sub.2X.sub.3=GVGorH sequence- CDRH1 295. GroupC X.sub.1ASQDIGX.sub.2X.sub.3LX.sub.4 consensus X.sub.1=RorQ,X.sub.2X.sub.3=NF,NN,DY,orNY,X.sub.4=S,I,orR. sequence- CDRL1 296. GroupC X.sub.1ATNLX.sub.2X.sub.3 consensus X.sub.1=GorY,X.sub.2X.sub.3=EDorAN sequence- CDRL2 297. GroupD EGNTX.sub.1RP consensus X.sub.1=LorF sequence- CDRL2 298. GroupD LQSDNLPXIT consensus X.sub.1=LorF sequence- CDRL3 299. GroupEconsensus KSSQSX.sub.1LX.sub.2X.sub.3X.sub.4NX.sub.5X.sub.6NYLA sequence X.sub.1=LorV,X.sub.2X.sub.3X.sub.4=NSS,YNE,orYSS,X.sub.5X.sub.6=QK, CDRL1 KK,orQR 300. GroupEconsensus X.sub.1ASX.sub.2RES sequence- X.sub.1=ForW,X.sub.2=TorS CDRL2 301. GroupFconsensus RASX.sub.1SVSX.sub.2SX.sub.3X.sub.4X.sub.5X.sub.6MH sequence- X.sub.1=KorQ,X.sub.2=TorM,X.sub.3X.sub.4X.sub.5X.sub.6=GYSYorRFYL CDRL1 302. GroupFconsensus X.sub.1ASNLX.sub.2S sequence- X.sub.1=LorR,X.sub.2=EorA. CDRL2 303. GroupFconsensus QX.sub.1X.sub.2REX.sub.3PX.sub.4T sequence- X.sub.1X.sub.2=HSorQT,X.sub.3=LorS,X.sub.4=ForR. CDRL3 304. GroupG YISYDGSX.sub.1NYNPSLKS consensus X.sub.1=KorN sequence- CDRH2 305. GroupG EGNTX.sub.1RP consensus X.sub.1=LorF sequence- CDRL2 306. GroupH NYX.sub.1MX.sub.2 consensus X.sub.1=VorY,X.sub.2=VorA sequence- CDRH1 307. GroupH SISX.sub.1GGX.sub.2X.sub.3TYX.sub.4RDSVKG consensus X.sub.1=AorT,X.sub.2X.sub.3=DDorGI,X.sub.4=YorF. sequence- CDRH2 308. GroupH LASEX.sub.1IX.sub.2SX.sub.3LA consensus X.sub.1=GorD,X.sub.2=SorY,X.sub.3=CorN sequence- CDRL1 309. GroupH QQX.sub.1YX.sub.2FPYT consensus X.sub.1=SorY,X.sub.2=KorN sequence- CDRL3 Exemplarysignalingsequence 310. Signaling MKCSWVIFFLMAVVIGVNS sequence 311. Signaling MESQTQVLMFLLLWVSGACA sequence 312. Signaling MDIRLSLAFLLLFIKGVQC sequence 313. Signaling MVWTSLLLPLLSLYAGSVT sequence 314. Signaling MEWSWVFLFLLSVIAGVQS sequence 315. Signaling MFSLALLLSLLLLCVSDSRA sequence 316. Signaling MAVLVLLLCLVTFPRCVLS sequence 317. Signaling MKFSWVIFFLMAVVTGVNS sequence 318. Signaling MAVPTQLLGLLLLWITDAIC sequence 319. Signaling MDISLSLAFLVLFIKGVQC sequence 320. Signaling MESQTQVLMSLLLWVSGTCG sequence 321. Signaling MRWSCIILFLVATATGVHS sequence 322. Signaling METDTLLLWVLLLWVPGSTG sequence 323. Signaling MKVLSLLYLLTAIPGILS sequence 324. Signaling MSVPTQVLGLLLLWLTGARC sequence 325. Signaling MTVLVLLLCLVTFPSCVLS sequence 326. Signaling MLAHAQFLGLLLLWFPGARC sequence 327. Signaling MGVPTQLLGLLLLWITDGIC sequence 328. Signaling MAVLVLLLCLMTFPSCVLS sequence 329. Signaling METDRLLLWALLLWVPGSTG sequence 330. Signaling MGRLTSSFLLLIVPAYVLS sequence 331. Signaling MESQTQVFLSLLLWVSGTCG sequence 332. Signaling MDRLTSSFLLLIVPAYVLS sequence 333. Signaling MDFQVQIFSFLLISASVIMSRG sequence 334. Signaling MDRLSSSFLLLLVPAYVLS sequence 335. Signaling MDFQVQIFSFLLISASVILSRG sequence 336. Signaling MDFQVQIFSFLLISASVVMSRG sequence 337. Signaling MDRLTSSILLLIVPAYVLS sequence 338. Signaling MRAHTQFIGLLWLWFAGARC sequence 339. Signaling MEWNWVFLFLLSVTAGVHS sequence 340. Signaling MRAHTQFLGFLLLWFPGARC sequence Exemplarylinkersequences 341. Linker (G).sub.n,n>=1 342. Linker (GS).sub.n,8>=n>=1 343. Linker (GSGGS).sub.n,8>=n>=1 344. Linker (GGGGS).sub.n,8>=n>=1 345. Linker (GGGS).sub.n,8>=n>=1 346. Linker (GGGGS).sub.3 347. Linker (GGGGS).sub.6 348. Linker (GSTSGSGKPGSGEGS).sub.n 3>=n>=1 ExemplaryPLA2G2Dsequences 349. HumanPLA2G2D MELALLCGLVVMAGVIPIQGGILNLNKMVKQVTG (withsignal KMPILSYWPYGCHCGLGGRGQPKDATDWCCQTH peptide) DCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKG UniProtKB/Swiss- SWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYW Prot:Q9UNK4.2 RPHCRGQTPGC 350. HumanPLA2G2D GILNLNKMVKQVTGKMPILSYWPYGCHCGLGGR (withoutsignal GQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYY peptide) RYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLK GenBank: RNLDTYQKRLRFYWRPHCRGQTPGC EAW94915.1 351. PLA2G2DH67A MELALLCGLVVMAGVIPIQGGILNLNKMVKQVTG (withsignal KMPILSYWPYGCHCGLGGRGQPKDATDWCCQTA peptide) DCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKG SWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYW RPHCRGQTGC 352. PLA2G2DH47A GILNLNKMVKQVTGKMPILSYWPYGCHCGLGGR (withoutsignal GQPKDATDWCCQTADCCYDHLKTQGCSIYKDYY peptide) RYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLK RNLDTYQKRLRFYWRPHCRGQTGC 353. HumanPLA2G2D MELALLCGLVVMAGVIPIQGGILNLNKMVKQVTG GenBenk: KMPILSYWPYGCHCGLGGRGQPKDATDWCCQTH AAQ88969.1 DCCYDHLKTQGCGIYKDNNKSSIHCMDLSQRYCL MAVENVIYLENEDSE 354. PLA2G2D GILNLNKMVKQVTGKMPILSYWPYGCHCGLGGR (withoutsignal GQPKDATDWCCQTHDCCYDHLKTQGCGIYKDNN peptide) KSSIHCMDLSQRYCLMAVENVIYLENEDSE 355. Exemplary MKFSWVIFFLMAVVTGVNSE Signaling sequence