LTBP COMPLEX-SPECIFIC INHIBITORS OF TGFb1 AND USES THEREOF

20240301073 ยท 2024-09-12

    Inventors

    Cpc classification

    International classification

    Abstract

    The invention provides method of treating fibrosis, comprising the steps of (a) selecting a TGF? inhibitor for the treatment of fibrosis, (1) wherein the TGF? inhibitor (A) specifically binds a LTBP1-proTGF? complex; (B) does not bind a human GARP-proTGF? complex; (C) does not bind a human LRRC33-proTGFp complex; and (D) does not bind mature TGF?1, mature TGF?2 or mature TGF?3; and (2) wherein the TGF? inhibitor is selected using an assay to measure the amount of a marker, wherein the amount of the marker is indicative of the treatment of fibrosis, with the proviso that the marker is not pSmad2; and (b) providing the selected TGF? inhibitor for administration to a subject in need of treatment for fibrosis. These selected TGF? inhibitor are isoform-specific, context-selective inhibitors of TGF?1 that selectively target matrix-associated TGF?1 activation but not immune cell-associated TGF?1 activation.

    Claims

    1. A LTBP-selective TGF?1 inhibitor for use in the treatment of an inflammatory fibrotic disease in a subject, wherein the treatment comprises administration of an effective amount of a LTBP-selective TGF?1 inhibitor to the subject, wherein the LTBP-selective TGF?1 inhibitor is: a) an antibody or antigen-binding fragment thereof comprising the following six CDRs: (1) CDR-H1 comprising the amino acid sequence FTFRSYVMH (SEQ ID NO: 1); (2) CDR-H2 comprising the amino acid sequence VISHEGSLKYYADSVKG (SEQ ID NO: 2); (3) CDR-H3 comprising the amino acid sequence ARPRIAARRGGFGY (SEQ ID NO: 3); (4) CDR-L1 comprising the amino acid sequence TRSSGNIDNNYVQ (SEQ ID NO: 4); (5) CDR-L2 comprising the amino acid sequence EDNQRPS (SEQ ID NO: 5); and (6) CDR-L3 comprising the amino acid sequence QSYDYDTQGVV (SEQ ID NO: 6); b) an antibody that is not Ab42 and comprises a VH and a VL each of which has at least 90% sequence identity to SEQ ID NO: 7 and SEQ ID NO: 8, respectively, and binds human LTBP1-proTGF?1 and human LTBP3-proTGF?1 with a K.sub.D of 10 nM or less as measured by a surface plasmon resonance (SPR)-based assay (such as BIACORE); c) an antibody that is not Ab42 and competes for antigen binding with SR42 and binds an epitope comprising one or more amino acid residues of the sequence DMELVKRKRIEAIR (SEQ ID NO: 46), wherein optionally the antibody contacts one or more of the residues: Asp27 (D); Leu30 (L); Arg33 (R); Ile36 (I); Glu37 (E); or, d) an antibody that is not Ab42 and competes for antigen binding with SR42 and binds an epitope comprising one or more amino acid residues of the sequence YIDFRKDLGWK (SEQ ID NO: 93), wherein optionally the antibody contacts one or more of the residues: Tyr289 (Y); Lys294 (K); Asp295 (D); wherein the antibody binds recombinant human LTBP1-proTGF?1 and/or recombinant human LTBP3-proTGF?1 with at least 50-fold greater affinities over recombinant human GARP-proTGF?1 as measured in an in vitro binding assay.

    2. The LTBP-selective TGF?1 inhibitor for use according to claim 1, wherein the inflammatory fibrotic disease is a viral infection, wherein optionally the viral infection is a severe acute respiratory syndrome; wherein further optionally the severe acute respiratory syndrome is SARS-CoV (e.g., SARS-CoV1) or COVID19 (SARS-CoV2).

    3. The LTBP-selective TGF?1 inhibitor for use according to claim 1, wherein the inflammatory fibrotic disease is a chronic kidney disease (CKD), a chronic lung disease, a chronic liver disease, diabetes, muscle disease, systemic sclerosis, cancer, and/or genotoxic therapy-induced inflammation.

    4. The LTBP-selective TGF?1 inhibitor for use according to claim 3, wherein the chronic kidney disease is diabetic nephropathy, renal fibrosis, and/or Alport syndrome.

    5. The LTBP-selective TGF?1 inhibitor for use according to claim 3, wherein the chronic liver disease is non-alcoholic fatty liver disease (NAFLD), e.g., non-alcoholic fatty liver (NAFL) and non-alcoholic steatohepatitis (NASH), which may include: noncirrhotic NASH with liver fibrosis, liver cirrhosis, NASH with compensated cirrhosis, NASH with decompensated cirrhosis, liver inflammation with fibrosis, liver inflammation without fibrosis; stage 2 and 3 liver fibrosis, stage 4 fibrosis (NASH cirrhosis or cirrhotic NASH with fibrosis), primary biliary cholangitis (PBC) (formerly known as primary biliary cirrhosis), and/or primary sclerosing cholangitis (PSC), wherein optionally the subject has or is at risk of developing obesity, metabolic syndrome, and/or type 2 diabetes.

    6. The LTBP-selective TGF?1 inhibitor for use according to claim 5, wherein the LTBP-selective TGF?1 inhibitor is used in conjunction with another therapy comprising a myostatin inhibitor and/or a GLP-1 receptor agonist.

    7. The LTBP-selective TGF?1 inhibitor for use according to claim 6, wherein the myostatin inhibitor is a myostatin-selective inhibitor, wherein optionally the myostatin-selective inhibitor is apitegromab, GYM329, trevogromab, or a variant thereof.

    8. The LTBP-selective TGF?1 inhibitor for use according to claim 6, wherein the myostatin inhibitor is a non-selective myostatin inhibitor, wherein optionally the non-selective myostatin inhibitor is an antibody that binds ActRII (e.g., bimagromab), a ligand trap, or an anti-myostatin Adnectin (e.g., BMS-986089.

    9. The LTBP-selective TGF?1 inhibitor for use according to claim 3, wherein the diabetes is type 1 diabetes or type 2 diabetes.

    10. The LTBP-selective TGF?1 inhibitor for use according to claim 3, wherein the chronic lung disease is IPF, infection, and/or radiation-induced pulmonary fibrosis.

    11. The LTBP-selective TGF?1 inhibitor for use according to claim 3, wherein the muscle disease is a dystrophy, wherein optionally the dystrophy is DMD, wherein further optionally the subject is treated with a dystrophin-directed therapy.

    12. The LTBP-selective TGF?1 inhibitor for use according to claim 3, wherein the cancer comprises a fibrotic solid tumor (e.g., desmoplasia).

    13. The LTBP-selective TGF?1 inhibitor for use according to any one of the previous claims, wherein the subject is treated with a genotoxic therapy, wherein the genotoxic therapy-induced inflammation is radiation therapy-induced inflammation or chemotherapy-induced inflammation, wherein optionally, the subject has cancer selected from: uterine corpus endometrial carcinoma (UCEC), thyroid carcinoma (THCA), testicular germ cell tumors (TGCT), skin cutaneous melanoma (SKCM), prostate adenocarcinoma (PRAD), ovarian serous cystadenocarcinoma (OV), lung squamous cell carcinoma (LUSC), lung adenocarcinoma (LUAD), liver hepatocellular carcinoma (LIHC), kidney renal clear cell carcinoma (KIRC), head and neck squamous cell carcinoma (HNSC), glioblastoma multiforme (GMB), esophageal carcinoma (ESCA), colon adenocarcinoma (COAD), breast invasive carcinoma (BRCA), bladder urothelial carcinoma (BLCA), myelofibrosis, melanoma, adjuvant melanoma, renal cell carcinoma (RCC) (e.g., clear cell RCC, papillary RCC, chromophobe RCC, collecting duct RCC, and unclassified RCC), bladder cancer, colorectal cancer (CRC) (e.g., microsatellite-stable CRC, mismatch repair deficient colorectal cancer), colon cancer, rectal cancer, anal cancer, breast cancer, triple-negative breast cancer (TNBC), HER2-negative breast cancer, HER2-positive breast cancer, BRCA-mutated breast cancer, hematologic malignancies, non-small cell carcinoma, non-small cell lung cancer/carcinoma (NSCLC), small cell lung cancer/carcinoma (SCLC), extensive-stage small cell lung cancer (ES-SCLC), lymphoma (classical Hodgkin's and non-Hodgkin's), primary mediastinal large B-cell lymphoma (PMBCL), T-cell lymphoma, diffuse large B-cell lymphoma, histiocytic sarcoma, follicular dendritic cell sarcoma, interdigitating dendritic cell sarcoma, myeloma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), small lymphocytic lymphoma (SLL), head and neck cancer (e.g., head and neck squamous cell cancer), urothelial cancer e.g., metastatic urothelial carcinoma), merkel cell carcinoma (e.g., metastatic merkel cell carcinoma), merkel cell skin cancer, cancer with high microsatellite instability (MSI-H), cancer with mismatch repair deficiency (dMMR), tumor mutation burden high cancer, mesothelioma (e.g., malignant pleural mesothelioma), gastric cancer, gastroesophageal junction cancer (GEJ), gastric adenocarcinoma, neuroendocrine tumors, gastrointestinal stromal tumors (GIST), gastric cardia adenocarcinoma, renal cancer, biliary cancer, cholangiocarcinoma, pancreatic cancer, prostate cancer, adenocarcinoma, squamous cell carcinoma, non-squamous cell carcinoma, cutaneous squamous cell carcinoma (CSCC), ovarian cancer, endometrial cancer, fallopian tube cancer, cervical cancer, peritoneal cancer, stomach cancer, brain cancers, malignant glioma, glioblastoma, gliosarcoma, neuroblastoma, thyroid cancer, adrenocortical carcinoma, oral intra-epithelial neoplasia, esophageal cancer, nasal cavity and paranasal sinus squamous cell carcinoma, nasopharynx carcinoma, salivary gland cancer, liver cancer, basal cell carcinoma, and hepatocellular cancer (HCC).

    14. The LTBP-selective TGF?1 inhibitor for use according to any one of the preceding claims, wherein the subject is treated with a Treg-enhancing agent, wherein optionally the Treg-enhancing agent comprises all-trans retinoic acid (ATRA), vitamin D3, indoleamine-pyrrole 2,3-dioxygenase (IDO), short-chain fatty acids (e.g., butyrate), and/or AKT/mTOR pathway inhibitors such as rapamycin.

    15. The LTBP-selective TGF?1 inhibitor for use according to any one of the preceding claims, wherein the LTBP-selective TGF?1 inhibitor is administered in an amount sufficient to achieve a serum concentration of about 100-300 ?g/mL.

    16. A pharmaceutical composition comprising an antibody or an antigen-binding fragment thereof that binds recombinant human LTBP1-proTGF?1 and/or recombinant human LTBP3-proTGF?1 with a K.sub.D of 10 nM or less as measured by a SPR-based assay (such as Biacore), wherein the antibody is not Ab42, wherein the antibody competes for antigen binding with SR42 and binds an epitope comprising one or more amino acid residues of the sequence DMELVKRKRIEAIR (SEQ ID NO: 46), wherein optionally the antibody contacts one or more of the residues: Asp27 (D); Leu30 (L); Arg33 (R); Ile36 (I); Glu37 (E).

    17. A pharmaceutical composition comprising an antibody or an antigen-binding fragment thereof that binds recombinant human LTBP1-proTGF?1 and/or recombinant human LTBP3-proTGF?1 with a K.sub.D of 10 nM or less as measured by a SPR-based assay (such as Biacore), wherein the antibody is not Ab42; wherein the antibody competes for antigen binding with SR42 and binds an epitope comprising one or more amino acid residues of the sequence YIDFRKDLGWK (SEQ ID NO: 93), wherein optionally the antibody contacts one or more of the residues: Tyr289 (Y); Lys294 (K); Asp295 (D).

    Description

    BRIEF DESCRIPTION OF THE FIGURES

    [0071] For illustration, some embodiments of the disclosure are shown in the drawings described below. Like numerals in the drawings indicate like elements throughout. The disclosure is not limited to the precise arrangements, dimensions, and instruments shown.

    [0072] FIG. 1(A) and FIG. 1(B) demonstrate that targeting of the latent form of TGF?1 provided isoform and context specificity. FIG. 1(A) shows how LTBP presents TGF? in connective tissue, i.e., extracellular matrix (ECM). As shown in the drawing, TGF? is expressed as part of a large latent complex (LLC). The activation is by integrin-induced traction force. LTBP-presented TGF?1 is a major driver of fibrosis. FIG. 1(B) is a drawing that demonstrates functional assays (potency assays) to detect the inhibition of activated recombinant latent TGF?1. FIG. 1(B) depicts the activation of latent TGF?1 deposited in the extracellular matrix (ECM). In this assay, presenting molecules were co-transfected with TGF?1 in integrin-expressing cells. Transiently transfected cells were seeded in assay plates in the presence of inhibitors. Then, latent LTBP-TGF?1 complex was embedded in the ECM. TGF? reporter cells were added to the system. Free growth factor (released by integrin) signals and was detected by luciferase assay. See WO 2020/160291 A2. Isoform-specific monoclonal antibodies that bind the latent TGF?1 prodomain, with no detectable binding to latent TGF?2 or TGF?3, and that inhibit integrin-mediated activation of latent TGF?1 in vitro with the context-dependency as described therein.

    [0073] FIG. 2 is a set of four graphs showing Ab42 human Fab binding to human TGF?1 complexes: (1) LTBP1-proTGF?, (2) LTBP3-proTGF?, (3) GARP-proTGF?, or (4) LRRC33-proTGF?). As shown in FIG. 2, LTBP-complex antibodies were highly specific and had picomolar monovalent affinities as measured by BIACORE?. Note the low level of binding of Ab42 against both GARP and LRRC33 complexed TGF?1 as shown by the RU values, the Y axis of each graph, and the low responses shown in the bottom two graphs.

    [0074] FIG. 3 is a graph showing that Ab42 was a more potent inhibitor of LTBP TGF?1 activation than a context-independent reference antibody. FIG. 3 shows the results from a CAGA assay with endogenous expression of LTBP, and demonstrated the potent inhibition of Ab42. For a description of a similar assay, see Itoh et al. (2019) A comparative analysis of Smad-responsive motifs identifies multiple regulatory inputs for TGF-? transcriptional activation. Properties of Smad-binding motifs J. Biol. Chem., 294(42), 15466-15479 (Oct. 18, 2019).

    [0075] FIG. 4(A) and FIG. 4(B) are two graphs showing Sprague Dawley Rat serum results after Ab42 exposure at 10 mg/kg administration.

    [0076] FIG. 5(A) and FIG. 5(B) are graphs showing Sprague Dawley Rat serum results after Ab42 exposure at 30 mg/kg administration.

    [0077] FIG. 6 is a dot plot showing Sprague Dawley rat picrosirius red/serum exposure correlation results after Ab42 exposure at 10 mg/kg and 30 mg/kg administration.

    [0078] FIG. 7 is a graph showing individual serum exposures of Ab42 in a previous rat choline-deficient high fat diet (CDHFD) pharmacokinetics (PK)/pharmacodynamics (PD) analysis. A serum exposure of about 340 ?g/ml was required to reduce pSMAD2 in CDHFD livers.

    [0079] FIG. 8 is a bar graph showing that a single dose of Ab42 reduced pSmad2 in a rat choline-deficient high fat diet (CDHFD) PK/PD analysis.

    [0080] FIG. 9 is a graph showing the serum exposure (?g/ml) of Ab42 at two different doses over time.

    [0081] FIG. 10 shows the percent suppression of hydroxyproline. HuNEG=100%, Pre-treatment=0%. * P<0.05. ** P<0.01. *** P<0.001. **** P<0.0001. FIG. 10 shows the results of the correlation of t-test vs. IgG group and t-test versus vehicle (Alk5i).

    [0082] FIG. 11 is a graph showing the results of plasma blood urea nitrogen assay and creatinine assays. Measurements were made through day 56.

    [0083] FIG. 12 is a graph showing the results of a creatinine assay. Measurements were made through day 56.

    [0084] FIG. 13 is a graph showing HYP levels in the liver after treatment in the CDHFD study.

    [0085] Results demonstrated that inhibition of the LTBP arm is just as efficacious as the inhibition of all context-independent inhibitors (see Reference Antibody).

    [0086] FIG. 14 (A)-FIG. 14(C) is a set of graphs showing the ratios of phosphorylated SMAD protein versus total (phosphorylated and unphospohrylated) Smad. FIG. 14(A) is a graph showing relative ratios of phosphorylated versus total (phosphorylated and unphospohrylated) SMAD2/3 (pSMAD2/3:tSMAD2/3) in an Alport mouse model. A single dose of Ab42 was sufficient to significantly inhibit pSmad2/3 signaling in whole kidney lysates. FIG. 14(B) is a graph showing the amount of phosphorylated Smad2/3 (pSmad2/3) as determined by ELISA. FIG. 14(C) is a graph showing the amount of total Smad2/3 (tSmad2/3) protein as determined by ELISA. As shown by FIG. 14(B) and FIG. 14(C), reduction of pSmad was contributing to the change in ratio shown in FIG. 14(A).

    [0087] FIG. 15 shows the results from a Alport syndrome (mouse) kidney fibrosis PK/PD analysis.

    [0088] Eleven-week-old mice were treated with a single dose of antibody. Mouse tissue was collected after forty-eight hours. Treatment with Ab42 significantly reduced pSmad2 in Alport syndrome mouse kidneys.

    [0089] FIG. 16 is a graph showing the serum concentration by hour after administration of Ab42.

    [0090] FIG. 17 is a pair of graphs showing the results of an rat adenine kidney fibrosis PK/PD analysis.

    [0091] FIG. 18 is a pair of graphs showing that the YTE mutation enhanced binding of Ab42 to Hu FcRn. Ab42-YTE HuG4120 nM. Ab42 HuG4860 nM. The YTE mutation enhanced binding to human FcRn dramatically at acidic pH and slightly at neutral pH, as measured by OCTET?.

    [0092] FIG. 19 shows that the introduction of the YTE mutations in Ab42 resulted in a reduced melting temperature. The YTE mutation resulted in a decreased melting temperature.

    [0093] FIG. 20 is a graph showing a similar potency of Ab42 YTE compared to Ab42. The Ab42 and Ab42-YTE lots showed comparable activity compared with a DS210209B positive control.

    [0094] FIG. 21 is a panel of graphs that show treatment with Ab42 reduced plasma BUN and creatinine in adenine fed rats.

    [0095] FIG. 22 is a graph that shows the results of an immunohistochemical (IHC) analysis that was carried out to determine the amount of phosphorylated Smad2 (active Smad2) in fibrotic kidney samples after treatment with Ab42.

    [0096] FIG. 23A shows the average serum exposure for Ab42 using a loading dose strategy. FIG. 23B shows the PSR/serum exposure correlation for Ab42 using a loading dose strategy.

    [0097] FIG. 24 is a graph that shows exposure with Ab42 was dose-proportional and maintained across all time points.

    [0098] FIGS. 25A and 25B show the results of immunohistochemical (IHC) analysis to determine the amount of phosphorylated Smad2 (active Smad2) in fibrotic kidney samples after treatment with Ab42.

    [0099] FIG. 26 is a graph that shows treatment with Ab42 reduced expression of certain TGF? related genes in the adenine model.

    [0100] FIG. 27 is a graph that shows a strong induction of profibrotic gene expression in the adenine model, and a reduction of pro-fibrotic genes with treatment with LTBP-TGF?1 specific inhibitor Ab42.

    [0101] FIG. 28 is a graph that shows relative gene expression of certain pro-inflammatory genes in the adenine model.

    [0102] FIG. 29 is a graph that shows relative gene expression of TNF? and TGF? ligands.

    [0103] FIG. 30 is a graph that shows relative gene expression of LTBP1, LRRC33 and Col3A1.

    [0104] FIG. 31 is a graph that shows relative gene expression of KIM1 and LNC2.

    [0105] FIG. 32 is a graph that shows relative gene expression of FN1 over time.

    [0106] FIG. 33 is a graph that shows relative gene expression of Col3A1 over time.

    [0107] FIG. 34 is a graph that shows relative gene expression of IL-1? over time.

    [0108] FIG. 35 is a graph that shows relative gene expression of IL-6 over time.

    [0109] FIG. 36 is a graph that shows relative gene expression of GARP over time.

    [0110] FIG. 37 is a graph that shows relative gene expression of LTBP1 over time.

    [0111] FIG. 38 is a graph that shows relative gene expression of THBS over time.

    [0112] FIG. 39 is a graph that shows relative gene expression of col1a11 over time.

    [0113] FIG. 40 is a graph that shows relative gene expression of CD68 over time.

    [0114] FIG. 41 is a graph that shows relative gene expression of Loxl2 over time.

    [0115] FIG. 42 is a graph that shows relative gene expression of MMP2 over time.

    [0116] FIG. 43 is a graph that shows relative gene expression of MMP9 over time.

    [0117] FIG. 44 is a graph that shows relative gene expression of KIM1 over time.

    [0118] FIG. 45 is a graph that shows relative gene expression of LRRC33 over time.

    [0119] FIG. 46 is a graph that shows relative gene expression of TNF? over time.

    [0120] FIG. 47 is a graph that shows cell viability using the resazurin assay at endpoint.

    [0121] FIG. 48 is a graph measuring lactate dehydrogenase levels in supernatant at each timepoint.

    [0122] FIG. 49 is a graph that shows results from the study described in Example 15. Group averaged PK data up to day 72 is shown.

    [0123] FIG. 50 is a graph that shows PK data for individual animals from the study described in Example 15.

    DETAILED DESCRIPTION OF THE DISCLOSURE

    [0124] The present disclosure provides compositions and methods that are useful for reducing activation of a subset of TGF?1. More specifically, potent antibodies or fragments thereof capable of selectively targeting and inhibiting LTBP1/3-associated proTGF?1 are used in the treatment of TGF?-associated disease in a human subject. Inhibitors that target latent proTGF?1 complexes, upstream of growth factor-receptor interaction, are generally referred to as activation inhibitors of TGF?1.

    [0125] To date, four presenting molecules for TGF? have been identified: latent TGF beta-binding protein 1 (LTBP1), latent TGF beta-binding protein 3 (LTBP3), glycoprotein A repetitions predominant (GARP) and leucine-rich repeat-containing protein 33 (LRRC33). Each of these presenting molecules can form disulfide bonds with a homodimeric pro-protein complex of the TGF?1 precursor, i.e., proTGF?1. The proTGF?1 complex remains dormant (latent) in the respective extracellular niche (e.g., ECM and immune cell surface) until activation events trigger the release of soluble growth factor from the complex.

    [0126] As compared to the TGF? growth factors and the receptors, which are expressed broadly, the presenting molecules show more restricted or selective (e.g., tissue-specific) expression patterns, giving rise to functional compartmentalization of TGF?1 activities by virtue of association. The four presenting molecule-proTGF?1 complexes, namely, LTBP1-proTGF?1, LTBP3-proTGF?1, GARP-proTGF?1 and LRRC33-proTGF?1, therefore, provide discrete contexts of TGF?1 signaling within the tissue in which the presenting molecules are expressed. These contexts may be divided into two broad categories: i) TGF?1 signaling associated with the ECM (e.g., matrix-associated TGF?1 function); and ii) TGF?1 signaling associated with cells (particularly certain immune cell function). The LTBP1-proTGF?1 and LTBP3-proTGF?1 complexes fall under the first category, while GARP-proTGF?1 and LRRC33-proTGF?1 complexes fall under the second category. Thus, disclosed herein are isoform-selective inhibitors of TGF?1 that are capable of selectively inhibiting the activation of TGF?1 that is associated with the ECM.

    [0127] In preferred embodiments, the TGF?1 inhibitor is Ab42 or a variant thereof. Alternatively, in some embodiments, the TGF?1 inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the N-terminal stretch of amino acids DMELVKRKRIEAIR (SEQ ID NO: 46) within the so-called alpha-1 helix region of the prodomain of the latent proTGF?1 complex. In some embodiments, the antibody or the fragment contacts one or more of the following residues within the prodomain: Asp27 (D); Leu30 (L); Arg33 (R); Ile36 (I); Glu37 (E) (shown in bold above). Additionally or alternatively, in some embodiments, the inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the amino acid sequence YIDFRKDLGWK (SEQ ID NO: 93) within the TGF?1 growth factor domain (e.g., the finger-1 domain). In some embodiments, the antibody or fragment thereof contacts one or more of the following residues: Tyr289 (Y); Lys294 (K); Asp295 (D) (shown in bold above). In some embodiments, such antibody binds a conformational epitope comprising one or more residues of DMELVKRKRIEAIR (SEQ ID NO: 46) and one or more residues of YIDFRKDLGWK (SEQ ID NO: 93), wherein the antibody is not Ab42.

    [0128] In exemplary embodiments, the compositions described herein are useful for selectively reducing activation of TGF?1 in the context of an LTBP protein, e.g., a LTBP1 and/or a LTBP3 protein. Such compositions advantageously inhibit activation of extracellular matrix-associated TGF?31, without inhibiting TGF?1 in the context of the immune-associated TGF?1 presenting molecules GARP and LRRC33. The compositions described herein are useful for treating disorders associated with TGF?1 activation, particularly fibrotic disorders, such as scleroderma, Alport syndrome, IPF and DMD. Accordingly, in embodiments, the disclosure provides compositions for reducing activation of TGF?1, methods of use thereof, methods of manufacture, and treatment methods. Methods of selecting a TGF?1 inhibitor for subjects exhibiting symptoms of a fibrotic disorder are also provided.

    [0129] In some embodiments, the disclosure provides compositions for reducing activation of TGF?1, in a subject with scleroderma.

    [0130] In some embodiments, the disclosure provides compositions for reducing activation of TGF?1, in a subject with Alport syndrome.

    [0131] The rationale for the therapeutic use of a TGF?1 inhibitor that does not target the GARP-proTGF?1 complex on regulatory T cells is at least threefold:

    [0132] First, regulatory T cells play a crucial role in maintaining immune tolerance to self-antigens and in preventing autoimmune disease. Since Tregs generally suppress, dampen or downregulate induction and proliferation of effector T cells, systemic inhibition of this function may lead to overactive or exaggerated immune responses in the host by disabling the break that is normally provided by Treg cells. The approach of TGF?1 inhibition without disabling Treg function is aimed to avoid the risk of eliciting autoimmunity. Furthermore, patients who already have a propensity for developing over-sensitive immune responses or autoimmunity may be particularly at risk of triggering or exacerbating such conditions, without the availability of normal Treg function; and therefore, the inhibitors that selectively target the matrix TGF?1 may advantageously minimize such risk.

    [0133] Second, evidence suggests that an alteration in the Th17/Treg ratio leads to an imbalance in pro-fibrotic Th17 cytokines, which correlate with severity of fibrosis, such as liver fibrosis. The perturbation of the GARP arm of TGF?1 function may directly or indirectly exacerbate fibrotic conditions.

    [0134] Third, regulatory T cells are indispensable for immune homeostasis and the prevention of autoimmunity. Particularly for a TGF?1 inhibition therapy intended for a long-term or chronic administration, it would be desirable to avoid potential side effects stemming from perturbation of normal Treg function in maintaining immune homeostasis. This strategy preserves normal immune function, which is required, inter alia, for combatting infections.

    [0135] The disclosure described herein does not concern a process for cloning humans, processes for modifying the germ line genetic identity of humans, uses of human embryos for industrial or commercial purposes or processes for modifying the genetic identity of animals which are likely to cause them suffering with no substantial medical benefit to man or animal, and also animals resulting from such processes.

    Definitions

    [0136] In order that the disclosure may be more readily understood, certain terms are first defined. These definitions should be read in light of the remainder of the disclosure and as understood by a person of ordinary skill in the art. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by a person of ordinary skill in the art. Additional definitions are set forth throughout the detailed description.

    [0137] Advanced fibrosis: the term advanced fibrosis as used herein has the meaning understood in the pertinent art, e.g., as understood by a physician in the context of diagnosing or treating subjects/patients with a fibrotic disease or disorder. As used herein, the term has the medical art-recognized meaning. Subjects suffer from advanced fibrosis if they have an advanced stage of a fibrotic disorder, particularly organ fibrosis, which renders the patients a candidate for receiving, or in need of, an allograft transplant.

    [0138] Affinity maturation: has the immunological art-recognized meaning of a type of antibody optimization and is a process of improving the affinity of an antibody or a fragment to its antigen and typically involves making one or more changes to the amino acid sequence of the antibody or the fragment to achieve greater affinity. Typically, a parental antibody and an affinity-matured counterpart retain the same epitope. Affinity maturation may include diversification or mutagenesis of one or more CDR sequences.

    [0139] Affinity: Affinity is the strength of binding of a molecule (such as an antibody) to its ligand (such as an antigen). It is typically measured and reported by the equilibrium dissociation constant (KD). In the context of antibody-antigen interactions, KD is the ratio of the antibody dissociation rate (off rate or Koff or Kdis), how quickly it dissociates from its antigen, to the antibody association rate (on rate or Kon) of the antibody, how quickly it binds to its antigen. For example, an antibody with an affinity of ?5 nM has a KD value that is 5 nM or lower (i.e., 5 nM or higher affinity) determined by a suitable in vitro binding assay. Suitable in vitro assays can be used to measure KD values of an antibody for its antigen, such as Biolayer Interferometry (BLI) and Solution Equilibrium Titration (e.g., MSD-SET). The Ab42 in vitro binding assay results provided in the EXAMPLES below showed high-affinity (low K.sub.D value) binding.

    [0140] Alport syndrome: has the medical art-recognized meaning of a genetic disorder characterized by glomerulonephritis, end-stage kidney disease, and hearing loss. Blood in urine is universal. Proteinuria is a feature as kidney disease progresses. Alport syndrome is caused by an inherited defect in type IV collagena structural material that is needed for the normal function of different parts of the body. Mouse models exist that have genetic mutations characteristic of Alport syndrome.

    [0141] Antibody: The term antibody encompasses any naturally-occurring, recombinant, modified or engineered immunoglobulin or immunoglobulin-like structure or antigen-binding fragment or portion thereof, or derivative thereof, as further described elsewhere herein. Unless specified to the contrary, the term antigen as used herein shall encompass antigen-binding fragments and functional variants thereof. Thus, the term refers to an immunoglobulin molecule that specifically binds to a target antigen, and includes, for instance, chimeric, humanized, fully human, and bispecific antibodies. An intact antibody will generally comprise at least two full-length heavy chains and two full-length light chains, but in some instances can include fewer chains such as antibodies naturally occurring in camelids which can comprise only heavy chains. Antibodies can be derived solely from a single source, or can be chimeric, that is, different portions of the antibody can be derived from two different antibodies. Antibodies, or antigen-binding portions thereof, can be produced in hybridomas, by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact antibodies. The term antibodies, as used herein, includes monoclonal antibodies, bispecific antibodies, minibodies, domain antibodies, synthetic antibodies (sometimes referred to herein as antibody mimetics), chimeric antibodies, humanized antibodies, human antibodies, antibody fusions (sometimes referred to herein as antibody conjugates), respectively. In some embodiments, the term also encompasses peptibodies.

    [0142] Antigen: The term antigen broadly includes any molecules comprising an antigenic determinant within a binding region(s) to which an antibody or a binding-fragment specifically binds. An antigen can be a single-unit molecule (such as a protein monomer or a fragment) or a complex comprised of multiple components. An antigen provides an epitope, e.g., a molecule or a portion of a molecule, or a complex of molecules or portions of molecules, capable of being bound by a selective binding agent, such as an antigen-binding protein (including, e.g., an antibody). Thus, a selective binding agent may specifically bind to an antigen that is formed by two or more components in a complex. In some embodiments, the antigen is capable of being used in an animal to produce antibodies capable of binding to that antigen. An antigen can possess one or more epitopes that are capable of interacting with different antigen-binding proteins, e.g., antibodies. In the context of the present disclosure, a suitable antigen is a complex (e.g., multimeric complex comprised of multiple components in association) containing a proTGF dimer in association with a presenting molecule. Each monomer of the proTGF dimer comprises a prodomain and a growth factor domain, separated by a furin cleavage sequence. Two such monomers form the proTGF dimer complex. This in turn is covalently associated with a presenting molecule via disulfide bonds, which involve a cysteine residue present near the N-terminus of each of the proTGF monomer. This multi-complex formed by a proTGF dimer bound to a presenting molecule is generally referred to as a large latent complex. An antigen complex suitable for screening antibodies or antigen-binding fragments, for example, includes a presenting molecule component of a large latent complex. Such presenting molecule component may be a full-length presenting molecule or a fragment(s) thereof. Minimum required portions of the presenting molecule typically contain at least 50 amino acids, but more preferably at least 100 amino acids of the presenting molecule polypeptide, which comprises two cysteine residues capable of forming covalent bonds with the proTGF?1 dimer.

    [0143] Antigen-binding portion/fragment: The terms antigen-binding portion or antigen-binding fragment of an antibody, as used herein, refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., TGF?1). Antigen-binding portions include, but are not limited to, any naturally occurring, enzymatically obtainable, synthetic, or genetically engineered polypeptide or glycoprotein that specifically binds an antigen to form a complex. In some embodiments, an antigen-binding portion of an antibody may be derived, e.g., from full antibody molecules using any suitable standard techniques such as proteolytic digestion or recombinant genetic engineering techniques involving the manipulation and expression of DNA encoding antibody variable and optionally constant domains. Non-limiting examples of antigen-binding portions include: (i) Fab fragments, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) F(ab)2 fragments, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) Fd fragments consisting of the VH and CH1 domains; (iv) Fv fragments consisting of the VL and VH domains of a single arm of an antibody; (v) single-chain Fv (scFv) molecules (see, e.g., Bird et al., (1988) Science 242:423-426; and Huston et al., (1988) Proc. Nat'l. Acad. Sci. USA 85:5879-5883); (vi) dAb fragments (see, e.g., Ward et al., (1989) Nature 341: 544-546); and (vii) minimal recognition units consisting of the amino acid residues that mimic the hypervariable region of an antibody (e.g., an isolated complementarity determining region (CDR)). Other forms of single chain antibodies, such as diabodies are also encompassed. The term antigen-binding portion of an antibody includes a single chain Fab fragment otherwise known as an scFab, comprising an antibody heavy chain variable domain (VH), an antibody constant domain 1 (CH1), an antibody light chain variable domain (VL), an antibody light chain constant domain (CL) and a linker, wherein said antibody domains and said linker have one of the following orders in N-terminal to C-terminal direction: a) VH-CH1-linker-VL-CL, b) VL-CL-linker-VH-CH1, c) VH-CL-linker-VL-CH1 or d) VL-CH1-linker-VH-CL; and wherein said linker is a polypeptide of at least 30 amino acids, preferably between 32 and 50 amino acids.

    [0144] As needed: in the context of pharmaceutical dosing regimens, means that the dosing regimen is not based on a predetermined dosing schedule but instead based on one or more parameters or markers measured or monitored periodically during treatment, which provides information or guidance as to whether additional doses should be beneficial to the subject/patient. For instance, a pharmaceutical composition comprising a TGF? inhibitor such as TGF?1/2/3 inhibitors (pan inhibitors), TGF?1/2 inhibitors and TGF?1/3 inhibitors, may be administered, intermittently, on an as needed basis in a therapeutically effective amount sufficient to achieve or maintain clinical benefit, e.g., reduction of one or more clinical markers of fibrosis. In forty-first embodiment, administration of a LTBP-complex selective TGF? inhibitor, such as Ab42, can be used in combination with a method of determining or monitoring therapeutic efficacy. The LTBP-complex selective TGF? inhibitor is administered in patients only when clinical benefit from additional doses of the TGF? inhibitor is expected. It is contemplated that, in order to manage toxicities, intermittent or as-needed dosing regimen may be required more frequently with isoform-non-selective inhibitors of TGF?, as compared to TGF?1-selective inhibitors, such as those disclosed herein.

    [0145] Autoimmune disease: has the immunological art-recognized meaning of a condition arising from an abnormal or overactive immune response to a normal body part. Immunostimulating agents administered to such patients with autoimmune conditions may exacerbate the condition.

    [0146] Bias: In the context of the present disclosure, the term bias refers to skewed or uneven affinity towards or against a subset of antigens to which an antibody is capable of specifically binding. For example, an antibody is said to have bias when the affinity for one antigen complex and the affinity for another antigen complex are not equivalent (e.g., more than five-fold difference in affinity). Preferred antibodies of the present disclosure include matrix-biased (or LTBP-biased) antibodies, which preferentially bind EMC-associated complexes (LTBP1-proTGF?1 and LTBP3-proTGF?), such that relative affinities between at least one of the matrix-associated complexes and at least one of the cell-associated complexes (GARP-proTGF?1 and/or LRRC33-proTGF?1 complexes) is greater than five-fold. By comparison, antibodies characterized as unbiased have approximately equivalent affinities towards such antigen complexes (e.g., less than five-fold difference in affinity).

    [0147] Binding region: As used herein, a binding region is a portion of an antigen (e.g., an antigen complex) that, when bound to an antibody or a fragment thereof, can form an interface of the antibody-antigen interaction. Upon antibody binding, a binding region becomes protected from surface exposure, which can be detected by suitable techniques, such as HDX-MS. Antibody-antigen interaction may be mediated via multiple (e.g., two or more) binding regions. A binding region can comprise an antigenic determinant, or epitope.

    [0148] Bio-Layer Interferometry (BLI): is a label-free technology for optically measuring biomolecular interactions, e.g., between a ligand immobilized on the biosensor tip surface and an analyte in solution. Bio-layer interferometry provides the ability to monitor binding specificity, rates of association and dissociation, or concentration, with precision and accuracy. Bio-layer interferometry platform instruments are commercially available, e.g., from ForteBio and are known as the OCTET? System. Bio-layer interferometry can carry out in vitro binding assays as described herein.

    [0149] Cell-associated TGF?1/proTGF?1: The term refers to TGF?1 or its signaling complex (e.g., pro/latent TGF?1) that is membrane-bound (e.g., tethered to cell surface). Typically, such cell is an immune cell. TGF?1 that is presented by GARP or LRRC33 is a cell-associated TGF?1. GARP and LRRC33 are transmembrane presenting molecules that are expressed on cell surface of certain cells. GARP-proTGF?1 and LRRC33-proTGF?1 may be collectively referred to as cell-associated (or cell-surface) proTGF?1 complexes, that mediate cell-associated (e.g., immune cell-associated) TGF?1 activation/signaling. The term also includes recombinant, purified GARP-proTGF?1 and LRRC33-proTGF?1 complexes in solution (e.g., in vitro assays) which are not physically attached to cell membranes. Average K.sub.D values of an antibody (or its fragment) to a GARP-proTGF?1 complex and an LRRC33-proTGF?1 complex may be calculated to collectively represent affinities for cell-associated (e.g., immune cell-associated) proTGF?1 complexes. See, for example, Table, column (G). Human counterpart of a presenting molecule or presenting molecule complex may be indicated by an h preceding the protein or protein complex, e.g., hGARP, hGARP-proTGF?1, hLRRC33 and hLRRC33-proTGF?1.

    [0150] Chronic inflammation: The term chronic inflammation as used herein has the medical art-recognized meaning. Fibrotic disorders that involve chronic inflammation are characterized by continuous or persistent injury to a tissue such that it does not resolve in normal healing after an initial injury. Chronic inflammation refers to a prolonged inflammatory response that involves a progressive change in the type of cells present at the site of inflammation, e.g., fibrotic tissues. Chronic inflammation is characterized by the simultaneous destruction and repair of the tissue from the inflammatory process and can follow an acute form of inflammation or be a prolonged low-grade form.

    [0151] Clinical benefit: As used herein, the term clinical benefits is intended to include both efficacy and safety of a therapy. Thus, therapeutic treatment that achieves a desirable clinical benefit is both efficacious and safe (e.g., with tolerable or acceptable toxicities or adverse events).

    [0152] Combination therapy: Combination therapy refers to treatment regimens for a clinical indication that comprise two or more therapeutic agents. Thus, the term refers to a therapeutic regimen in which a first therapy comprising a first composition (e.g., active ingredient) is administered in conjunction with a second therapy comprising a second composition (active ingredient) to a patient, intended to treat the same or overlapping disease or clinical condition. The first and second compositions may both act on the same cellular target, or discrete cellular targets. The phrase in conjunction with, in the context of combination therapies, means that therapeutic effects of a first therapy overlaps temporarily and/or spatially with therapeutic effects of a second therapy in the subject receiving the combination therapy. Thus, the combination therapies may be formulated as a single formulation for concurrent administration, or as separate formulations, for sequential administration of the therapies. When a subject who has been treated with a first therapy (e.g., background therapy) for the treatment of a disease is administered with a second therapy to treat the same disease, the second therapy may be referred to as an add-on therapy or adjunct therapy. In preferred embodiments, combination therapy or adjunct therapy can produce a synergistic effect such that clinical benefits from both therapies are greater than a sum of clinical benefits from each of the therapies alone,

    [0153] Combinatory or combinatorial epitope: A combinatorial epitope is an epitope that is recognized and bound by a combinatorial antibody at a site (i.e., antigenic determinant) formed by non-contiguous portions of a component or components of an antigen, which, in a three-dimensional structure, come together in close proximity to form the epitope. Thus, antibodies of the disclosure may bind an epitope formed by two or more components (e.g., portions or segments) of a pro/latent TGF?1 complex. A combinatory epitope may comprise amino acid residue(s) from a first component of the complex, and amino acid residue(s) from a second component of the complex, and so on. Each component may be of a single protein or of two or more proteins of an antigenic complex. A combinatory epitope is formed with structural contributions from two or more components (e.g., portions or segments, such as amino acid residues) of an antigen or antigen complex.

    [0154] Compete or cross-compete: The term compete when used in the context of antigen-binding proteins (e.g., an antibody or antigen-binding portion thereof) that compete for the same epitope means competition between antigen-binding proteins as determined by an assay in which the antigen-binding protein being tested prevents or inhibits (e.g., reduces) specific binding of a reference antigen-binding protein to a common antigen (e.g., TGF?1 or a fragment thereof). Numerous types of competitive binding assays can be used to determine if one antigen-binding protein competes with another, for example: solid phase direct or indirect radioimmunoassay (RIA), solid phase direct or indirect enzyme immunoassay (EIA), sandwich competition assay; solid phase direct biotin-avidin EIA; solid phase direct labeled assay, and solid phase direct labeled sandwich assay. Usually, when a competing antigen-binding protein is present in excess, it will inhibit (e.g., reduce) specific binding of a reference antigen-binding protein to a common antigen by at least 40-45%, 45-50%, 50-55%, 55-60%, 60-65%, 65-70%, 70-75% or 75% or more. In some instances, binding is inhibited by at least 80-85%, 85-90%, 90-95%, 95-97%, or 97% or more. In some instances, binding is inhibited by at least 80-90%, at least 85%-95%, at least 95-99%. In some instances, binding is inhibited by at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more. In some embodiments, a first antibody or antigen-binding portion thereof and a second antibody or antigen-binding portion thereof cross-block with each other with respect to the same antigen, for example, as assayed by BLI (such as BIACORE? or OCTET?), using standard test conditions, e.g., according to the manufacturer's instructions (e.g., binding assayed at room temperature, ?20-25? C.). In some embodiments, the first antibody or fragment thereof and the second antibody or fragment thereof may have the same epitope. In other embodiments, the first antibody or fragment thereof and the second antibody or fragment thereof may have non-identical but overlapping epitopes. In yet further embodiments, the first antibody or fragment thereof and the second antibody or fragment thereof may have separate (different) epitopes which are in close proximity in a three-dimensional space, such that antibody binding is cross-blocked via steric hindrance. Cross-block means that binding of the first antibody to an antigen prevents binding of the second antibody to the same antigen, and similarly, binding of the second antibody to an antigen prevents binding of the first antibody to the same antigen.

    [0155] Complementary determining region (CDR): As used herein, the term CDR refers to the complementarity determining region within antibody variable sequences. There are three CDRs in each of the variable regions of the heavy chain and the light chain, which are designated CDR1, CDR2 and CDR3, for each of the variable regions. The term CDR set as used herein refers to a group of three CDRs that occur in a single variable region that can bind the antigen. The exact boundaries of these CDRs have been defined differently according to different systems. The system described by Kabat (Kabat et al., (1987; 1991) Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md.) not only provides an unambiguous residue numbering system applicable to any variable region of an antibody, but also provides precise residue boundaries defining the three CDRs. These CDRs may be referred to as Kabat CDRs. Chothia and coworkers (Chothia & Lesk (1987) J. Mol. Biol. 196: 901-917; and Chothia et al., (1989) Nature 342: 877-883) found that certain sub-portions within Kabat CDRs adopt nearly identical peptide backbone conformations, despite having great diversity at the level of amino acid sequence. These sub-portions were designated as L-CDR1, L-CDR2 and L-CDR3 or H-CDR1, H-CDR2 and H-CDR3, where the L and the H designate the light chain and the heavy chain regions, respectively. These regions may be referred to as Chothia CDRs, which have boundaries that overlap with Kabat CDRs. Other boundaries defining CDRs overlapping with the Kabat CDRs have been described by Padlan (1995) FASEB J. 9:133-139 and MacCallum (1996) J. Mol. Biol. 262(5): 732-45. Still other CDR boundary definitions may not strictly follow one of the herein systems, but will nonetheless overlap with the Kabat CDRs, although they may be shortened or lengthened in light of prediction or experimental findings that particular residues or groups of residues or even entire CDRs do not significantly impact antigen-binding (see, for example: Lu X et al., MAbs. 2019 January; 11(1):45-57). The methods used herein may utilize CDRs defined according to any of these systems, although certain embodiments use Kabat- or Chothia-defined CDRs.

    [0156] Conformational epitope: A conformational epitope is an epitope that is recognized and bound by a conformational antibody in a three-dimensional conformation, but not in an unfolded peptide of the same amino acid sequence. A conformational epitope may be referred to as a conformation-specific epitope, conformation-dependent epitope, or conformation-sensitive epitope. A corresponding antibody or fragment thereof that specifically binds such an epitope may be referred to as conformation-specific antibody, conformation-selective antibody, or conformation-dependent antibody. Binding of an antigen to a conformational epitope depends on the three-dimensional structure (conformation) of the antigen or antigen complex.

    [0157] Constant region/domain: An immunoglobulin constant domain refers to a heavy or light chain constant domain. Human IgG heavy chain and light chain constant domain amino acid sequences are known in the art.

    [0158] Context-independent: According to the present disclosure, a context-independent antibody that binds proTGF?1 has equivalent affinities across the four known presenting molecule-proTGF?1 complexes, namely, LTBP1-proTGF?1, LTBP3-proTGF?1, GARP-proTGF?1 and LRRC33-proTGF?1. Any suitable in vitro binding assay, such as surface plasmon resonance, Biolayer Interferometry (BLI), and/or solution equilibrium titration (e.g., MSD-SET), may be employed to measure binding activities of antibodies or fragments thereof.

    [0159] Context-specific antibodies or context-selective antibodies: as contrasted with context-independent antibodies, are those antibodies that can bind selectively to a subset, but not all, of proTGF?1 complexes associated with a particular biological context. Matrix-selective targeting enables specific inhibition of TGF?1 function associated with the extracellular matrix. ECM-selective inhibition can be achieved by the use of antibodies or fragments thereof that selectively target the extracellular matrix components, LTBP1-proTGF?1 or LTBP3-proTGF?1. Antibodies and fragments disclosed herein therefore represent a class of context-specific antibodies. LTBP1-specific and LTBP3-specific inhibitors of TGF?1 activation are also context-specific antibodies. In some embodiments, context selective or context specific can include antibodies that bind both LTBP-1 and LTBP-3 complexes but do not bind GARP or LRRC33. In some embodiments, LTBP context-selectivity refers to a class of LTBP1-specific and LTBP-3 specific inhibitors of TGF?1 activation that are have at least 50? more selectivity over GARP or LRRC33 complexes.

    [0160] Corticosteroid: PREDNISONE? is an example of a known corticosteroid which can reduce inflammation in tissues, such as lungs by suppressing the immune system. Corticosteroids are only prescribed in patients with idiopathic pulmonary fibrosis who have an acute exacerbation of their lung fibrosis and can be harmful in patients with idiopathic pulmonary fibrosis that have scarring that is stable or slowly worsening.

    [0161] Cross-blocking antibody has the immunological art-recognized meaning of a first antibody or antigen-binding portion thereof and a second antibody or antigen-binding portion thereof cross-block with each other with respect to the same antigen, e.g., as assayed by as measured by Biolayer Interferometry, such as OCTET?, or surface plasmon resonance (SPR), such as BIACORE? Systems, using standard test conditions, e.g., according to the manufacturer's instructions, e.g., binding assayed at room temperature, ?20-25? C. The first antibody or fragment thereof and the second antibody or fragment thereof may have the same epitope; may have non-identical but overlapping epitopes; or, may have separate (different) epitopes which are in close proximity in a three-dimensional space, such that antibody binding is cross-blocked via steric hindrance. The term cross-block means that binding of the first antibody to an antigen prevents binding of the second antibody to the same antigen, and similarly, binding of the second antibody to an antigen prevents binding of the first antibody to the same antigen.

    [0162] Dissociation rate: has the immunological art-recognized meaning of a kinetics parameter measured by how fast/slow a ligand, e.g., antibody or fragment, dissociates from its binding target, e.g., antigen. Dissociation rate is also referred to as the off rate (k.sub.OFF). Relative on/off rates between an antibody and its antigen, i.e., k.sub.ON and k.sub.OFF) determine the overall strength of the interaction, or affinity, typically expressed as a dissociation constant, or K.sub.D. Therefore, equivalent affinities, e.g., K.sub.D values) may be achieved by having fast association (high k.sub.ON), slow dissociation (low k.sub.OFF), or contribution from both factors. Monovalent interactions may be measured by the use of monovalent antigen-binding molecules/fragments, such as fAb (Fab), while divalent interactions may be measured by the use of divalent antigen-binding molecules such as whole immunoglobulins, e.g., IgGs. Dissociation kinetics may be expressed in terms of dissociation half-time (sometimes referred to as half binding time), or t.sub.1/2, defined as a duration of time it takes for one half the number of antibody molecules, e.g., mAb, Fab, etc.) to dissociate from bound antigen. Thus, antibodies with slow dissociation rates have long dissociation half-time, and antibodies with fast dissociation rates have short dissociation half-time. Ab42 can remain bound to the antigen for a much longer duration of time (e.g., greater t.sub.1/2) than an antibody with much higher OFF rate, which falls off (e.g., dissociates from) the antigen relatively quickly. Thus, the difference in the dissociation kinetics predominantly attributes to the notable difference in their overall affinities (K.sub.D), which may result in enhanced potency. Therefore, characterization of binding kinetics provides useful information as to potential durability of effects and resulting in vivo potency. The Ab42 in vitro binding assay results provided in the EXAMPLES below showed low dissociation rate (OFF-rate).

    [0163] Dosage: has the medical art-recognized meaning. The typical therapeutic dosage of an antibody of the disclosure ranges between about 1-30 mg/kg per dose. A typical dosing regimen may include once a week, every two weeks, every three weeks, every four weeks, once a month, every six weeks, etc.

    [0164] ECM-associated TGF?1/proTGF?1: The term refers to TGF?1 or its signaling complex (e.g., pro/latent TGF?1) that is a component of (e.g., deposited into) the extracellular matrix. TGF?1 that is presented by LTBP1 or LTBP3 is an ECM-associated TGF?1. LTBPs are critical for correct deposition and subsequent bioavailability of TGF? in the ECM, where fibrillin (Fbn) and fibronectin (FN) are believed to be the main matrix proteins responsible for the association of LTBPs with the ECM. Average K.sub.D values of an antibody (or its fragment) to an LTBP1-proTGF?1 complex and an LTBP3-proTGF?1 complex may be calculated to collectively represent affinities for ECM-associated (or matrix-associated) proTGF?1 complexes. Human counterpart of a presenting molecule or presenting molecule complex may be indicated by an h preceding the protein or protein complex, e.g., hLTBP1, hLTBP1-proTGF?1, hLTBP3 and hLTBP3-proTGF?1.

    [0165] Effective amount: The terms effective amount and therapeutically effective amount have the medical art-recognized meaning of a dosage or dosing regimen that achieves statistically significant clinical benefits in a patient population. The terms effective and therapeutically effective refer to the ability or an amount to sufficiently produce a detectable change in a parameter of a disease, e.g., a slowing, pausing, reversing, diminution, or amelioration in a symptom or downstream effect of the disease. The term encompasses but does not require the use of an amount that completely cures a disease. According to some embodiments, an effective amount (or therapeutically effective amount, or therapeutic dose) is a dosage, concentration, or dosing regimen that achieves statistically significant clinical benefits (e.g., efficacy) in a patient population. For example, for an antibody that has been shown to be efficacious at doses between 3 mg/kg and 30 mg/kg in preclinical models, the effective amount can be said to be between about 3-30 mg/kg. Effective amount may be expressed as the level of serum exposure. For example, a therapeutically effective amount of Ab42 may be a dose sufficient to achieve a serum exposure of between about 10-400 ?g/mL of the antibody.

    [0166] Effector T cells: Effector T cells, as used herein, are T lymphocytes that actively respond immediately to a stimulus, such as co-stimulation and include, but are not limited to, CD4+ T cells (also referred to as T helper or Th cells) and CD8+ T cells (also referred to as cytotoxic T cells). Th cells assist other white blood cells in immunologic processes, including maturation of B cells into plasma cells and memory B cells, and activation of cytotoxic T cells and macrophages. These cells are also known as CD4+ T cells because they express the CD4 glycoprotein on their surfaces. Helper T cells become activated when they are presented with peptide antigens by MHC class II molecules, which are expressed on the surface of antigen-presenting cells (APCs). Once activated, they divide rapidly and secrete small proteins called cytokines that regulate or assist in the active immune response. These cells can differentiate into one of several subtypes, including Th1, Th2, Th3, Th17, Th9, or TFh, which secrete different cytokines to facilitate different types of immune responses. Signaling from the APC directs T cells into particular subtypes. Cytotoxic (Killer). Cytotoxic T cells (TC cells, CTLs, T-killer cells, killer T cells), on the other hand, destroy virus-infected cells and cancer cells, and are also implicated in transplant rejection. These cells are also known as CD8+ T cells since they express the CD8 glycoprotein at their surfaces. These cells recognize their targets by binding to antigen associated with MHC class I molecules, which are present on the surface of all nucleated cells. Cytotoxic effector cell (e.g., CD8+ cells) include, e.g., perforin and granzyme B.

    [0167] Epitope: The term epitope may be also referred to as an antigenic determinant, is a molecular determinant (e.g., polypeptide determinant) that can be specifically bound by a binding agent, immunoglobulin or T-cell receptor. Epitope determinants include chemically active surface groupings of molecules, such as amino acids, sugar side chains, phosphoryl, or sulfonyl, and, in certain embodiments, may have specific three-dimensional structural characteristics, and/or specific charge characteristics. An epitope recognized by an antibody or an antigen-binding fragment of an antibody is a structural element of an antigen that interacts with CDRs (e.g., the complementary site) of the antibody or the fragment. An epitope may be formed by contributions from several amino acid residues, which interact with the CDRs of the antibody to produce specificity. An antigenic fragment can contain more than one epitope. In certain embodiments, an antibody specifically binds an antigen when it recognizes its target antigen in a complex mixture of proteins and/or macromolecules.

    [0168] Fibrosis: The term fibrosis or fibrotic condition/disorder refers to the process or manifestation characterized by the pathological accumulation of extracellular matrix (ECM) components, such as collagens, within a tissue or organ. Indeed, collagen accumulation is a hallmark of fibrosis. According to some embodiments, the fibrosis is lung (also referred to as pulmonary) fibrosis. In some embodiments, the fibrosis is scleroderma. In some embodiments, the fibrosis is fibrosis of skeletal muscle, wherein optionally the fibrosis of skeletal muscle is associated with muscular dystrophy, wherein further optionally the muscular dystrophy is MDM. In some embodiments, the fibrosis is a kidney fibrosis, wherein the kidney fibrosis is associated with CKD and/or a genetic disorder such as Alport syndrome.

    [0169] Pulmonary fibrosis: The term pulmonary fibrosis or lung fibrosis as used in the context of the present disclosure refers to the formation of excess fibrous connective tissue in the lung. According to some embodiments, pulmonary fibrosis may be a secondary effect of other lung diseases. Examples of such diseases include autoimmune disorders, viral infections and bacterial infections (such as tuberculosis). Pulmonary fibrosis may also be idiopathic, with cigarette smoking, environmental factors (e.g. occupational exposure to gases, smoke, chemicals or dusts) or genetic predisposition thought to be risk factors.

    [0170] Fibrotic microenvironment: The term fibrotic microenvironment refers to a local disease niche within a tissue, in which fibrosis occurs in vivo. The fibrotic microenvironment may comprise disease-associated molecular signature (a set of chemokines, cytokines, etc.), disease-associated cell populations (such as activated macrophages, MDSCs, etc.) as well as disease-associated ECM environments (alterations in ECM components and/or structure). Fibrotic microenvironment is thought to support the transition of fibroblast to ?-smooth muscle actin-positive myofibroblast in a TGF?-dependent manner. Fibrotic microenvironment may be further characterized by the infiltration of certain immune cells (such as macrophages and MDSCs).

    [0171] GARP-TGF?1 complex: As used herein, the term GARP-TGF?1 complex (or GARP-proTGF?1 complex) refers to a protein complex comprising a pro-protein form or latent form of a transforming growth factor-31 (TGF?1) protein and a glycoprotein-A repetitions predominant protein (GARP) or fragment or variant thereof. In some embodiments, a pro-protein form or latent form of TGF?1 protein may be referred to as pro/latent TGF?1 protein. In some embodiments, a GARP-TGF?1 complex comprises GARP covalently linked with pro/latent TGF?1 via one or more disulfide bonds. In nature, such covalent bonds are formed with cysteine residues present near the N-terminus (e.g., amino acid position 4) of a proTGF?1 dimer complex. In other embodiments, a GARP-TGF?1 complex comprises GARP non-covalently linked with pro/latent TGF?1. In some embodiments, a GARP-TGF?1 complex is a naturally-occurring complex, for example a GARP-TGF?1 complex in a cell. The term hGARP denotes human GARP.

    [0172] GSK3008348: (3S)-3-[3-(3,5-Dimethyl-1H-pyrazol-1-yl)phenyl]-4-{(3S)-3-[2-(5,6,7,8-tetrahydro-1,8-naphthyridin-2-yl)ethyl]-1-pyrrolidinyl}butanoic acid, CAS 1629249-33-7, is a selective small molecule ?v?6 RGD-mimetic. See John et al., Nature Communications, volume 11, Article number 4659 (2020).

    [0173] Human antibody: The term human antibody, as used herein, is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences. The human antibodies of the present disclosure may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and in particular CDR3. However, the term human antibody, as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.

    [0174] Humanized antibody: The term humanized antibody refers to antibodies, which comprise heavy and light chain variable region sequences from a non-human species (e.g., a mouse) but in which at least a portion of the VH and/or VL sequence has been altered to be more human-like, i.e., more similar to human germline variable sequences. One type of humanized antibody is a CDR-grafted antibody, in which human CDR sequences are introduced into non-human VH and VL sequences to replace the corresponding nonhuman CDR sequences. Also humanized antibody is an antibody, or a variant, derivative, analog or fragment thereof, which immunospecifically binds to an antigen of interest and which comprises an FR region having substantially the amino acid sequence of a human antibody and a CDR region having substantially the amino acid sequence of a non-human antibody.

    [0175] As used herein, the term substantially in the context of a CDR refers to a CDR having an amino acid sequence at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the amino acid sequence of a non-human antibody CDR. A humanized antibody comprises substantially all of at least one, and typically two, variable domains (Fab, Fab, F(ab)2, FabC, Fv) in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin (i.e., donor antibody) and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. In an embodiment a humanized antibody also comprises at least a portion of an immunoglobulin Fc region, typically that of a human immunoglobulin. In some embodiments, a humanized antibody contains the light chain as well as at least the variable domain of a heavy chain. The antibody also may include the CH1, hinge, CH2, CH3, and CH4 regions of the heavy chain. In some embodiments, a humanized antibody only contains a humanized light chain. In some embodiments, a humanized antibody only contains a humanized heavy chain. In specific embodiments, a humanized antibody only contains a humanized variable domain of a light chain and/or humanized heavy chain.

    [0176] Hydrogen/deuterium exchange mass spectrometry (HDX-MS): HDX-MS is a well-known technique employed to interrogate protein confirmation and protein-protein interactions in solution by measuring the degree of solvent accessibility. See, for example, Wei et al., (2014) Drug Discov Today 19(1): 95-102. Hydrogen/deuterium exchange mass spectrometry for probing higher order structure of protein therapeutics: methodology and applications. The HDX-MS technique may be employed to determine a region or regions of an antigen bound by an antibody (i.e., binding region(s)). Thus, such binding region(s) may contain or form an epitope.

    [0177] In the results provided in the EXAMPLES below, epitope mapping by H/DX-MS identified the segment of the antigen that is important in Ab42 binding. This was later confirmed by x-ray crystallography which identified the epitope for Ab42 within the alpha-1 helix region of the prodomain and the finger-1 domain of the growth factor domain.

    [0178] Immune suppression or immunosuppression: has the immunological art-recognized meaning of suppression or reduction of the strength of the body's immune system. The terms refer to the ability to suppress immune cells, such as T cells, NK cells and B cells. The gold standard for evaluating immunosuppressive function is the inhibition of T cell activity, which may include antigen-specific suppression and non-specific suppression. Regulatory T cells (Tregs) and MDSCs may be considered immunosuppressive cells. M2-polarized macrophages (e.g., TAMs) may also be characterized as immunosuppressive. Patients who benefit from immunosuppression include those who have advanced stages of organ fibrosis and are candidates for, being considered for, or have undergone transplantation.

    [0179] Isoform-specific/selective: has the immunological art-recognized meaning of an agent's ability to discriminate one isoform over other structurally related isoforms (i.e., selectivity). An isoform-specific TGF? inhibitor exerts its inhibitory activity towards one isoform of TGF? but not the other isoforms of TGF? at a given concentration. An isoform-specific TGF?1 antibody selectively binds TGF?1. A TGF?1-specific inhibitor (antibody) preferentially targets (binds, thereby inhibits) the TGF?1 isoform over TGF?2 or TGF?3 with substantially greater affinity. Context-specific inhibitors of this specification are also isoform-specific. For example, the selectivity in this context may refer to at least a 500-1000-fold difference in respective affinities as measured by an in vitro binding assay such as OCTET? and BIACORE?. In some embodiments, the selectivity is such that the inhibitor when used at a dosage effective to inhibit TGF?1 in vivo does not inhibit TGF?2 and TGF?3. For instance, an antibody may preferentially bind TGF?1 at affinity of ?1 ?M, while the same antibody may bind TGF?2 and/or TGF?3 at ?0.5-50 nM. For such an inhibitor to be useful as a therapeutic, dosage to achieve desirable effects (e.g., therapeutically effective amounts) must fall within the window within which the inhibitor can effectively inhibit the TGF?1 isoform without inhibiting TGF?2 or TGF?3. The terms isoform-specific and isoform-selective are used interchangeably herein.

    [0180] Isolated: An isolated antibody as used herein, refers to an antibody that is substantially free of other antibodies having different antigenic specificities. In some embodiments, an isolated antibody is substantially free of other unintended cellular material and/or chemicals.

    [0181] Large Latent Complex: The term large latent complex (LLC) in the context of the present disclosure refers to a complex comprised of a proTGF?1 dimer bound to so-called a presenting molecule. Thus, a large latent complex is a presenting molecule-proTGF?1 complex, such as LTBP1-proTGF?1, LTBP3-proTGF?1, GARP-proTGF?1 and LRRC33-proTGF?1. Such complexes may be formed in vitro using recombinant, purified components capable of forming the complex. For screening purposes, presenting molecules used for forming such LLCs need not be full length polypeptides; however, the portion of the protein capable of forming disulfide bonds with the proTGF?1 dimer complex via the cysteine residues near its N-terminal regions is typically required.

    [0182] Latency associated peptide (LAP): LAP is so-called the prodomain of proTGF?1. As described in more detail herein, LAP is comprised of the Straight Jacket domain and the Arm domain. Straight Jacket itself is further divided into the Alpha-1 Helix and Latency Lasso domains.

    [0183] Long-term administration or chronic administration: has the immunological art-recognized meaning of a therapeutic regimen that involves over six months of treatment is considered long-term. In some patient populations, long-term therapeutic regimens involve administration of a drug (such as context-specific TGF?1 inhibitors) for an indefinite duration of time.

    [0184] Localized: In the context of the present disclosure, the term localized (as in localized tumor) refers to anatomically isolated or isolatable abnormalities, such as solid malignancies, as opposed to systemic disease. Certain leukemia, for example, may have both a localized component (for instance the bone marrow) and a systemic component (for instance circulating blood cells) to the disease.

    [0185] LRRC33-TGF?1 complex: As used herein, the term LRRC33-TGF?1 complex (or LRRC33-proTGF?1 complex) refers to a complex between a pro-protein form or latent form of transforming growth factor-31 (TGF?1) protein and a Leucine-Rich Repeat-Containing Protein 33 (LRRC33; also known as Negative Regulator Of Reactive Oxygen Species or NRROS) or fragment or variant thereof. In some embodiments, a LRRC33-TGF?1 complex comprises LRRC33 covalently linked with pro/latent TGF?1 via one or more disulfide bonds. In nature, such covalent bonds are formed with cysteine residues present near the N-terminus (e.g., amino acid position 4) of a proTGF?1 dimer complex. In other embodiments, a LRRC33-TGF?1 complex comprises LRRC33 non-covalently linked with pro/latent TGF?1. In some embodiments, a LRRC33-TGF?1 complex is a naturally-occurring complex, for example a LRRC33-TGF?1 complex in a cell. The term hLRRC33 denotes human LRRC33.

    [0186] LTBP1-TGF?1 complex: As used herein, the term LTBP1-TGF?1 complex (or LTBP1-proTGF?1 complex) refers to a protein complex comprising a pro-protein form or latent form of transforming growth factor-31 (TGF?1) protein and a latent TGF-beta binding protein 1 (LTBP1) or fragment or variant thereof. In some embodiments, a LTBP1-TGF?1 complex comprises LTBP1 covalently linked with pro/latent TGF?1 via one or more disulfide bonds. In nature, such covalent bonds are formed with cysteine residues present near the N-terminus (e.g., amino acid position 4) of a proTGF?1 dimer complex. In other embodiments, a LTBP1-TGF?1 complex comprises LTBP1 non-covalently linked with pro/latent TGF?1. In some embodiments, a LTBP1-TGF?1 complex is a naturally-occurring complex, for example a LTBP1-TGF?1 complex in a cell. The term hLTBP1 denotes human LTBP1.

    [0187] LTBP3-TGF?1 complex: As used herein, the term LTBP3-TGF?1 complex (or LTBP3-proTGF?1 complex) refers to a protein complex comprising a pro-protein form or latent form of transforming growth factor-31 (TGF?1) protein and a latent TGF-beta binding protein 3 (LTBP3) or fragment or variant thereof. In some embodiments, a LTBP3-TGF?1 complex comprises LTBP3 covalently linked with pro/latent TGF?1 via one or more disulfide bonds. In nature, such covalent bonds are formed with cysteine residues present near the N-terminus (e.g., amino acid position 4) of a proTGF?1 dimer complex. In other embodiments, a LTBP3-TGF?1 complex comprises LTBP1 non-covalently linked with pro/latent TGF?1. In some embodiments, a LTBP3-TGF?1 complex is a naturally-occurring complex, for example a LTBP3-TGF?1 complex in a cell. The term hLTBP3 denotes human LTBP3.

    [0188] Macrophage: has the immunological art-recognized meaning of a type of white blood cells of the immune system and includes heterogeneous, phenotypically diverse subpopulations of myeloid cells. Some macrophages differentiate from bone marrow-derived, circulating monocytes, while others are tissue-specific macrophages that reside within particular anatomical or tissue locations (resident macrophages). Tissue-specific macrophages include but are not limited to: adipose tissue macrophages; Kupffer cells (liver); sinus histiocytes (lymph nodes); alveolar macrophages (or dust cells, pulmonary alveoli of lungs); tissue macrophages (histiocytes) leading to giant cells (connective tissue); Langerhans cells (skin and mucosa); microglia (central nervous system); Hofbauer cells (placenta); intraglomerular mesangial cells (kidney); osteoclasts (bone); epithelioid cells (granulomas); red pulp macrophages (or sinusoidal lining cells, red pulp of spleen); peritoneal macrophages (peritoneal cavity); and LysoMac (Peyer's patch). Macrophages, e.g., bone-marrow derived monocytes, can be activated by certain stimuli (such as cytokines) resulting in polarized phenotypes, e.g., M1 and M2. M2-biased activated macrophages are further classified into several phenotypically distinct subtypes, such as M2a, M2b, M2c, e.g., pro-fibrotic) and M2d (pro-tumor or TAM-like).

    [0189] Marker or Biomarker: encompasses the definition of biomarkers provided by the by the World Health Organization. The International Programme on Chemical Safety, led by the World Health Organization (WHO) in coordination with the United Nations and the International Labor Organization, has defined a biomarker as any substance, structure, or process that can be measured in the body or its products and influence or predict the incidence of outcome or disease. WHO International Programme on Chemical Safety Biomarkers in Risk Assessment: Validity and Validation (2001). See also Strimbu & Tavel, What are Biomarkers? Curr. Opin. HIV AIDS, 5(6): 463-466 (November 2011). Predictive biomarkers provide information on the probability or likelihood of response to a particular therapy. Typically, a predictive biomarker is measured before and after treatment, and the changes or relative levels of the marker in samples collected from the subject indicates or predicts therapeutic benefit.

    [0190] Matrix-Associated pro TGF?1: has the immunological art-recognized meaning. LTBP1 and LTBP3 are presenting molecules that are components of the extracellular matrix. LTBP1-proTGF?1 and LTBP3-proTGF?1 may be collectively referred to as ECM-associated (or matrix-associated) proTGF?1 complexes, that mediate ECM-associated TGF?1 activation or signaling. LTBP1 and LTBP3 are components of the extracellular matrix. LTBP1-proTGF?1 and LTBP3-proTGF?1 may be collectively referred to as ECM-associated (or matrix-associated) proTGF?1 complexes, that mediate ECM-associated TGF?1 signaling/activities.

    [0191] Maximally tolerated dose (MTD): has the immunological art-recognized meaning, in the context of safety or toxicology considerations, of the highest amount of a test article (such as a TGF?1 inhibitor) evaluated with no observed adverse effect level (NOAEL). The NOAEL for a context-independent reference antibody in rats was the highest dose evaluated (100 mg/kg), suggesting that the maximally tolerated dose for a context-independent reference antibody is greater than 100 mg/kg, based on a four-week toxicology analysis.

    [0192] Meso-Scale Discovery or MSD: has the immunological art-recognized meaning of a type of immunoassay that employs high binding carbon electrodes to capture proteins, e.g., antibodies. The antibodies can be incubated with particular antigens, which binding can be detected with secondary antibodies that are conjugated to electrochemiluminescent labels. Upon an electrical signal, light intensity can be measured to quantify analytes in the sample.

    [0193] Myelofibrosis or osteomyelofibrosis: is a rare bone marrow proliferative disorder, which belongs to a group of diseases called myeloproliferative disorders and includes primary myelofibrosis and secondary myelofibrosis. Myelofibrosis characterized by the proliferation of an abnormal clone of hematopoietic stem cells in the bone marrow and other sites results in fibrosis, or the replacement of the marrow with scar tissue. Myelofibrosis is characterized by mutations that cause upregulation or overactivation of the downstream JAK pathway.

    [0194] Myeloid-derived suppressor cells (MDSCs): have the immunological art-recognized meaning of a heterogeneous population of cells generated during various pathologic conditions and thought to represent a pathologic state of activation of monocytes and relatively immature neutrophils. MDSCs include at least two categories of cells termed (i) granulocytic (G-MDSC) or polymorphonuclear (PMN-MDSC), which are phenotypically and morphologically like neutrophils; and (ii) monocytic (M-MDSC) which are phenotypically and morphologically similar to monocytes. MDSCs are characterized by a distinct set of genomic and biochemical features and can be distinguished by specific surface molecules. Human G-MDSCs/PMN-MDSCs typically express the cell-surface markers CD11 b, CD33, CD15 and CD66. In addition, human G-MDSCs/PMN-MDSCs may also express HLA-DR or Arginase. By comparison, human M-MDSCs typically express the cell surface markers CD11 b, CD33 and CD14. The MDSCs may also express CD39 and CD73 to mediate adenosine signaling involved in organ fibrosis (such as liver fibrosis, and lung fibrosis), cancer and myelofibrosis. Human M-MDSCs may also express HLA-DR. In addition to such cell-surface markers, MDSCs are characterized by the ability to suppress immune cells, such as T cells, NK cells and B cells. Immune suppressive functions of MDSCs may include inhibition of antigen-non-specific function and inhibition of antigen-specific function. MDSCs can express cell surface LRRC33 or LRRC33-proTGF?1.

    [0195] Myofibroblasts: have the immunological art-recognized meaning of cells with certain phenotypes of fibroblasts and smooth muscle cells and generally express vimentin, alpha-smooth muscle actin (?-SMA; human gene ACTA2) and paladin. In many disease conditions involving extracellular matrix dysregulations (such as increased matrix stiffness), normal fibroblast cells become de-differentiated into myofibroblasts in a TGF?3-dependent manner. Aberrant overexpression of TGF? is common among myofibroblast-driven pathologies. TGF? is known to promote myofibroblast differentiation, cell proliferation, and matrix production. Myofibroblasts or myofibroblast-like cells within the fibrotic microenvironment can be called fibrosis-associated fibroblasts (or FAFs).

    [0196] Nintedanib: is an anti-scarring (anti-fibrotic) medication that slows progression of idiopathic pulmonary fibrosis. Some patients taking nintedanib have side effects, most commonly including diarrhea. There are no medications that cure idiopathic pulmonary fibrosis or decrease the amount of scarring in the lungs. Some medications help slow the progression of pulmonary fibrosis.

    [0197] Off rate (k.sub.OFF): has the immunological art-recognized meaning of a kinetic parameter of how fast or how slowly an antibody (such as mAb) or antigen-binding fragment (such as fAb) dissociates from its antigen and may be also referred to as the dissociation rate. Dissociation rates can be experimentally measured in suitable in vitro binding assays, such as bio-layer interferometry (Octet?) or surface plasmon resonance (BIACORE?)-based systems. In the context of antibody-antigen binding kinetics, the term half-binding-time (t.sub.1/2) or dissociation half-time refers to the duration of time required for half the number of antibody molecules, e.g., mAb, Fab) to dissociate from the bound antigen, e.g., LTBP1-proTGF?1, LTBP3-proTGF?1. Thus, an antibody that dissociates slowly, i.e., low off rates) from its antigen has a long t.sub.1/2. Conversely, an antibody that dissociates rapidly, i.e., high off rates) from its antigen has a short t.sub.1/2.

    [0198] Pan-TGF? inhibitor or pan-inhibition of TGF?: As used herein, the term pan inhibitor of TGF? has the art-recognized meaning. A pan-TGF? inhibitor is any agent that is capable of inhibiting or antagonizing all three isoforms of TGF?. Such an inhibitor may be a small molecule inhibitor of TGF? isoforms. The term includes pan-TGF? antibody which refers to any antibody capable of binding to each of TGF? isoforms, i.e., TGF?1, TGF?2, and TGF?3. In a fifty-second embodiment, a pan-TGF? antibody binds to and neutralizes activities of all three isoforms, i.e., TGF?1, TGF?2, and TGF?3 activities.

    [0199] Picrosirius red: Also known as Sirius Red F 3B or Direct Red 80), Picosirius red is an azo dye primarily used in staining methods for collagen and amyloid. Picrosirius red (PSR) has the molecular formula C.sub.45H.sub.26N.sub.10Na.sub.6O.sub.21S.sub.6.

    [0200] Pirfenidone: Pirfenidone is an anti-scarring (anti-fibrotic) medication that slows the progression of idiopathic pulmonary fibrosis. Some patients taking pirfenidone have side effects, most commonly stomach upset and skin rash, particularly with exposure to sun. Pirfenidone was approved by Health Canada for the treatment of mild to moderate idiopathic pulmonary fibrosis. To date, there are no medications that cure idiopathic pulmonary fibrosis or decrease the amount of scarring in the lungs. Some medications help slow the progression of pulmonary fibrosis.

    [0201] Potency: The term potency has the immunological art-recognized meaning of the activity of a drug, such as a functional antibody (or fragment) having inhibitory activity, with respect to concentration or amount of the drug to produce a defined effect. For example, an antibody capable of producing certain effects at a given dosage is more potent than another antibody that requires twice the amount (dosage) to produce equivalent effects. Potency may be measured in cell-based assays, such as TGF? activation/inhibition assays, whereby the degree of TGF? activation, such as activation triggered by integrin binding, can be measured in the presence or absence of test article (e.g., inhibitory antibodies) in a cell-based system. Typically, among those capable of binding to the same or overlapping binding regions of an antigen (e.g., cross-blocking antibodies), antibodies with higher affinities (lower K.sub.D values) tend to show higher potency than antibodies with lower affinities (greater K.sub.D values).

    [0202] Predictive biomarkers: provide information on the probability or likelihood of response to a particular therapy. Typically, a predictive biomarker is measured before and after treatment, and the changes or relative levels of the marker in samples collected from the subject indicates or predicts therapeutic benefit.

    [0203] Presenting molecule: As used herein, the term presenting molecule refers to proteins that form covalent bonds with proTGF? and present the inactive complex in an extracellular niche (such as extracellular matrix or immune cell surface) thereby maintaining its latency until an activation event occurs. Known presenting molecules for proTGF?1 include: LTBP1, LTBP3, GARP and LRRC33, which can form presenting molecule-proTGF?1 complexes, namely, LTBP1-proTGF?1, LTBP3-proTGF?1, GARP-proTGF?1 and LRRC33-proTGF?1, respectively. Presenting molecules in the context of the present disclosure refer to anchoring proteins that can form covalent bonds with latent pro-proteins (e.g., proTGF?1) and present the inactive complex in an extracellular niche (such as ECM or immune cell surface) thereby maintaining its latency until an activation event occurs. Known presenting molecules for proTGF?1 include: LTBP1, LTBP3, GARP (also known as LRRC32) and LRRC33, which can form presenting molecule-proTGF?1 complexes (LLCs), namely, LTBP1-proTGF?1, LTBP3-proTGF?1, GARP-proTGF?1 and LRRC33-proTGF?1, respectively. In nature, LTBP1 and LTBP3 are components of the extracellular matrix (ECM); therefore, LTBP1-proTGF?1 and LTBP3-proTGF?1 may be collectively referred to as ECM-associated (or matrix-associated) proTGF?1 complexes that mediate ECM-associated TGF?1 signaling/activities. GARP and LRRC33, on the other hand, are transmembrane proteins expressed on cell surface of certain cells; therefore, GARP-proTGF?1 and LRRC33-proTGF?1 may be collectively referred to as cell-associated (or cell-surface) proTGF?1 complexes, that mediate cell-associated (e.g., immune cell-associated) TGF?1 signaling/activities.

    [0204] proTGF?1: As used herein, the term proTGF?1 refers to and encompasses precursor forms of inactive TGF?1 complex that comprises a prodomain sequence of TGF?1 within the complex. The term can include the pro-forms, as well as the latent-forms of TGF?1. The expression pro/latent TGF?1 may be used interchangeably. The pro form of TGF?1 exists prior to proteolytic cleavage at the furin site. Once cleaved, the resulting form is said to be the latent form of TGF?1. The latent complex remains associated until further activation trigger, such as integrin-driven activation event. The proTGF?1 complex is comprised of dimeric TGF?1 pro-protein polypeptides, linked with disulfide bonds. The latent dimer complex is covalently linked to a single presenting molecule via the cysteine residue at position 4 (Cys4) of each of the proTGF?1 polypeptides. The adjective latent may be used generally to describe the inactive state of TGF?1, prior to integrin-mediated or other activation events. The proTGF?1 polypeptide contains a prodomain (LAP) and a growth factor domain.

    [0205] Regulatory T cells, or Tregs: have the immunological art-recognized meaning of a type of immune cells characterized by the expression of the biomarkers, CD4, forkhead box P3 (FOXP3), and CD25, as well as STATS. Tregs are sometimes referred to as suppressor T cells and represent a subpopulation of T cells that modulate the immune system, maintain tolerance to self-antigens, and prevent autoimmune disease. Tregs are immunosuppressive and generally suppress or downregulate induction and proliferation of effector T (Teff) cells. Tregs can develop in the thymus (so-called CD4+ Foxp3+natural Tregs) or differentiate in the periphery upon priming of na?ve CD4+ T cells by antigen-presenting cells (APCs), e.g., following exposure to TGF? or retinoic acid. Treg cells produce and secrete cytokines including IL-10 and TGF?1. Generally, differentiation of Treg and Th17 cells is negatively correlated.

    [0206] Selection or selecting: has the plain meaning of the act of choosing from a number or group by fitness or preference. See Merriam-Webster's Unabridged Dictionary (2021).

    [0207] Selectivity: has immunological art-recognized meaning. While antibody specificity is defined by the epitope the antibody binds to, antibody is defined by the antibody's binding to a unique epitope. Selectivity in this context may refer to at least a 500-1000-fold difference in respective affinities as measured by an in vitro binding assay such as OCTET? and BIACORE?. The selectivity is such that the inhibitor when used at a dosage effective to inhibit TGF?1 in vivo does not inhibit TGF?2 and TGF?3. The Ab42 in vitro binding assay results provided in the EXAMPLES below show selectivity towards the LTBP complexes.

    [0208] Specific binding or specifically binds: has the immunological art-recognized meaning that the interaction of the antibody or antigen-binding portion thereof with an antigen or amino acid residue is dependent upon the presence of a particular structure, e.g., an antigenic determinant or epitope. The antibody or antigen-binding portion thereof binds to a specific protein rather than to proteins generally.

    [0209] The term specific binding to an epitope of proTGF?1, specifically binds to an epitope of proTGF?1, specific binding to proTGF?1, or specifically binds to proTGF?1 as used herein, refers to an antibody or an antigen-binding portion thereof that binds to proTGF?1 and has a dissociation constant (K.sub.D) of 1.0?10.sup.?8 M or less, as determined by suitable in vitro binding assays. In some embodiments, an antibody or antigen-binding portion thereof can specifically bind to both human and a non-human, (e.g., mouse) orthologues of proTGF?1. In some embodiments, an antibody or an antigen-binding portion thereof specifically binds to a target, e.g., TGF?1, if the antibody has a K.sub.D for the target of at least about 10-6 M. Preferably, the measured K.sub.D values of such antibody range between 10-100 nM. More preferably, the measured K.sub.D values of such antibody range between 0.1-10 nM. By in vitro pharmacology as measured by bio-layer interferometry, Ab 42 was measured to have a K.sub.D of less than or equal to 10 nM binding to human LTBP1/3 large latent TGF?1 complexes. See WO 2020/160291, incorporated by reference in its entirety herein.

    [0210] Subject: The term subject in the context of therapeutic applications refers to an individual who receives clinical care or intervention, such as treatment, diagnosis, etc. Suitable subjects include vertebrates, including but not limited to mammals (e.g., human and non-human mammals). Where the subject is a human subject, the term patient may be used interchangeably. In a clinical context, the term a patient population or patient subpopulation is used to refer to a group of individuals that falls within a set of criteria, such as clinical criteria (e.g., disease presentations, disease stages, susceptibility to certain conditions, responsiveness to therapy, etc.), medical history, health status, gender, age group, genetic criteria (e.g., carrier of certain mutation, polymorphism, gene duplications, DNA sequence repeats, etc.) and lifestyle factors (e.g., diet, smoking, alcohol consumption, exercise, etc.).

    [0211] Target engagement: As used herein, the term target engagement refers to the ability of a molecule (e.g., TGF? inhibitor) to bind to its intended target in vivo (e.g., endogenous TGF?). In case of activation inhibitors, the intended target can be a large latent complex.

    [0212] T helper 17 cells (Th17): is meant to refer to a subset of pro-inflammatory T helper cells characterized by the markers STAT3 and ROR?t and the production of cytokines including interleukin 17 (IL-17A/F) and IL-22. Th17 cells are differentiated when naive T cells are exposed to TGF? and IL-6. Th17 cells are generally associated with tissue inflammation, autoimmunity and clearance of certain pathogens. The differentiation of Th17 cells and Treg cells is generally inversely related. Imbalance in Th17-to-Treg ratios, (e.g., Th17/Treg) has been implicated in a number of pathologies, such as fibrotic conditions and autoimmune conditions.

    [0213] TGF? inhibitor: The term TGF? inhibitor refers broadly to any agent capable of antagonizing biological activities, signaling or function of TGF? growth factor (e.g., TGF?1, TGF?2 and/or TGF?3).

    [0214] The term is not intended to limit its mechanism of action and includes, for example, neutralizing antibodies, receptor antagonists (e.g., kinase inhibitors), soluble ligand traps, and activation inhibitors of TGF?. Non-selective TGF? inhibitors are commonly referred to as pan-inhibitors of TGF?. TGF? inhibitors also include antibodies that are capable of reducing the availability of latent proTGF? which can be activated in the niche, for example, by inducing antibody-dependent cell mediated cytotoxicity (ADCC), and/or antibody-dependent cellular phagocytosis (ADPC), as well as antibodies that result in internalization of cell-surface complex comprising latent proTGF?, thereby removing the precursor from the plasma membrane without depleting the cells themselves.

    [0215] The TGF? family is a class within the TGF? superfamily and contains three members in human: TGF?1, TGF?2, and TGF?3, which are structurally similar and are encoded by separate genes. The three growth factors are known to signal via the same receptors.

    [0216] TGF?1 activation: has the immunological art-recognized meaning. See, e.g., WO 2017/156500, incorporated by reference in its entirety herein. Unlike other cytokines, TGF? superfamily members are not secreted as active growth factors, but as dimeric pro-proteins which consist of an N-terminal prodomain and a C-terminal growth factor domain. Cleavage of proTGF?1 by furin proteases separates the homodimeric growth factor domain from its prodomain, also referred to as latency associated peptide (LAP). However, the growth factor and LAP remain noncovalently associated, forming a latent complex which is unable to bind its receptors and induce signaling. During translation, latent TGF?1, also called the small latent complex (SLC), becomes linked to presenting molecules via disulfide bridges, forming the large latent complex (LLC). These molecules allow proTGF?1 to be presented in specific cellular or tissue contexts. Two cysteines near the N-terminus of the latent TGF?1 link to appropriately positioned cysteines on the presenting molecule. The identity of the presenting molecule depends on the environment and cell type producing latent TGF?1. Fibroblasts secrete latent TGF?1 tethered to latent TGF?-binding proteins (LTBPs), which then associate with proteins in the extracellular matrix (ECM), i.e., fibronectin, fibrillin-1) to link latent TGF? to the extracellular matrix.

    [0217] TGF?1-related indication: A TGF?1-related indication means any disease, disorder and/or condition related to expression, activity and/or metabolism of a TGF?1 or any disease, disorder and/or condition that may benefit from inhibition of the activity and/or levels TGF?1. Certain TGF?1-related indications are driven predominantly by the TGF?1 isoform. TGF?1-related indications include, but are not limited to: fibrotic conditions (such as organ fibrosis, and fibrosis of tissues involving chronic inflammation), proliferative disorders (such as cancer, e.g., solid tumors and myelofibrosis), disease associated with ECM dysregulation (such as conditions involving matrix stiffening and remodeling), disease involving endothelial-to-mesenchymal transition (EndMT), disease involving epithelial-to-mesenchymal transition (EMT), disease involving proteases, disease with aberrant gene expression of certain markers described herein. These disease categories are not intended to be mutually exclusive. According to some embodiments, the TGF?1-related indication is fibrosis.

    [0218] TGF?1 superfamily: in mammals, the transforming growth factor-beta (TGF?) superfamily is comprised of at least 33 gene products. These include the bone morphogenetic proteins (BMPs), activins, growth and differentiation factors (GDFs), and the three isoforms of the TGF? family: TGF?1, TGF?2, and TGF?3. The TGF?s have key functions in several processes, such as inhibition of cell proliferation, extracellular matrix (ECM) remodeling, and immune homeostasis. The roles of TGF?2 and TGF?3 are less clear to persons having ordinary skill in the immunological art. The three TGF? isoforms have distinct temporal and spatial expression patterns. The three TGF? isoforms all through the same receptors, TGF?RI and TGF?RII, although sometimes type III receptors such as betaglycan are also required. The biological importance of the TGF? pathway in humans was implicated and validated genetic diseases. Several drugs that target the TGF? pathway were developed and tested in patients, but with limited success.

    [0219] Th17-to-Treg ratios: have the immunological art-recognized meaning of measured ratios (relative proportions) of the number of Th17 cells versus the number of Treg cells in a tissue or sample of interest. Typically, known cell markers are used to identify, sort or isolate the cell types. Such markers include cell-surface molecules expressed on the particular cell type; a cytokine or a panel of cytokines produced, e.g., secreted) by the particular cell type, or mRNA expression of certain gene markers that serve as a signature/profile of the particular cell type. A Th17/Treg ratio of one (1) means that there is an equal or equivalent number of each of the cell types within the tissue or sample being evaluated. A Th17/Treg ratio of two (2) means that there is approximately twice the number of Th17 cells as compared to Treg cells in the tissue or sample. An elevated Th17/Treg ratio may arise from an increased number of Th17 cells, a decreased number of Treg cells, or combination thereof.

    [0220] Therapeutic window: has the medical art-recognized meaning a range of doses or concentrations that produces therapeutic response without causing significant, observable, or unacceptable adverse effect in subjects, e.g., within adverse effects that are acceptable or tolerable. Therapeutic window may be calculated as a ratio between minimum effective concentrations (MEC) to the minimum toxic concentrations (MTC). A TGF?1 inhibitor that achieves in vivo efficacy at 10 mg/kg and shows tolerability or acceptable toxicities at 100 mg/kg provides at least a 10-fold, e.g., 10? therapeutic window. By contrast, a pan-inhibitor of TGF? that is efficacious at 10 mg/kg but causes adverse effects at 5 mg/kg is said to have dose-limiting toxicities. A context-independent TGF?1 inhibitor antibody is efficacious at dosage ranging between about <3 and 30 mg/kg/week and is free of observable toxicities associated with pan-inhibition of TGF? at least 100 mg/kg/week for four weeks in preclinical models such as rats. Based on this, the context-independent TGF?1 inhibitor antibody shows at minimum a 3.3-fold and up to 33-fold therapeutic window.

    [0221] Toxicity or toxicities: have the immunological art-recognized meaning of unwanted in vivo effects in patients associated with a therapy administered to the patients, such as undesirable side effects and adverse events. Tolerability refers to a level of toxicities associated with a therapy or therapeutic regimen, which can be reasonably tolerated by patients, without discontinuing the therapy due to the toxicities, i.e., acceptable level of toxicities. Typically, toxicity/toxicology studies are carried out in one or more preclinical models prior to clinical development to assess safety profiles of a drug candidate, e.g., monoclonal antibody therapy. Toxicity or toxicology studies may help determine the no observed adverse effect level (NOAEL) and the maximally tolerated dose (MTD) of a test article, based on which a therapeutic window may be deduced. Preferably, a species that is shown to be sensitive to the particular intervention should be chosen as a preclinical animal model in which the safety or toxicity analysis is to be carried out. For TGF? inhibition, suitable species include rats, dogs, and cynomologus monkeys. Mice are reported to be less sensitive to pharmacological inhibition of TGF? and may not reveal toxicities that are potentially dangerous in other species, including human, although certain studies report toxicities observed with pan-inhibition of TGF? in mice. To illustrate, the NOAEF for a context-independent TGF?1 inhibitor antibody in rats was the highest dose evaluated (100 mg/kg), suggesting that the MTD is greater than 100 mg/kg per week, based on a four-week toxicology analysis.

    [0222] Treat/treatment: have the medical art-recognized meaning and include therapeutic treatments, prophylactic treatments, and applications in which one reduces the risk that a subject will develop a disorder or other risk factor. The term treat or treatment includes therapeutic treatments, prophylactic treatments, and applications in which one reduces the risk that a subject will develop a disorder or other risk factor. Thus the term is intended to broadly mean: causing therapeutic benefits in a patient by, for example, slowing disease progression, reversing certain disease features, normalizing gene expression, enhancing or boosting the body's immunity; reducing or reversing immune suppression; reducing, removing or eradicating harmful cells or substances from the body; reducing disease burden (e.g., fibrosis and tumor burden); preventing recurrence or relapse; prolonging a refractory period, and/or otherwise improving survival. The term includes therapeutic treatments, prophylactic treatments, and applications in which one reduces the risk that a subject will develop a disorder or other risk factor. Treatment does not require the complete curing of a disorder and encompasses embodiments in which one reduces symptoms or underlying risk factors. In the context of combination therapy, the term may also refer to: i) the ability of a second therapeutic to reduce the effective dosage of a first therapeutic so as to reduce side effects and increase tolerability; ii) the ability of a second therapy to render the patient more responsive to a first therapy; and/or iii) the ability to effectuate additive or synergistic clinical benefits.

    [0223] Variable region: The term variable region or variable domain refers to a portion of the light and/or heavy chains of an antibody, typically including approximately the amino-terminal 120 to 130 amino acids in the heavy chain and about 100 to 110 amino terminal amino acids in the light chain. In certain embodiments, variable regions of different antibodies differ extensively in amino acid sequence even among antibodies of the same species. The variable region of an antibody typically determines specificity of a particular antibody for its target.

    [0224] GARP and LRRC33, on the other hand, are transmembrane proteins expressed on cell surface of certain cells; therefore, GARP-proTGF?1 and LRRC33-proTGF?1 may be collectively referred to as cell-associated (or cell-surface) proTGF?1 complexes, that mediate cell-associated, e.g., immune cell-associated) TGF?1 signaling/activities.

    [0225] Other than in the operating examples, or where otherwise indicated, all numbers expressing quantities of ingredients or reaction conditions used herein should be understood as modified in all instances by the term about. The term about when used in connection with percentages can mean?1%.

    [0226] The indefinite articles a and an, as used herein in the specification and in the claims, unless clearly indicated to the contrary, should be understood to mean at least one.

    [0227] The phrase and/or, as used herein in the specification and in the claims, should be understood to mean either or both of the elements so conjoined, i.e., elements that are conjunctively present in some cases and disjunctively present in other cases. Other elements may optionally be present other than the elements specifically identified by the and/or clause, whether related or unrelated to those elements specifically identified unless clearly indicated to the contrary. Thus, as a non-limiting example, a reference to A and/or B, when used in conjunction with open-ended language such as comprising can refer, in one embodiment, to A without B (optionally including elements other than B); in another embodiment, to B without A (optionally including elements other than A); in yet another embodiment, to both A and B (optionally including other elements); etc.

    [0228] As used herein in the specification and in the claims, the phrase at least one, in reference to a list of one or more elements, should be understood to mean at least one element selected from any one or more of the elements in the list of elements, but not necessarily including at least one of each and every element specifically listed within the list of elements and not excluding any combinations of elements in the list of elements. This definition also allows that elements may optionally be present other than the elements specifically identified within the list of elements to which the phrase at least one refers, whether related or unrelated to those elements specifically identified. Thus, as a non-limiting example, at least one of A and B (or, equivalently, at least one of A or B, or, equivalently at least one of A and/or B) can refer, in one embodiment, to at least one, optionally including more than one, A, with no B present (and optionally including elements other than B); in another embodiment, to at least one, optionally including more than one, B, with no A present (and optionally including elements other than A); in yet another embodiment, to at least one, optionally including more than one, A, and at least one, optionally including more than one, B (and optionally including other elements); etc.

    [0229] Use of ordinal terms such as first, second, third, etc., in the claims to modify a claim element does not by itself connote any priority, precedence, or order of one claim element over another or the temporal order in which acts of a method are performed, but are used merely as labels to distinguish one claim element having a certain name from another element having a same name (but for use of the ordinal term) to distinguish the claim elements.

    [0230] Ranges provided herein are understood to be shorthand for all of the values within the range. For example, a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50, e.g., 10-20, 1-10, 30-40, etc.

    [0231] The disclosure described herein does not concern a process for cloning humans, processes for modifying the germ line genetic identity of humans, uses of human embryos for industrial or commercial purposes or processes for modifying the genetic identity of animals which are likely to cause them suffering with no substantial medical benefit to man or animal, and also animals resulting from such processes.

    Transforming Growth Factor-Beta (TGF?)

    [0232] In mammals, the transforming growth factor-beta (TGF?) superfamily is comprised of at least 33 gene products. These include the bone morphogenetic proteins (BMPs), activins, growth and differentiation factors (GDFs), and the three isoforms of the TGF? family: TGF?1, TGF?2, and TGF?3. The TGF?s are thought to play key roles in diverse processes, such as inhibition of cell proliferation, extracellular matrix (ECM) remodeling, and immune homeostasis. The importance of TGF?1 for T cell homeostasis is demonstrated by the observation that TGF?1?/? mice survive only 3-4 weeks, succumbing to multiorgan failure due to massive immune activation (Kulkarni, A. B., et al., Proc Natl Acad Sci USA, 1993. 90(2): p. 770-4; Shull, M. M., et al., Nature, 1992. 359(6397): p. 693-9). The roles of TGF?2 and TGF?3 are less clear. Whilst the three TGF? isoforms have distinct temporal and spatial expression patterns, they signal through the same receptors, TGF?RI and TGF?RII, although in some cases, for example for TGF?2 signaling, type III receptors such as betaglycan are also required (Feng, X. H. and R. Derynck, Annu Rev Cell Dev Biol, 2005. 21: p. 659-93; Massague, J., Annu Rev Biochem, 1998. 67: p. 753-91). Ligand-induced oligomerization of TGF?RI/II triggers the phosphorylation of SMAD transcription factors, resulting in the transcription of target genes, such as Coil a1, Col3a1, ACTA2, and SERPINE1 (Massague, J., J. Seoane, and D. Wotton, Genes Dev, 2005. 19(23): p. 2783-810). SMAD-independent TGF? signaling pathways have also been described, for example in cancer or in the aortic lesions of Marfan mice (Derynck, R. and Y. E. Zhang, Nature, 2003. 425(6958): p. 577-84; Holm, T. M., et al., Science, 2011. 332(6027): p. 358-61).

    [0233] The biological importance of the TGF? pathway in humans has been validated by genetic diseases. Camurati-Engelman disease results in bone dysplasia due to an autosomal dominant mutation in the TGF #81 gene, leading to constitutive activation of TGF?1 signaling (Janssens, K., et al., J Med Genet, 2006. 43(1): p. 1-11). Patients with Loeys/Dietz syndrome carry autosomal dominant mutations in components of the TGF? signaling pathway, which cause aortic aneurism, hypertelorism, and bifid uvula (Van Laer, L., H. Dietz, and B. Loeys, Adv Exp Med Biol, 2014. 802: p. 95-105). As TGF? pathway dysregulation has been implicated in multiple diseases, several drugs that target the TGF? pathway have been developed and tested in patients, but with limited success. Most TGF? inhibitors described to date lack isoform specificity as briefly summarized below.

    [0234] Fresolimumab, a humanized monoclonal antibody that binds and inhibits all three isoforms of TGF? has been tested clinically in patients with focal segmental glomerulosclerosis, malignant melanoma, renal cell carcinoma, and systemic sclerosis (Rice, L. M., et al., J Clin Invest, 2015. 125(7): p. 2795-807; Trachtman, H., et al., Kidney Int, 2011. 79(11): p. 1236-43; Morris, J. C., et al., PLoS One, 2014. 9(3): p. e90353). Additional companies have developed monoclonal antibodies against the TGF? growth factors with varying degrees of selectivity for TGF? isoforms. Such agents likely elicit toxicities in vivo through residual activity against other TGF? family members besides TGF?1. This lack of isoform specificity may be due to the high degree of sequence identity between isoforms.

    [0235] Other approaches to target the TGF? pathway include ACE-1332, a soluble TGF?RII-Fc ligand trap from Acceleron (Yung, L. M., et al., A Am J Respir Crit Care Med, 2016. 194(9): p. 1140-1151), or small molecule inhibitors of the ALK5 kinase, such as Eli Lilly's galunisertib. ACE-1332 binds TGF?1 and TGF?3 with equally high affinity (Yung, L. M., et al., Am J Respir Crit Care Med, 2016. 194(9): p. 1140-1151), and ALK5 inhibitors block the activity of all growth factors that signal through TGFR1. Substantial toxicities have been found in preclinical studies using ALK5 inhibitors (Anderton, M. J., et al., Toxicol Pathol, 2011. 39(6): p. 916-24; Stauber, A., et al., Clinical Toxicology, 2014. 4(3): p. 1-10), and sophisticated clinical dosing schemes are required to maintain efficacy while reducing adverse events (Herbertz, S., et al., Drug Des Devel Ther, 2015. 9: p. 4479-99). In fact, the question of TGF? signaling specificity and its possible effect on toxicity observed with the known TGF? inhibitors has not been raised in most, if not all, of the candidate drugs that attempted to block TGF?. For example, how much of the toxicities are due to inhibition of TGF?1 versus TGF?2 and/or TGF?3 has not been addressed. Similarly, modes of TGF? activation have not been taken into account in designing or developing ways to antagonize TGF? signaling.

    [0236] Recent structural insights into the activation mechanism of TGF?1 (Shi, M., et al., Nature, 2011. 474(7351): p. 343-9) have enabled more specific approaches to TGF? inhibition (see, e.g., PCT/US2017/21972, the entire contents of which are incorporated herein by reference). Unlike other cytokines, TGF? superfamily members are not secreted as active growth factors, but as dimeric pro-proteins which consist of an N-terminal prodomain and a C-terminal growth factor domain. Cleavage of proTGF?1 by furin proteases separates the homodimeric growth factor domain from its prodomain, also referred to as latency associated peptide (LAP). However, the growth factor and LAP remain noncovalently associated, forming a latent complex which is unable to bind its receptors and induce signaling. During translation, latent TGF?1, also called the small latent complex (SLC), becomes linked to presenting molecules via disulfide bridges, forming the large latent complex (LLC). These molecules allow proTGF?1 to be presented in specific cellular or tissue contexts. Two cysteines near the N-terminus of the latent TGF?1 link to appropriately positioned cysteines on the presenting molecule. The identity of the presenting molecule depends on the environment and cell type producing latent TGF?1. For example, fibroblasts secrete latent TGF?1 tethered to latent TGF?-binding proteins (LTBPs), which then associate with proteins in the extracellular matrix (ECM) (i.e., fibronectin, fibrillin-1) to link latent TGF? to the ECM (Robertson et al. Matrix Biol 47: 44-53 (2015) (FIG. 2A). On the surface of activated regulatory T cells latent TGF?1 is covalently linked to the transmembrane protein GARP (glycoprotein-A repetitions predominant protein (GARP), and a protein closely related to GARP, LRRC33 (leucine-rich repeat-containing protein 33), serves as a presenting molecule for TGF?1 on the surface of monocytes, macrophages and microglia (Wang, R., et al., Mol Biol Cell, 2012. 23(6): p. 1129-39 and T. A. Springer, Int. BMP Conference 2016).

    [0237] A number of studies have shed light on the mechanisms of TGF?1 activation. Three integrins, ?V?6, ?V?8, and ?V?1 have been demonstrated to be key activators of latent TGF?1 (Reed, N. I., et al., Sci Transl Med, 2015. 7(288): p. 288ra79; Travis, M. A. and D. Sheppard, Annu Rev Immunol, 2014. 32: p. 51-82; Munger, J. S., et al., Cell, 1999. 96(3): p. 319-28). ?V integrins bind the RGD sequence present in TGF?1 and TGF?1 LAPs with high affinity (Dong, X., et al., Nat Struct Mol Biol, 2014. 21(12): p. 1091-6). Transgenic mice with a mutation in the TGF?1 RGD site that prevents integrin binding, but not secretion, phenocopy the TGF?1?/? mouse (Yang, Z., et al., J Cell Biol, 2007. 176(6): p. 787-93). Mice that lack both ?6 and ?8 integrins recapitulate all essential phenotypes of TGF?1 and TGF?3 knockout mice, including multiorgan inflammation and cleft palate, confirming the essential role of these two integrins for TGF?1 activation in development and homeostasis (Aluwihare, P., et al., J Cell Sci, 2009. 122(Pt 2): p. 227-32). Key for integrin-dependent activation of latent TGF?1 is the covalent tether to presenting molecules; disruption of the disulfide bonds between GARP and TGF?1 LAP by mutagenesis does not impair complex formation, but completely abolishes TGF?1 activation by ?V?6 (Wang, R., et al., Mol Biol Cell, 2012. 23(6): p. 1129-39). The recent structure of latent TGF?1 illuminates how integrins enable release of active TGF?1 from the latent complex: the covalent link of latent TGF?1 to its presenting molecule anchors latent TGF?1, either to the ECM through LTBPs, or to the cytoskeleton through GARP or LRRC33. Integrin binding to the RGD sequence results in a force-dependent change in the structure of LAP, allowing active TGF?1 to be released and bind nearby receptors (Shi, M., et al., Nature, 2011. 474(7351): p. 343-9). The importance of integrin-dependent TGF?1 activation in disease has also been well validated. A small molecular inhibitor of ?V?1 protects against bleomycin-induced lung fibrosis and carbon tetrachloride-induced liver fibrosis (Reed, N. I., et al., Sci Transl Med, 2015. 7(288): p. 288ra79), and ?V?6 blockade with an antibody or loss of integrin 136 expression suppresses bleomycin-induced lung fibrosis and radiation-induced fibrosis (Munger, J. S., et al., Cell, 1999. 96(3): p. 319-28); Horan, G. S., et al., Am J Respir Crit Care Med, 2008. 177(1): p. 56-65). In addition to integrins, other mechanisms of TGF?1 activation have been implicated, including thrombospondin-1 and activation by proteases such as matrix metalloproteinases (MMPs), cathepsin D or kallikrein. However, the majority of these studies were performed in vitro using purified proteins; there is less evidence for the role of these molecules from in vivo studies. Knockout of thrombospondin-1 recapitulates some aspects of the TGF?1?/? phenotype in some tissues, but is not protective in bleomycin-induced lung fibrosis, known to be TGF?3-dependent (Ezzie, M. E., et al., Am J Respir Cell Mol Biol, 2011. 44(4): p. 556-61). Additionally, knockout of candidate proteases did not result in a TGF?1 phenotype (Worthington, J. J., J. E. Klementowicz, and M. A. Travis, Trends Biochem Sci, 2011. 36(1): p. 47-54). This could be explained by redundancies or by these mechanisms being critical in specific diseases rather than development and homeostasis.

    [0238] TGF? has been implicated in a number of biological processes, including fibrosis, immune-modulation and cancer progression. TGF?1 was the first identified member of the TGF? superfamily of proteins. Like other members of the TGF? superfamily, TGF?1 and the isoforms TGF?2 and TGF?3, are initially expressed as inactive precursor pro-protein forms (termed proTGF?). TGF? proteins (e.g., TGF?1, TGF?2 and TGF?3) are proteolytically cleaved by proprotein convertases (e.g., furin) to yield the latent form (termed latent TGF?). In some embodiments, a pro-protein form or latent form of a TGF? protein (e.g., TGF?1, TGF?2 and TGF?3) may be referred to as pro/latent TGF? protein. TGF?1 may be presented to other molecules in complex with multiple molecules including, for example, GARP (to form a GARP-TGF?1 complex), LRRC33 (to form a LRRC33-TGF?1 complex), LTBP1 (to form a LTBP1-TGF?1 complex), and/or LTBP3 (to form a LTBP3-TGF?1 complex). The TGF?1 present in these complexes may be in either latent form (latent TGF?1) or in precursor form (proTGF?1).

    Binding Regions and Epitopes

    [0239] In the context of the present disclosure, the binding region of an antigen provides a structural basis for the antibody-antigen interaction. As used herein, a binding region refers to the areas of interface between the antibody and the antigen, such that, when bound to the proTGF?1 complex (antigen) in a physiological solution, the antibody or the fragment protects the binding region from solvent exposure, as determined by suitable techniques, such as hydrogen-deuterium exchange mass spectrometry (HDX-MS).

    [0240] In some embodiments, the first binding region and/or the second binding region confers the isoform selectivity of the antibody or the fragment.

    [0241] Advantageously, preferred inhibitory antibodies of the present disclosure are capable of inhibiting the release of mature growth factor from a latent complex associated with LTBP1 or LTBP3, thereby reducing growth factor signaling. Such antibodies may target any epitope that results in a reduction of growth factor release or activity when associated with such antibodies. In some embodiments, the antibodies of the present disclosure specifically bind a combinatorial epitope, i.e., an epitope formed by two or more components/portions of an antigen or antigen complex. For example, a combinatorial epitope may be formed by contributions from multiple portions of a single protein, i.e., amino acid residues from more than one non-contiguous segments of the same protein. Alternatively, a combinatorial epitope may be formed by contributions from multiple protein components of an antigen complex. In some embodiments, the antibodies of the present disclosure specifically bind a conformational epitope (or conformation-specific epitope), e.g., an epitope that is sensitive to the three-dimensional structure (i.e., conformation) of an antigen or antigen complex. In preferred embodiments, the combinatorial epitope comprises an amino acid residue within Alpha-1 Helix and optionally an amino acid residue within the growth factor domain. In preferred embodiments, the TGF?1 inhibitor is Ab42 or a variant thereof. Alternatively, in some embodiments, the TGF?1 inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the N-terminal stretch of amino acids DMELVKRKRIEAIR (SEQ ID NO: 46) within the so-called alpha-1 helix region of the prodomain of the latent proTGF?1 complex. In some embodiments, the antibody or the fragment contacts one or more of the following residues within the prodomain: Asp27 (D); Leu3 (L); Arg33 (R); Ile36 (I); Glu37 (E) (shown in bold above). Additionally or alternatively, in some embodiments, the inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the amino acid sequence YIDFRKDLGWK (SEQ ID NO: 93) within the TGF?1 growth factor domain (e.g., the finger-1 domain). In some embodiments, the antibody or fragment thereof contacts one or more of the following residues: Tyr289 (Y); Lys294 (K); Asp295 (D) (shown in bold above). In some embodiments, such antibody binds a conformational epitope comprising one or more residues of DMELVKRKRIEAIR (SEQ ID NO: 46) and one or more residues of YIDFRKDLGWK (SEQ ID NO: 93), wherein the antibody is not Ab42.

    TABLE-US-00001 TABLE1 Selectproteindomains/modulesofhumanTGFB1polypeptide HumanTGF?1 SEQID domain/module AminoAcidSequence NO Latency LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLP 47 Associated EAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETH Peptide(LAP) NEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKL (prodomain) KVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVV RQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGD LATIHGMNRPFLLLMATPLERAQHLQSSRHRR StraightJacket LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLP 48 GrowthFactor ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANF 49 Domain CLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPL PIVYYVGRKPKVEQLSNMIVRSCKCS Fastener residues74-76,YYA Furincleavage RHRR 50 site Arm EAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETH 51 NEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKL KVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVV RQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGD LATIHGMNRPFLLLMATPLERAQHLQSSRHRR Finger-1 CVRQLYIDFRKDLGWKWIHEPKGYHANFC 52 Finger-2 CVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS 53 Residuefor Cys4 presenting molecule association LatencyLasso LASPPSQGEVPPGPL 54 ExtendedLatency LASPPSQGEVPPGPLPEAVLALYNSTR 55 Lasso Alpha-1Helix LSTCKTIDMELVKRKRIEAIRGQILSKLR 56 (Preferredbindingregionunderlined) VKRKRIEA 9 DMELVKRKRIEAIR 46 Alpha-2Helix AVLALYNSTR 57 TriggerLoop NGFTTGRRGDLATIHGMNRP 58 Integrinbinding residue215-217,RGD Bowtie CSCDSRDNTLQVD 59

    Latent TGF?-Binding Proteins (LTBPs)

    [0242] In mammals there are four known LTBPs, LTBP1-4, each with multiple splice variants (Robertson, I. B., et al., Matrix Biol, 2015. 47: p. 44-53). LTBP2 is the only LTBP that does not associate with latent TGF? (Saharinen, J. and J. Keski-Oja, Mol Biol Cell, 2000. 11(8): p. 2691-704). While the association between LTBP1 or LTBP3 and latent TGF?1 has been well validated, the role of LTBP4 in TGF? presentation is less clear. The complex with LTBP4 and latent TGF?1 appears to form much less efficiently, potentially due to the absence of several negatively charged residues in the TGF?-binding domain of LTBP4 (Saharinen, J. and J. Keski-Oja, Mol Biol Cell, 2000. 11(8): p. 2691-704; Chen, Y., et al., J Mol Biol, 2005. 345(1): p. 175-86). Both LTBP4S?/? mice and Urban-Rifkin-Davis syndrome patients, who have null mutations in LTBP4, suffer from disrupted elastic fiber assembly (Urban, Z., et al., Am J Hum Genet, 2009. 85(5): p. 593-605; Dabovic, B., et al., J Cell Physiol, 2015. 230(1): p. 226-36). Additionally, while LTBP4S?/? mice have a lung septation and an elastogenesis defect, transgenic mice with an LTBP4 that cannot form a complex with latent TGF?1 have no obvious phenotype (Dabovic, B., et al., J Cell Physiol, 2015. 230(1): p. 226-36). Whether LTBP4 is directly involved in regulation of latent TGF?1 by functioning as a presenting molecule is unclear; LTBP4 may instead be required for proper formation of elastic fibrils in the ECM and its loss indirectly affect latent TGF?1 activation through defects in the ECM.

    [0243] In one aspect, the present disclosure is directed to inhibitors, e.g., immunoglobulins, e.g., antibodies, or antigen binding portions thereof, that selectively bind to a complex containing a TGF? pro-protein and a LTBP protein (e.g., LTBP1 or LTBP3). In a preferred embodiment, the TGF? protein is TGF?1. In some embodiments, the binding molecules disclosed herein bind selectively to a complex containing pro/latent TGF?1 and LTBP1 or LTBP3. Such binding molecules can allow TGF?1 activity to be selectively modulated in a context-dependent manner, i.e., by modulating TGF?1 in the context of a LTPB protein, without modulating the activity of TGF?1 complexed with other presenting molecules (e.g., GARP and/or LRRC33).

    Inhibitors that Selectively Bind to a LTBP-TGF?1 Complex

    [0244] The present disclosure provides novel, TGF?1 inhibitors that selectively target matrix- or ECM-associated TGF?1 activities. More specifically, such inhibitors include isoform-specific, context-selective inhibitors of TGF?1 activation that specifically bind latent forms of TGF?1 (e.g., proTGF?1 complex) within the ECM environment and prevent release of mature growth factor from the complex at the niche. Such matrix-targeting inhibitors are context-specific in that they selectively bind proTGF?1 associated with ECM presenting molecules, namely, LTBP1 and/or LTBP3. Thus, disclosed herein are monoclonal antibodies and fragments thereof capable of binding an epitope present in an LTBP1-proTGF?1 complex and/or LTBP3-proTGF?1 complex, whereas the epitope is not present in a GARP-proTGF?1 complex and/or LRRC33-proTGF?1 complex.

    [0245] In some embodiments, the context-selective inhibitors of the present disclosure are capable of specifically binding both a human LTBP1-proTGF?1 complex and a human LTBP3-proTGF?1 complex, with affinities of at least 10 nM (measured K.sub.D values) in a suitable in vitro binding assay, such as Octet. On the other hand, these context-specific antibodies show significantly less binding (e.g., at least 50-fold, preferably 100-fold reduced affinities) to a human GARP-proTGF?1 complex or a human LRRC33-proTGF?1 complex under the same assay conditions.

    [0246] The TGF?1 present in these complexes may be in either latent form (latent TGF?1) or in precursor form (proTGF?1). In one embodiment, the inhibitors do not significantly bind to LTBP1 alone (e.g., when not complexed with TGF?1). In another embodiment, the inhibitors do not significantly bind to LTBP3 alone (e.g., when not complexed with TGF?1). In another embodiment, the inhibitors do not significantly bind to TGF?1 alone (e.g., pro or latent TGF?1 not complexed with LTBP1 or LTBP3, or mature TGF?1). In another embodiment, the inhibitors that selectively bind a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex do not significantly bind to a complex containing TGF?1 and another presenting molecule, e.g., a GARP-TGF?1 complex (e.g., GARP complexed to pro- or latent TGF?1) and/or a LRRC33-TGF?1 complex (e.g., LRRC33 complexed to pro- or latent TGF?1). In one embodiment, the inhibitors that selectively bind LTBP1/3-TGF?1 do not significantly bind one or more (e.g., two or more, three or more, or all four) of the following: LTBP1 alone, TGF?1 alone, a GARP-TGF?1 complex, and a LRRC33-TGF?1 complex. In addition, in some embodiments, the inhibitors do not significantly bind LTBP3 alone.

    [0247] As used herein, the term inhibitor refers to any agent capable of blocking or antagonizing TGF?1 signaling. Such agents may include small molecule antagonists of TGF?1 and biologic antagonists of TGF?1 (e.g., protein fragments and antibodies). In some embodiments, the inhibitor may be an antibody (including fragments thereof, such as Domain Antibodies (dAbs) as described in, for example, U.S. Pat. Nos. 6,291,158; 6,582,915; 6,593,081; 6,172,197; and 6,696,245), a small molecule inhibitor, an Adnectin, an Affibody, a DARPin, an Anticalin, an Avimer, a Versabody or a gene therapy. Use of inhibitors encompassed by the present disclosure also includes antibody mimetics, such as monobodies and single-domain antibodies. Monobodies are synthetic binding proteins that typically employ a fibronectin type III domain (FN3) as a molecular scaffold. Monobodies include Adnectins? which are based on the 10th fibronectin type III domain.

    [0248] In some aspects, the inhibitors, e.g., antibodies, or antigen binding portions thereof, selectively bind to an epitope present on a LTBP1/3-TGF?1 complex, that is not present on a GARP-TGF?1 complex and/or a LRRC33-TGF?1 complex. In some embodiments, the epitope is available due to a conformational change in LTBP1/3 and/or TGF?1 that occurs when LTBP1/3 and TGF?1 form a complex. In this embodiment, the epitope is not present in LTBP1/3 or TGF?1 when the proteins are not associated in a complex. In one embodiment, the epitope is present on TGF?1, when TGF?1 is in a complex with LTBP1 or LTBP3. In another embodiment, the epitope is present on LTBP1, when LTBP1 is in a complex with TGF?1. In another embodiment, the epitope is present on LTBP3, when LTBP3 is in a complex with TGF?1. In another embodiment, the epitope comprises residues from both LTBP1 and TGF?1. In another embodiment, the epitope comprises residues from both LTBP3 and TGF?1. In some embodiments, the epitope is not accessible for binding by the antibody or a fragment thereof when the proTGF?1 complex is associated with a cell via a cell-surface presenting molecule such as GARP and LRRC33.

    [0249] In preferred embodiments, the TGF?1 inhibitor is Ab42 or a variant thereof. Alternatively, in some embodiments, the TGF?1 inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the N-terminal stretch of amino acids DMELVKRKRIEAIR (SEQ ID NO: 46) within the so-called alpha-1 helix region of the prodomain of the latent proTGF?1 complex. In some embodiments, the antibody or the fragment contacts one or more of the following residues within the prodomain: Asp27 (D); Leu30 (L); Arg33 (R); Ile36 (I); Glu37 (E) (shown in bold above). Additionally or alternatively, in some embodiments, the inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the amino acid sequence YIDFRKDLGWK (SEQ ID NO: 93) within the TGF?1 growth factor domain (e.g., the finger-1 domain). In some embodiments, the antibody or fragment thereof contacts one or more of the following residues: Tyr289 (Y); Lys294 (K); Asp295 (D) (shown in bold above). In some embodiments, such antibody binds a conformational epitope comprising one or more residues of DMELVKRKRIEAIR (SEQ ID NO: 46) and one or more residues of YIDFRKDLGWK (SEQ ID NO: 93), wherein the antibody is not Ab42.

    [0250] In one aspect, the disclosure provides functional inhibitors, e.g., antibodies, that modulate TGF?1 activity. In exemplary embodiments, the antibodies described herein are inhibitory antibodies, which inhibit the function or activity of TGF?1. In some embodiments, the antibodies, or antigen binding portions thereof, inhibit the activation (release) of TGF?1 from a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex. The present disclosure provides, in exemplary embodiments, context-specific or context-selective inhibitors of TGF?1 activation. Such inhibitors can bind a LTBP1/3-TGF?1 complex and inhibit activation of TGF?1 that is presented by LTBP1 or LTBP3, without inhibiting the activation of TGF?1 presented by GARP and/or LRRC33. Accordingly, in some embodiments, the antibodies, or antigen binding portions thereof, described herein inhibit the release of mature TGF?1 from a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex, but do not inhibit the release of mature TGF?1 from a GARP-TGF?1 complex and/or a LRRC33-TGF?1 complex. Due to the differential localization of LTBP, GARP, and LRRC33, the context-specific inhibitors of TGF?1 provided by the present disclosure can block a particular subset of TGF?1 activity in vivo. In one embodiment, the context-specific antibodies provided herein that inhibit LTBP1/3-TGF?1 but do not inhibit GARP-TGF?1 or LRRC33-TGF?1 can be used to inhibit TGF?1 localized to the extracellular matrix. In another embodiment, the context-specific antibodies can inhibit TGF?1 without modulating TGF?1-associated immune activity or immune response. In another embodiment, the context-specific antibodies can be used to inhibit TGF?1 activity associated with the extracellular matrix without modulating TGF?1 activity associated with hematopoietic cells. Accordingly, the context-specific antibodies can be used to inhibit LTBP1/3-associated TGF?1 activity in applications in which TGF?1 activation in the context of GARP and/or LRRC33 is undesirable, as described herein.

    [0251] In some embodiments, the TGF?1 comprises a naturally occurring mammalian amino acid sequence. In some embodiment, the TGF?1 comprises a naturally occurring human amino acid sequence. In some embodiments, the TGF?1 comprises a human, a monkey, a rat or a mouse amino acid sequence.

    [0252] In some embodiments, an antibody, or antigen binding portion thereof, described herein selectively binds to a complex comprising a TGF?1 protein comprising the amino acid sequence set forth in SEQ ID NO: 9, and LTBP1 or LTBP3. In some embodiments, an antibody, or antigen binding portion thereof, described herein selectively binds to a LTBP1/3-TGF?1 complex which comprises a non-naturally-occurring TGF?1 amino acid sequence (otherwise referred to herein as a non-naturally-occurring TGF?1). For example, a non-naturally-occurring TGF?1 may comprise one or more recombinantly generated mutations relative to a naturally-occurring TGF?1 amino acid sequence.

    [0253] In some embodiments, an antibody, or antigen binding portion thereof, described herein does not bind TGF?2 and/or TGF?3, or to protein complexes containing TGF?2 and/or TGF?3. Exemplary TGF?2 and TGF?3 amino acid sequences are set forth in SEQ ID NOs: 10 and 11, respectively. In some embodiments, a TGF?1, TGF?2, or TGF?3 amino acid sequence comprises an amino acid sequence as set forth in SEQ ID NOs: 12-23, as shown in Table 2. In some embodiments, a TGF?1 amino acid sequence comprises an amino acid sequence as set forth in SEQ ID NOs: 24-31, as shown in Table 3.

    TABLE-US-00002 TGF?1 (SEQIDNO:60) LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVL ALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQS THSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSN NSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSC DSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSS RHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCL GPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGR KPKVEQLSNMIVRSCKCS TGF?2 (SEQIDNO:61) SLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEPEEVPPEVI SIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENA IPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRI ELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKD RNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQ KTIKSTRKKNSGKTPHLLLMLLPSYRLESQQTNRRKKRALDAAYCFRNV QDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSR VLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSC KCS TGF?3 (SEQIDNO:62) SLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPTVMTHVPYQV LALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHN ELAVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQR IELFQILRPDEHIAKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRE SNLGLEISIHCPCHTFQPNGDILENIHEVMEIKFKGVDNEDDHGRGDLG RLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKRALDTNYCFRNLEEN CCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSTVLG LYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS

    TABLE-US-00003 TABLE2 ExemplaryTGF?1,TGF?2,andTGF?3aminoacidsequences SEQ ID Protein Sequence NO proTGF?1 LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPE 63 AVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHN EIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKV EQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQ WLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATI HGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNC CVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQY SKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLS NMIVRSCKCS proTGF?1C4S LSTSKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPE 64 AVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHN EIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKV EQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQ WLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATI HGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNC CVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQY SKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLS NMIVRSCKCS proTGF?1D2G LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPE 14 AVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHN EIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKV EQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQ WLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATI HGMNRPFLLLMATPLERAQHLQSSRHGALDTNYCFSSTEKNCC VRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSK VLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNM IVRSCKCS proTGF?1C4SD2G LSTSKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPE 15 AVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHN EIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKV EQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQ WLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATI HGMNRPFLLLMATPLERAQHLQSSRHGALDTNYCFSSTEKNCC VRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSK VLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNM IVRSCKCS proTGF?2 SLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEPEEVP 16 PEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMP PFFPSENAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRL QNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWL SFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIPNKSE ELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSY RLESQQTNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASA SPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS proTGF?2C5S SLSTSSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEPEEVP 17 PEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMP PFFPSENAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRL QNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWL SFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIPNKSE ELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSY RLESQQTNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASA SPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS proTGF?2C5SD2G SLSTSSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEPEEVP 18 PEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMP PFFPSENAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRL QNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWL SFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIPNKSE ELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSY RLESQQTNRRKGALDAAYCFRNVQDNCCLRPLYIDFKRDLGWK WIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASAS PCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS proTGF?2D2G SLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEPEEVP 19 PEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMP PFFPSENAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRL QNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWL SFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIPNKSE ELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSY RLESQQTNRRKGALDAAYCFRNVQDNCCLRPLYIDFKRDLGWK WIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASAS PCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS proTGF?3 SLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPTVMTHVP 20 YQVLALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDM IQGLAEHNELAVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLR VPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEWL SFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIHEV MEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLD NPGQGGQRKKRALDTNYCFRNLEENCCVRPLYIDFRQDLGWK WVHEPKGYYANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASA SPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS proTGF?3C7S SLSLSTSTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPTVMTHVP 21 YQVLALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDM IQGLAEHNELAVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLR VPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEWL SFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIHEV MEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLD NPGQGGQRKKRALDTNYCFRNLEENCCVRPLYIDFRQDLGWK WVHEPKGYYANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASA SPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS proTGF?3C7SD2G SLSLSTSTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPTVMTHVP 22 YQVLALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDM IQGLAEHNELAVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLR VPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEWL SFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIHEV MEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLD NPGQGGQRKGALDTNYCFRNLEENCCVRPLYIDFRQDLGWKW VHEPKGYYANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASP CCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS proTGF?3D2G SLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPTVMTHVP 23 YQVLALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDM IQGLAEHNELAVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLR VPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEWL SFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIHEV MEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLD NPGQGGQRKGALDTNYCFRNLEENCCVRPLYIDFRQDLGWKW VHEPKGYYANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASP CCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS

    TABLE-US-00004 TABLE3 Exemplarynon-humanTGF?1aminoacidsequences SEQ ID Protein Species Sequence NO proTGF?1 Mouse LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPL 24 PEAVLALYNSTRDRVAGESADPEPEPEADYYAKEVTRVLMV DRNNAIYEKTKDISHSIYMFFNTSDIREAVPEPPLLSRAELRLQ RLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFD VTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS PKRRGDLGTIHDMNRPFLLLMATPLERAQHLHSSRHRRALDT NYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCL GPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPL PIVYYVGRKPKVEQLSNMIVRSCKCS proTGF?1 Cyno LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPL 25 PEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMV ETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRL LRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSF DVTGVVRQWLSRGGEIEGFRLSAHCSCDSKDNTLQVDINGF TTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRAL DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANF CLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALE PLPIVYYVGRKPKVEQLSNMIVRSCKCS TGF?1LAP Mouse LSTSKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPL 26 C4S PEAVLALYNSTRDRVAGESADPEPEPEADYYAKEVTRVLMV DRNNAIYEKTKDISHSIYMFFNTSDIREAVPEPPLLSRAELRLQ RLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFD VTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS PKRRGDLGTIHDMNRPFLLLMATPLERAQHLHSSRHRR TGF?1LAP Cyno LSTSKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPL 27 C4S PEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMV ETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRL LRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSF DVTGVVRQWLSRGGEIEGFRLSAHCSCDSKDNTLQVDINGF TTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRR proTGF?1 Mouse LSTSKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPL 28 C4SD2G PEAVLALYNSTRDRVAGESADPEPEPEADYYAKEVTRVLMV DRNNAIYEKTKDISHSIYMFFNTSDIREAVPEPPLLSRAELRLQ RLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFD VTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS PKRRGDLGTIHDMNRPFLLLMATPLERAQHLHSSRHGALDT NYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCL GPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPL PIVYYVGRKPKVEQLSNMIVRSCKCS proTGF?1 Mouse LSTSKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPL 29 C4S PEAVLALYNSTRDRVAGESADPEPEPEADYYAKEVTRVLMV DRNNAIYEKTKDISHSIYMFFNTSDIREAVPEPPLLSRAELRLQ RLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFD VTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS PKRRGDLGTIHDMNRPFLLLMATPLERAQHLHSSRHRRALDT NYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCL GPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPL PIVYYVGRKPKVEQLSNMIVRSCKCS proTGF?1 Cyno LSTSKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPL 30 C4S PEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMV ETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRL LRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSF DVTGVVRQWLSRGGEIEGFRLSAHCSCDSKDNTLQVDINGF TTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRAL DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANF CLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALE PLPIVYYVGRKPKVEQLSNMIVRSCKCS proTGF?1 Cyno LSTSKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPL 31 C4SD2G PEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMV ETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRL LRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSF DVTGVVRQWLSRGGEIEGFRLSAHCSCDSKDNTLQVDINGF TTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHGALDT NYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCL GPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPL PIVYYVGRKPKVEQLSNMIVRSCKCS

    [0254] In some embodiments, an antibody, or antigen binding portion thereof, as described herein, is capable of selectively binding to a LTBP-TGF?1 complex. In some embodiments, antigenic protein complexes (e.g., a LTBP-TGF?1 complex) may comprise one or more LTBP proteins (e.g., LTBP1, LTBP2, LTBP3, and LTBP4).

    [0255] In some embodiments, the antibody, or antigen binding portion thereof, selectively binds a LTBP1-TGF?1 complex. In some embodiments, the LTBP1 protein is a naturally-occurring protein. In some embodiments, the LTBP1 protein is a non-naturally occurring protein. In some embodiments, the LTBP1 protein is a recombinant protein. Such recombinant LTBP1 protein may comprise LTBP1, alternatively spliced variants thereof, and/or fragments thereof. Recombinant LTBP1 proteins may also be modified to comprise one or more detectable labels. In some embodiments, the LTBP1 protein comprises a leader sequence (e.g., a native or non-native leader sequence). In some embodiments, the LTBP1 protein does not comprise a leader sequence (i.e., the leader sequence has been processed or cleaved). Such detectable labels may include, but are not limited to biotin labels, polyhistidine tags, myc tags, HA tags and/or fluorescent tags. In some embodiments, the LTBP1 protein is a mammalian LTBP1 protein. In some embodiments, the LTBP1 protein is a human, a monkey, a mouse, or a rat LTBP1 protein. In some embodiments, the LTBP1 protein comprises an amino acid sequence as set forth in SEQ ID NO: 32 in Table 4. In some embodiments, the LTBP1 protein comprises an amino acid sequence as set forth in SEQ ID NOs: 33 or SEQ ID NO: 34 in Table 3.

    [0256] In some embodiments, an antibody, or antigen binding portion thereof, as described herein, is capable of binding to a LTBP3-TGF?1 complex. In some embodiments, the LTBP3 protein is a naturally-occurring protein. In some embodiments, the LTBP3 protein is a non-naturally occurring protein. In some embodiments, the LTBP3 protein is a recombinant protein. Such recombinant LTBP3 protein may comprise LTBP3, alternatively spliced variants thereof and/or fragments thereof. In some embodiments, the LTBP3 protein comprises a leader sequence (e.g., a native or non-native leader sequence). In some embodiments, the LTBP3 protein does not comprise a leader sequence (i.e., the leader sequence has been processed or cleaved). Recombinant LTBP3 proteins may also be modified to comprise one or more detectable labels. Such detectable labels may include, but are not limited to biotin labels, polyhistidine tags, myc tags, HA tags and/or fluorescent tags. In some embodiments, the LTBP3 protein is a mammalian LTBP3 protein. In some embodiments, the LTBP3 protein is a human, a monkey, a mouse, or a rat LTBP3 protein. In some embodiments, the LTBP3 protein comprises an amino acid sequence as set forth in SEQ ID NO: 35. In some embodiments, the LTBP3 protein comprises an amino acid sequence as set forth in SEQ ID NOs: 36 or 37.

    [0257] In some embodiments, antigenic protein complexes may be so-called a small latent complex (or SLC), comprised of a dimeric complex of the LAP (or prodomain) and a growth factor domain. In other embodiments, antigenic protein complexes may be so-called a large latent complex (or LLC) which further comprises a presenting molecule bound to a SLC. Presenting molecules include LTBP proteins (e.g., LTBP1, LTBP2, LTBP3, and LTBP4), CARP proteins, LRRC33 proteins, or fragment(s) thereof. When LLCs are used as antigenic protein complexes, typically, a minimum required fragment suitable for carrying out the embodiments disclosed herein includes at least 50 amino acids, preferably at least 100 amino acids, of a presenting molecule protein, comprising at least two cysteine residues capable of forming disulfide bonds with a proTGF?1 complex. Specifically, these Cys residues form covalent bonds with Cysteine resides present near the N-terminus of each monomer of the proTGF?1 complex.

    TABLE-US-00005 TABLE4A ExemplaryLTBPaminoacidsequences SEQID Protein Species Sequence NO LTBP1S Human NHTGRIKVVFTPSICKVTCTKGSCQNSCEKGNTTTLISE 32 NGHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQCP PNFTGKLCQIPVHGASVPKLYQHSQQPGKALGTHVIHS THTLPLTVTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQ VSRIDGPTGQKTKEAQPGQSQVSYQGLPVQKTQTIHST YSHQQVIPHVYPVAAKTQLGRCFQETIGSQCGKALPGL SKQEDCCGTVGTSWGFNKCQKCPKKPSYHGYNQMM ECLPGYKRVNNTFCQDINECQLQGVCPNGECLNTMGS YRCTCKIGFGPDPTFSSCVPDPPVISEEKGPCYRLVSS GRQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPG TAAFKEICPGGMGYTVSGVHRRRPIHHHVGKGPVFVK PKNTQPVAKSTHPPPLPAKEEPVEALTFSREHGPGVAE PEVATAPPEKEIPSLDQEKTKLEPGQPQLSPGISTIHLH PQFPVVIEKTSPPVPVEVAPEASTSSASQVIAPTQVTEI NECTVNPDICGAGHCINLPVRYTCICYEGYRFSEQQRK CVDIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASE EGTNCIDVDECLRPDVCGEGHCVNTVGAFRCEYCDSG YRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVP CTEGFRGWNGQCLDVDECLEPNVCANGDCSNLEGSY MCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCKN TEGSFRCTCGQGYQLSAAKDQCEDIDECQHRHLCAHG QCRNTEGSFQCVCDQGYRASGLGDHCEDINECLEDKS VCQRGDCINTAGSYDCTCPDGFQLDDNKTCQDINECE HPGLCGPQGECLNTEGSFHCVCQQGFSISADGRTCED IDECVNNTVCDSHGFCDNTAGSFRCLCYQGFQAPQDG QGCVDVNECELLSGVCGEAFCENVEGSFLCVCADENQ EYSPMTGQCRSRTSTDLDVDVDQPKEEKKECYYNLND ASLCDNVLAPNVTKQECCCTSGVGWGDNCEIFPCPVL GTAEFTEMCPKGKGFVPAGESSSEAGGENYKDADECL LFGQEICKNGFCLNTRPGYECYCKQGTYYDPVKLQCF DMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLDASE KRCIRPAESNEQIEETDVYQDLCWEHLSDEYVCSRPLV GKQTTYTECCCLYGEAWGMQCALCPLKDSDDYAQLC NIPVTGRRQPYGRDALVDFSEQYTPEADPYFIQDRFLN SFEELQAEECGILNGCENGRCVRVQEGYTCDCFDGYH LDTAKMTCVDVNECDELNNRMSLCKNAKCINTDGSYK CLCLPGYVPSDKPNYCTPLNTALNLEKDSDLE LTBP1S Cyno NHTGRIKVVFTPSICKVTCTKGSCQNSCEKGNTTTLISE 33 NGHAADTLTATNFRVVLCHLPCMNGGQCSSRDKCQC PPNFTGKLCQIPVHGASVPKLYQHSQQPGKALGTHVIH STHTLPLTVTSQQGVKVKFPPNIVNIHVKHPPEASVQIH QVSRIDGPTGQKTKEAQPGQSQVSYQGLPVQKTQTIH STYSHQQVIPHVYPVAAKTQLGRCFQETIGSQCGKALP GLSKQEDCCGTVGTSWGFNKCQKCPKKPSYHGYNQM MECLPGYKRVNNTFCQDINECQLQGVCPNGECLNTMG SYRCTCKIGFGPDPTFSSCVPDPPVISEEKGPCYRLVS SGRQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLP GTAAFKEICPGGMGYTVSGVHRRRPIHHHVGKGPVFV KPKNTQPVAKSTHPPPLPAKEEPVEALTFSREHGPGVA EPEVATAPPEKEIPSLDQEKTKLEPGQPQLSPGISTIHL HPQFPVVIEKTSPPVPVEVAPEASTSSASQVIAPTQVTE INECTVNPDICGAGHCINLPVRYTCICYEGYKFSEQQRK CVDIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASE EGTNCIDVDECLRPDVCGEGHCVNTVGAFRCEYCDSG YRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVP CTEGFRGWNGQCLDVDECLEPNVCTNGDCSNLEGSY MCSCHKGYTRTPDHKHCKDIDECQQGNLCVNGQCKN TEGSFRCTCGQGYQLSAAKDQCEDIDECQHHHLCAHG QCRNTEGSFQCVCDQGYRASGLGDHCEDINECLEDKS VCQRGDCINTAGSYDCTCPDGFQLDDNKTCQDINECE HPGLCGPQGECLNTEGSFHCVCQQGFSISADGRTCED IDECVNNTVCDSHGFCDNTAGSFRCLCYQGFQAPQDG QGCVDVNECELLSGVCGEAFCENVEGSFLCVCADENQ EYSPMTGQCRSRTSTDLDVEQPKEEKKECYYNLNDAS LCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVLGT AEFTEMCPKGKGFVPAGESSSEAGGENYKDADECLLF GQEICKNGFCLNTRPGYECYCKQGTYYDPVKLQCFDM DECQDPSSCIDGQCVNTEGSYNCFCTHPMVLDASEKR CIRPAESNEQIEETDVYQDLCWEHLSDEYVCSRPLVGK QTTYTECCCLYGEAWGMQCALCPMKDSDDYAQLCNIP VTGRRQPYGRDALVDFSEQYAPEADPYFIQDRFLNSFE ELQAEECGILNGCENGRCVRVQEGYTCDCFDGYHLDT AKMTCVDVNECDELNNRMSLCKNAKCINTEGSYKCLC LPGYVPSDKPNYCTPLNTALNLEKDSDLE LTBP1S mouse NHTGRIKVVFTPSICKVTCTKGNCQNSCQKGNTTTLISE 34 NGHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQCP PNFTGKLCQIPVLGASMPKLYQHAQQQGKALGSHVIHS THTLPLTMTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQ VSRIDSPGGQKVKEAQPGQSQVSYQGLPVQKTQTVHS TYSHQQLIPHVYPVAAKTQLGRCFQETIGSQCGKALPG LSKQEDCCGTVGTSWGFNKCQKCPKKQSYHGYTQMM ECLQGYKRVNNTFCQDINECQLQGVCPNGECLNTMGS YRCSCKMGFGPDPTFSSCVPDPPVISEEKGPCYRLVS PGRHCMHPLSVHLTKQICCCSVGKAWGPHCEKCPLPG TAAFKEICPGGMGYTVSGVHRRRPIHQHIGKEAVYVKP KNTQPVAKSTHPPPLPAKEEPVEALTSSWEHGPRGAE PEVVTAPPEKEIPSLDQEKTRLEPGQPQLSPGVSTIHLH PQFPVVVEKTSPPVPVEVAPEASTSSASQVIAPTQVTEI NECTVNPDICGAGHCINLPVRYTCICYEGYKFSEQLRK CVDIDECAQVRHLCSQGRCENTEGSFLCVCPAGFMAS EEGTNCIDVDECLRPDMCRDGRCINTAGAFRCEYCDS GYRMSRRGYCEDIDECLKPSTCPEEQCVNTPGSYQCV PCTEGFRGWNGQCLDVDECLQPKVCTNGSCTNLEGS YMCSCHRGYSPTPDHRHCQDIDECQQGNLCMNGQCR NTDGSFRCTCGQGYQLSAAKDQCEDIDECEHHHLCSH GQCRNTEGSFQCVCNQGYRASVLGDHCEDINECLEDS SVCQGGDCINTAGSYDCTCPDGFQLNDNKGCQDINEC AQPGLCGSHGECLNTQGSFHCVCEQGFSISADGRTCE DIDECVNNTVCDSHGFCDNTAGSFRCLCYQGFQAPQD GQGCVDVNECELLSGVCGEAFCENVEGSFLCVCADEN QEYSPMTGQCRSRVTEDSGVDRQPREEKKECYYNLN DASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPV QGTAEFTEMCPRGKGLVPAGESSYDTGGENYKDADE CLLFGEEICKNGYCLNTQPGYECYCKQGTYYDPVKLQ CFDMDECQDPNSCIDGQCVNTEGSYNCFCTHPMVLDA SEKRCVQPTESNEQIEETDVYQDLCWEHLSEEYVCSR PLVGKQTTYTECCCLYGEAWGMQCALCPMKDSDDYA QLCNIPVTGRRRPYGRDALVDFSEQYGPETDPYFIQDR FLNSFEELQAEECGILNGCENGRCVRVQEGYTCDCFD GYHLDMAKMTCVDVNECSELNNRMSLCKNAKCINTEG SYKCLCLPGYIPSDKPNYCTPLNSALNLDKESDLE LTBP3 Human GPAGERGAGGGGALARERFKVVFAPVICKRTCLKGQC 35 RDSCQQGSNMTLIGENGHSTDTLTGSGFRVVVCPLPC MNGGQCSSRNQCLCPPDFTGRFCQVPAGGAGGGTG GSGPGLSRTGALSTGALPPLAPEGDSVASKHAIYAVQV IADPPGPGEGPPAQHAAFLVPLGPGQISAEVQAPPPVV NVRVHHPPEASVQVHRIESSNAESAAPSQHLLPHPKPS HPRPPTQKPLGRCFQDTLPKQPCGSNPLPGLTKQEDC CGSIGTAWGQSKCHKCPQLQYTGVQKPGPVRGEVGA DCPQGYKRLNSTHCQDINECAMPGVCRHGDCLNNPG SYRCVCPPGHSLGPSRTQCIADKPEEKSLCFRLVSPEH QCQHPLTTRLTRQLCCCSVGKAWGARCQRCPTDGTA AFKEICPAGKGYHILTSHQTLTIQGESDFSLFLHPDGPP KPQQLPESPSQAPPPEDTEEERGVTTDSPVSEERSVQ QSHPTATTTPARPYPELISRPSPPTMRWFLPDLPPSRS AVEIAPTQVTETDECRLNQNICGHGECVPGPPDYSCHC NPGYRSHPQHRYCVDVNECEAEPCGPGRGICMNTGG SYNCHCNRGYRLHVGAGGRSCVDLNECAKPHLCGDG GFCINFPGHYKCNCYPGYRLKASRPPVCEDIDECRDPS SCPDGKCENKPGSFKCIACQPGYRSQGGGACRDVNE CAEGSPCSPGWCENLPGSFRCTCAQGYAPAPDGRSC LDVDECEAGDVCDNGICSNTPGSFQCQCLSGYHLSRD RSHCEDIDECDFPAACIGGDCINTNGSYRCLCPQGHRL VGGRKCQDIDECSQDPSLCLPHGACKNLQGSYVCVCD EGFTPTQDQHGCEEVEQPHHKKECYLNFDDTVFCDSV LATNVTQQECCCSLGAGWGDHCEIYPCPVYSSAEFHS LCPDGKGYTQDNNIVNYGIPAHRDIDECMLFGSEICKE GKCVNTQPGYECYCKQGFYYDGNLLECVDVDECLDES NCRNGVCENTRGGYRCACTPPAEYSPAQRQCLSPEE MDVDECQDPAACRPGRCVNLPGSYRCECRPPWVPGP SGRDCQLPESPAERAPERRDVCWSQRGEDGMCAGPL AGPALTFDDCCCRQGRGWGAQCRPCPPRGAGSHCP TSQSESNSFWDTSPLLLGKPPRDEDSSEEDSDECRCV SGRCVPRPGGAVCECPGGFQLDASRARCVDIDECREL NQRGLLCKSERCVNTSGSFRCVCKAGFARSRPHGACV PQRRR LTBP3 CYNO GPAGERGAGGGGALARERFKVVFAPVICKRTCLKGQC 36 RDSCQQGSNMTLIGENGHSTDTLTGSGFRVVVCPLPC MNGGQCSSRNQCLCPPDFTGRFCQVPAGGAGGGTG GSGPGLSRAGALSTGALPPLAPEGDSVASKHAIYAVQV IADPPGPGEGPPAQHAAFLVPLGPGQISAEVQAPPPVV NVRVHHPPEASVQVHRIESSNAEGAAPSQHLLPHPKPS HPRPPTQKPLGRCFQDTLPKQPCGSNPLPGLTKQEDC CGSIGTAWGQSKCHKCPQLQYTGVQKPGPVRGEVGA DCPQGYKRLNSTHCQDINECAMPGVCRHGDCLNNPG SYRCVCPPGHSLGPSRTQCIADKPEEKSLCFRLVSPEH QCQHPLTTRLTRQLCCCSVGKAWGARCQRCPADGTA AFKEICPAGKGYHILTSHQTLTIQGESDFSLFLHPDGPP KPQQLPESPSQAPPPEDTEEERGVTTDSPVSEERSVQ QSHPTATTSPARPYPELISRPSPPTMRWFLPDLPPSRS AVEIAPTQVTETDECRLNQNICGHGECVPGPPDYSCHC NPGYRSHPQHRYCVDVNECEAEPCGPGRGICMNTGG SYNCHCNRGYRLHVGAGGRSCVDLNECAKPHLCGDG GFCINFPGHYKCNCYPGYRLKASRPPVCEDIDECRDPS SCPDGKCENKPGSFKCIACQPGYRSQGGGACRDVNE CAEGSPCSPGWCENLPGSFRCTCAQGYAPAPDGRSC VDVDECEAGDVCDNGICTNTPGSFQCQCLSGYHLSRD RSHCEDIDECDFPAACIGGDCINTNGSYRCLCPQGHRL VGGRKCQDIDECTQDPGLCLPHGACKNLQGSYVCVCD EGFTPTQDQHGCEEVEQPHHKKECYLNFDDTVFCDSV LATNVTQQECCCSLGAGWGDHCEIYPCPVYSSAEFHS LCPDGKGYTQDNNIVNYGIPAHRDIDECMLFGAEICKE GKCVNTQPGYECYCKQGFYYDGNLLECVDVDECLDES NCRNGVCENTRGGYRCACTPPAEYSPAQRQCLSPEE MDVDECQDPAACRPGRCVNLPGSYRCECRPPWVPGP SGRDCQLPESPAERAPERRDVCWSQRGEDGMCAGP QAGPALTFDDCCCRQGRGWGAQCRPCPPRGAGSQC PTSQSESNSFWDTSPLLLGKPRRDEDSSEEDSDECRC VSGRCVPRPGGAVCECPGGFQLDASRARCVDIDECRE LNQRGLLCKSERCVNTSGSFRCVCKAGFARSRPHGAC VPQRRR LTBP3 Mouse GPAGERGTGGGGALARERFKVVFAPVICKRTCLKGQC 37 RDSCQQGSNMTLIGENGHSTDTLTGSAFRVVVCPLPC MNGGQCSSRNQCLCPPDFTGRFCQVPAAGTGAGTGS SGPGLARTGAMSTGPLPPLAPEGESVASKHAIYAVQVI ADPPGPGEGPPAQHAAFLVPLGPGQISAEVQAPPPVV NVRVHHPPEASVQVHRIEGPNAEGPASSQHLLPHPKP PHPRPPTQKPLGRCFQDTLPKQPCGSNPLPGLTKQED CCGSIGTAWGQSKCHKCPQLQYTGVQKPVPVRGEVG ADCPQGYKRLNSTHCQDINECAMPGNVCHGDCLNNP GSYRCVCPPGHSLGPLAAQCIADKPEEKSLCFRLVSTE HQCQHPLTTRLTRQLCCCSVGKAWGARCQRCPADGT AAFKEICPGKGYHILTSHQTLTIQGESDFSLFLHPDGPP KPQQLPESPSRAPPLEDTEEERGVTMDPPVSEERSVQ QSHPTTTTSPPRPYPELISRPSPPTFHRFLPDLPPSRSA VEIAPTQVTETDECRLNQNICGHGQCVPGPSDYSCHC NAGYRSHPQHRYCVDVNECEAEPCGPGKGICMNTGG SYNCHCNRGYRLHVGAGGRSCVDLNECAKPHLCGDG GFCINFPGHYKCNCYPGYRLKASRPPICEDIDECRDPS TCPDGKCENKPGSFKCIACQPGYRSQGGGACRDVNE CSEGTPCSPGWCENLPGSYRCTCAQYEPAQDGLSCID VDECEAGKVCQDGICTNTPGSFQCQCLSGYHLSRDRS RCEDIDECDFPAACIGGDCINTNGSYRCLCPLGHRLVG GRKCKKDIDECSQDPGLCLPHACENLQGSYVCVCDEG FTLTQDQHGCEEVEQPHHKKECYLNFDDTVFCDSVLA TNVTQQECCCSLGAGWGDHCEIYPCPVYSSAEFHSLV PDGKRLHSGQQHCELCIPAHRDIDECILFGAEICKEGKC VNTQPGYECYCKQGFYYDGNLLECVDVDECLDESNCR NGVCENTRGGYRCACTPPAEYSPAQAQCLIPERWSTP QRDVKCAGASEERTACVWGPWAGPALTFDDCCCRQP RLGTQCRPCPPRGTGSQCPTSQSESNSFWDTSPLLLG KSPRDEDSSEEDSDECRCVSGRCVPRPGGAVCECPG GFQLDASRARCVDIDECRELNQRGLLCKSERCVNTSG SFRCVCKAGFTRSRPHGPACLSAAADDAAIAHTSVIDH RGYFH

    [0258] In an exemplary embodiment, inhibitors, e.g., antibodies, and antigen-binding fragments thereof, that selectively bind LTBP1-TGF?11 and/or LTBP3-TGF?11 with at least 50-fold, preferably 100-fold affinities, as compared to a complex containing TGF?1 and CARP or LRRC33.

    TABLE-US-00006 TABLE4B ExemplaryGARPandLRRC33aminoacidsequences SEQ ID Protein Sequence NO GARP AQHQDKVPCKMVDKKVSCQVLGLLQVPSVLPPDTETLDLSGNQ 38 LRSILASPLGFYTALRHLDLSTNEISFLQPGAFQALTHLEHLSLAH NRLAMATALSAGGLGPLPRVTSLDLSGNSLYSGLLERLLGEAPS LHTLSLAENSLTRLTRHTFRDMPALEQLDLHSNVLMDIEDGAFE GLPRLTHLNLSRNSLTCISDFSLQQLRVLDLSCNSIEAFQTASQP QAEFQLTWLDLRENKLLHFPDLAALPRLIYLNLSNNLIRLPTGPP QDSKGIHAPSEGWSALPLSAPSGNASGRPLSQLLNLDLSYNEIE LIPDSFLEHLTSLCFLNLSRNCLRTFEARRLGSLPCLMLLDLSHN ALETLELGARALGSLRTLLLQGNALRDLPPYTFANLASLQRLNLQ GNRVSPCGGPDEPGPSGCVAFSGITSLRSLSLVDNEIELLRAGA FLHTPLTELDLSSNPGLEVATGALGGLEASLEVLALQGNGLMVL QVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLL PGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVD ATQDLICRFSSQEEVSLSHVRPEDCEKGGLKNINLIIILTFILVSAIL LTTLAACCCVRRQKFNQQYKA SGARP AQHQDKVPCKMVDKKVSCQVLGLLQVPSVLPPDTETLDLSGNQ 39 LRSILASPLGFYTALRHLDLSTNEISFLQPGAFQALTHLEHLSLAH NRLAMATALSAGGLGPLPRVTSLDLSGNSLYSGLLERLLGEAPS LHTLSLAENSLTRLTRHTFRDMPALEQLDLHSNVLMDIEDGAFE GLPRLTHLNLSRNSLTCISDFSLQQLRVLDLSCNSIEAFQTASQP QAEFQLTWLDLRENKLLHFPDLAALPRLIYLNLSNNLIRLPTGPP QDSKGIHAPSEGWSALPLSAPSGNASGRPLSQLLNLDLSYNEIE LIPDSFLEHLTSLCFLNLSRNCLRTFEARRLGSLPCLMLLDLSHN ALETLELGARALGSLRTLLLQGNALRDLPPYTFANLASLQRLNLQ GNRVSPCGGPDEPGPSGCVAFSGITSLRSLSLVDNEIELLRAGA FLHTPLTELDLSSNPGLEVATGALGGLEASLEVLALQGNGLMVL QVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLL PGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVD ATQDLICRFSSQEEVSLSHVRPEDCEKGGLKNIN GARP ISQRREQVPCRTVNKEALCHGLGLLQVPSVLSLDIQALYLSGNQ 40 mouse LQSILVSPLGFYTALRHLDLSDNQISFLQAGVFQALPYLEHLNLA HNRLATGMALNSGGLGRLPLLVSLDLSGNSLHGNLVERLLGETP RLRTLSLAENSLTRLARHTFWGMPAVEQLDLHSNVLMDIEDGAF EALPHLTHLNLSRNSLTCISDFSLQQLQVLDLSCNSIEAFQTAPE PQAQFQLAWLDLRENKLLHFPDLAVFPRLIYLNVSNNLIQLPAGL PRGSEDLHAPSEGWSASPLSNPSRNASTHPLSQLLNLDLSYNEI ELVPASFLEHLTSLRFLNLSRNCLRSFEARQVDSLPCLVLLDLSH NVLEALELGTKVLGSLQTLLLQDNALQELPPYTFASLASLQRLNL QGNQVSPCGGPAEPGPPGCVDFSGIPTLHVLNMAGNSMGMLR AGSFLHTPLTELDLSTNPGLDVATGALVGLEASLEVLELQGNGLT VLRVDLPCFLRLKRLNLAENQLSHLPAWTRAVSLEVLDLRNNSF SLLPGNAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRV DVDATQDLICRFGSQEELSLSLVRPEDCEKGGLKNVNLILLLSFT LVSAIVLTTLATICFLRRQKLSQQYKA SGARP ISQRREQVPCRTVNKEALCHGLGLLQVPSVLSLDIQALYLSGNQ 41 mouse LQSILVSPLGFYTALRHLDLSDNQISFLQAGVFQALPYLEHLNLA HNRLATGMALNSGGLGRLPLLVSLDLSGNSLHGNLVERLLGETP RLRTLSLAENSLTRLARHTFWGMPAVEQLDLHSNVLMDIEDGAF EALPHLTHLNLSRNSLTCISDFSLQQLQVLDLSCNSIEAFQTAPE PQAQFQLAWLDLRENKLLHFPDLAVFPRLIYLNVSNNLIQLPAGL PRGSEDLHAPSEGWSASPLSNPSRNASTHPLSQLLNLDLSYNEI ELVPASFLEHLTSLRFLNLSRNCLRSFEARQVDSLPCLVLLDLSH NVLEALELGTKVLGSLQTLLLQDNALQELPPYTFASLASLQRLNL QGNQVSPCGGPAEPGPPGCVDFSGIPTLHVLNMAGNSMGMLR AGSFLHTPLTELDLSTNPGLDVATGALVGLEASLEVLELQGNGLT VLRVDLPCFLRLKRLNLAENQLSHLPAWTRAVSLEVLDLRNNSF SLLPGNAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRV DVDATQDLICRFGSQEELSLSLVRPEDCEKGGLKNVN LRRC33 MELLPLWLCLGFHFLTVGWRNRSGTATAASQGVCKLVGGAAD 42 (alsoknown CRGQSLASVPSSLPPHARMLTLDANPLKTLWNHSLQPYPLLESL asNRROS; SLHSCHLERISRGAFQEQGHLRSLVLGDNCLSENYEETAAALHA Uniprot LPGLRRLDLSGNALTEDMAALMLQNLSSLRSVSLAGNTIMRLDD Accession SVFEGLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAFNNLPCI No.Q86YC3) VDFGLTRLRVLNVSYNVLEWFLATGGEAAFELETLDLSHNQLLF FPLLPQYSKLRTLLLRDNNMGFYRDLYNTSSPREMVAQFLLVDG NVTNITTVSLWEEFSSSDLADLRFLDMSQNQFQYLPDGFLRKMP SLSHLNLHQNCLMTLHIREHEPPGALTELDLSHNQLSELHLAPGL ASCLGSLRLFNLSSNQLLGVPPGLFANARNITTLDMSHNQISLCP LPAASDRVGPPSCVDFRNMASLRSLSLEGCGLGALPDCPFQGT SLTYLDLSSNWGVLNGSLAPLQDVAPMLQVLSLRNMGLHSSFM ALDFSGFGNLRDLDLSGNCLTTFPRFGGSLALETLDLRRNSLTA LPQKAVSEQLSRGLRTIYLSQNPYDCCGVDGWGALQHGQTVAD WAMVTCNLSSKIIRVTELPGGVPRDCKWERLDLGLLYLVLILPSC LTLLVACTVIVLTFKKPLLQVIKSRCHWSSVY *Nativesignalpeptideisdepictedinboldfont. soluble MDMRVPAQLLGLLLLWFSGVLGWRNRSGTATAASQGVCKLVG 43 LRRC33 GAADCRGQSLASVPSSLPPHARMLTLDANPLKTLWNHSLQPYP (sLRRC33) LLESLSLHSCHLERISRGAFQEQGHLRSLVLGDNCLSENYEETA AALHALPGLRRLDLSGNALTEDMAALMLQNLSSLRSVSLAGNTI MRLDDSVFEGLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAF NNLPCIVDFGLTRLRVLNVSYNVLEWFLATGGEAAFELETLDLSH NQLLFFPLLPQYSKLRTLLLRDNNMGFYRDLYNTSSPREMVAQF LLVDGNVTNITTVSLWEEFSSSDLADLRFLDMSQNQFQYLPDGF LRKMPSLSHLNLHQNCLMTLHIREHEPPGALTELDLSHNQLSEL HLAPGLASCLGSLRLFNLSSNQLLGVPPGLFANARNITTLDMSH NQISLCPLPAASDRVGPPSCVDFRNMASLRSLSLEGCGLGALPD CPFQGTSLTYLDLSSNWGVLNGSLAPLQDVAPMLQVLSLRNMG LHSSFMALDFSGFGNLRDLDLSGNCLTTFPRFGGSLALETLDLR RNSLTALPQKAVSEQLSRGLRTIYLSQNPYDCCGVDGWGALQH GQTVADWAMVTCNLSSKIIRVTELPGGVPRDCKWERLDLGLHH HHHH *Modifiedhumankappalightchainsignalpeptide isdepictedinboldfont. **Histidinetagisunderlined. HumanLRRC33- MDMRVPAQLLGLLLLWFSGVLGWRNRSGTATAASQGVCKLVG 44 GARPchimera GAADCRGQSLASVPSSLPPHARMLTLDANPLKTLWNHSLQPYP LLESLSLHSCHLERISRGAFQEQGHLRSLVLGDNCLSENYEETA AALHALPGLRRLDLSGNALTEDMAALMLQNLSSLRSVSLAGNTI MRLDDSVFEGLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAF NNLPCIVDFGLTRLRVLNVSYNVLEWFLATGGEAAFELETLDLSH NQLLFFPLLPQYSKLRTLLLRDNNMGFYRDLYNTSSPREMVAQF LLVDGNVTNITTVSLWEEFSSSDLADLRFLDMSQNQFQYLPDGF LRKMPSLSHLNLHQNCLMTLHIREHEPPGALTELDLSHNQLSEL HLAPGLASCLGSLRLFNLSSNQLLGVPPGLFANARNITTLDMSH NQISLCPLPAASDRVGPPSCVDFRNMASLRSLSLEGCGLGALPD CPFQGTSLTYLDLSSNWGVLNGSLAPLQDVAPMLQVLSLRNMG LHSSFMALDFSGFGNLRDLDLSGNCLTTFPRFGGSLALETLDLR RNSLTALPQKAVSEQLSRGLRTIYLSQNPYDCCGVDGWGALQH GQTVADWAMVTCNLSSKIIRVTELPGGVPRDCKWERLDLGLLIII LTFILVSAILLTTLAACCCVRRQKFNQQYKA *Modifiedhumankappalightchainsignalpeptide isdepictedinboldfont. **LRRC33ectodomainisunderlined. #GARPtransmembranedomainisitalicized. ##GARPintracellulartailisdoubleunderlined.

    [0259] In another aspect, the disclosure provides methods of inhibiting TGF?1 activation in the context of LTBP1 and/or LTBP3. In one embodiment, the method comprises exposing a LTBP1-proTGF?1 complex or a LTBP3-proTGF?1 complex an inhibitor, an antibody or antigen-binding fragment thereof, and/or a pharmaceutical composition described herein. For example, in one embodiment, the inhibitor is an inhibitor of extracellular matrix-associated TGF?1 activation, which selectively binds a LTBP1/3-presented proTGF?1 latent complex. In one embodiment, the inhibitor does not significantly inhibit immune cell-associated TGF?1 activation, for example, immune cell-associated TGF?1 activation that results from activation of a GARP-presented proTGF?1 latent complex. In another embodiment, the antibody, or antigen-binding portion thereof, selectively binds an LTBP1-proTGF?1 latent complex and/or an LTBP3-proTGF?1 latent complex, thereby modulating release of mature TGF?1 growth factor from the latent complex, wherein the antibody, or antigen-binding portion thereof, does not bind mature TGF?1 alone or a GARP-proTGF?1 latent complex. In one embodiment, the antibody, or antigen-binding portion thereof, inhibits the release of mature TGF?1 from the LTBP1-proTGF?1 complex and/or the LTBP3-proTGF?1 complex. In one embodiment, the antibody, or antigen-binding portion thereof, does not inhibit the release of mature TGF?1 from a GARP-proTGF?1 complex or a LRRC33-proTGF?1 complex.

    [0260] In one embodiment, the method is performed in vitro. In another embodiment, the method is performed in vivo. In one embodiment, the LTBP1-proTGF?1 complex or the LTBP3-proTGF?1 complex is in an extracellular matrix. The extracellular matrix can comprise, for example, fibrillin and/or fibronectin. In some embodiments, the extracellular matrix comprises a protein comprising an RGD motif.

    [0261] In some embodiments of the foregoing aspects, the antibody, or antigen-binding fragment thereof, does not stimulate immune effector cells. In one embodiment, the antibody, or antigen-binding fragment thereof, inhibits the release of mature TGF?1 from a LTBP1-proTGF?1 complex and/or a LTBP3-proTGF?1 complex, and does not inhibit the release of mature TGF?1 from a GARP-proTGF?1 complex and/or an LRRC33-proTGF?1 complex.

    [0262] In some embodiments, inhibitors, e.g., antibodies (and fragment thereof) of the present disclosure that selectively bind to a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex can bind the complex with relatively high affinity, e.g., with a dissociation constant (K.sub.D) less than 10.sub.?8 M, 10.sub.?9 M, 10.sub.?10 M, 10.sub.?11 M or lower. In one embodiment, an antibody, or an antigen binding fragment thereof, binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex with a dissociation constant (K.sub.D) of about 10-8 M, about 10-9 M, about 10-10 M, about 10-11 M, about 10-12 M, or about 10-13 M. For example, antibodies that selectively bind to a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex can bind the complex with an affinity between 5 ?M and 10 nM, e.g., between 50 ?M and 20 nM, e.g., between 100 ?M and 10 nM. In one embodiment, the antibody, or antigen-binding fragment thereof, can bind a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex with an affinity of about 20 nm to about 500 nm. For example, the antibody, or antigen-binding fragment thereof, can bind a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex with an affinity of about 0.1 nM to about 10 nM.

    [0263] The disclosure also includes antibodies or antigen binding fragments that compete with any of the antibodies described herein for binding to a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex. In some embodiments, such antibodies have an affinity for the complex of 50 nM or lower (e.g., 20 nM or lower, 10 nM or lower, 500 ?M or lower, 50 ?M or lower, or 5 ?M or lower). The affinity and binding kinetics of antibodies (or antigen binding fragments thereof) that selectively bind to a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex can be tested using any suitable method, including but not limited to biosensor technology (e.g., OCTET? or BIACORE?)

    [0264] In one embodiment, the antibodies, or antigen-binding fragments thereof, of the present disclosure do not compete with antibody SR-Ab42 for binding to a human LTBP1-proTGF?1 complex.

    [0265] Aspects of the disclosure relate to antibodies that compete or cross-compete with any of the antibodies provided herein. The term compete, as used herein with regard to an antibody, means that a first antibody binds to an epitope (e.g., an epitope of a LTBP1-TGF?1 complex and/or an epitope of a LTBP3-TGF?1 complex) in a manner sufficiently similar to the binding of a second antibody, such that the result of binding of the first antibody with its epitope is detectably decreased in the presence of the second antibody compared to the binding of the first antibody in the absence of the second antibody. The alternative, where the binding of the second antibody to its epitope is also detectably decreased in the presence of the first antibody, can, but need not be the case. That is, a first antibody can inhibit the binding of a second antibody to its epitope without that second antibody inhibiting the binding of the first antibody to its respective epitope. However, where each antibody detectably inhibits the binding of the other antibody with its epitope or ligand, whether to the same, greater, or lesser extent, the antibodies are said to cross-compete with each other for binding of their respective epitope(s). Both competing and cross-competing antibodies are within the scope of this disclosure. Regardless of the mechanism by which such competition or cross-competition occurs (e.g., steric hindrance, conformational change, or binding to a common epitope, or portion thereof), the skilled artisan would appreciate that such competing and/or cross-competing antibodies are encompassed and can be useful for the methods and/or compositions provided herein.

    [0266] Aspects of the disclosure relate to antibodies that compete or cross-compete with any of the specific antibodies, or antigen binding fragment thereof, as provided herein, e.g., an antibody having one or more CDR sequences (1, 2, 3, 4, 5, or 6 CDR sequences) set forth in Table 5. In one embodiment, the disclosure provides antibodies, and antigen-binding fragments thereof, that compete or cross-compete with an antibody having heavy chain CDR sequences comprising SEQ ID NO:1, SEQ ID NO:2, and SEQ ID NO:3 as set forth in Table 5, and/or light chain CDR sequences comprising SEQ ID NO:4, SEQ ID NO:5, and SEQ ID NO:6 as set forth in Table 5. In one embodiment, the disclosure provides antibodies that compete or cross-compete with an antibody, or antigen binding portion thereof, having a heavy chain variable region sequence comprising SEQ ID NO:7, and/or a light chain variable region sequence comprising SEQ ID NO:8. In some embodiments, an antibody, or antigen binding portion thereof, binds at or near the same epitope as any of the antibodies provided herein. In some embodiments, an antibody, or antigen binding portion thereof, binds near an epitope if it binds within 15 or fewer amino acid residues of the epitope. In some embodiments, any of the antibody, or antigen binding portion thereof, as provided herein, binds within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acid residues of an epitope that is bound by any of the antibodies provided herein.

    [0267] In another embodiment, provided herein is an antibody, or antigen binding fragment thereof, competes or cross-competes for binding to any of the antigens provided herein (e.g., a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex) with an equilibrium dissociation constant, K.sub.D, between the antibody and the protein of less than 10-8 M. In other embodiments, an antibody, or an antigen binding fragment thereof, competes or cross-competes for binding to any of the antigens provided herein with a K.sub.D in a range from 10.sup.?11 M to 10.sup.?8 M. In some embodiments, provided herein is an anti-TGF?1 antibody, or an antigen binding fragment thereof, that competes for binding with an antibody, or antigen binding fragment thereof, described herein. In some embodiments, provided herein is an anti-TGF?1 antibody, or antigen binding fragment thereof, that binds to the same epitope as an antibody, or antigen binding fragment thereof, described herein.

    [0268] The antibodies, and antigen binding fragments thereof, provided herein can be characterized using any suitable methods. For example, one method is to identify the epitope to which the antigen binds, or epitope mapping. There are many suitable methods for mapping and characterizing the location of epitopes on proteins, including solving the crystal structure of an antibody-antigen complex, competition assays, gene fragment expression assays, and synthetic peptide-based assays, as described, for example, in Chapter 11 of Harlow and Lane, Using Antibodies, a Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1999. In an additional example, epitope mapping can be used to determine the sequence to which an antibody binds. The epitope can be a linear epitope, i.e., contained in a single stretch of amino acids, or a conformational epitope formed by a three-dimensional interaction of amino acids that may not necessarily be contained in a single stretch (primary structure linear sequence). In some embodiments, the epitope is a TGF?1 epitope that is only available for binding by the antibody, or the antigen binding fragment thereof, described herein, when the TGF?1 is in a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex.

    [0269] In preferred embodiments, the TGF?1 inhibitor is Ab42 or a variant thereof. Alternatively, in some embodiments, the TGF?1 inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the N-terminal stretch of amino acids DMELVKRKRIEAIR (SEQ ID NO: 46) within the so-called alpha-1 helix region of the prodomain of the latent proTGF?1 complex. In some embodiments, the antibody or the fragment contacts one or more of the following residues within the prodomain: Asp27 (D); Leu30 (L); Arg33 (R); Ile36 (I); Glu37 (E) (shown in bold above). Additionally or alternatively, in some embodiments, the inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the amino acid sequence YIDFRKDLGWK (SEQ ID NO: 93) within the TGF?1 growth factor domain (e.g., the finger-1 domain). In some embodiments, the antibody or fragment thereof contacts one or more of the following residues: Tyr289 (Y); Lys294 (K); Asp295 (D) (shown in bold above). In some embodiments, such antibody binds a conformational epitope comprising one or more residues of DMELVKRKRIEAIR (SEQ ID NO: 46) and one or more residues of YIDFRKDLGWK (SEQ ID NO: 93), wherein the antibody is not Ab42.

    [0270] In some embodiments, the antibodies, or antigen binding fragment thereof, of the present disclosure that selectively bind to a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex include one or more of complementary determining regions (CDRs) shown in Table 5. In some embodiments, the disclosure provides a nucleic acid molecule that encodes an antibody, or antigen binding portion thereof, that selectively binds to a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex, as described herein. In one embodiment, the nucleic acid molecules encode one or more of the CDR sequences shown in Table 5.

    TABLE-US-00007 TABLE5 Complementarydeterminingregionsoftheheavychain(CDRHs)andthelightchain (CDRLs)ofAb42 H-CDR1 H-CDR2 H-CDR3 L-CDR1 L-CDR2 L-CDR3 FTFRSYVMH VISHEGSLK ARPRIAA TRSSGNIDNNYVQ EDNQRPS QSYDYDTQGVV (SEQID YYADSVKG RRGGFGY (SEQIDNO:4) (SEQID (SEQIDNO: NO:1) (SEQID (SEQID NO:5) 6) NO:2) NO:3)

    [0271] In some embodiments, antibodies of the present disclosure that selectively bind to a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex include any antibody, or antigen binding portion thereof, comprising a CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, or CDRL3, or combinations thereof, as provided in Table 5. In some embodiments, antibodies that selectively bind to a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex include CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 as provided in Table 5.

    [0272] The present disclosure also provides a nucleic acid sequence that encodes a molecule comprising CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, or CDRL3, or combinations thereof, as provided in Table 5.

    [0273] Antibody heavy and light chain CDR3 domains may play a particularly important role in the binding specificity/affinity of an antibody for an antigen. Accordingly, in some embodiments, the antibodies, or antigen binding fragment thereof, that selectively bind to a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex, or the nucleic acid molecules that encode these antibodies, or antigen binding fragment thereof, can include at least the heavy and/or light chain CDR3 of the antibody shown in Table 5.

    [0274] Aspects of the disclosure relate to a monoclonal antibody, or antigen binding portion thereof, that binds selectively to a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex, and that comprises six complementarity determining regions (CDRs): CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3.

    [0275] In some embodiments (e.g., as for Ab42, shown in Table 5), the antibody, or antigen binding portion thereof, that selectively binds to a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex comprises: a CDRH1 comprising an amino acid sequence as set forth in SEQ ID NO: 1, a CDRH2 comprising an amino acid sequence as set forth in SEQ ID NO: 2, a CDRH3 comprising an amino acid sequence as set forth in SEQ ID NO: 3, a CDRL1 comprising an amino acid sequence as set forth in SEQ ID NO: 4, a CDRL2 comprising an amino acid sequence as set forth in SEQ ID NO: 5, and a CDRL3 comprising an amino acid sequence as set forth in SEQ ID NO: 6.

    [0276] According to some embodiments, the antibody, or the antigen binding fragment thereof, comprises a CDRH1 sequence comprising FTFRSYVMH (SEQ ID NO: 1); a CDRH2 sequence comprising VISHEGSLKYYADSVKG (SEQ ID NO: 2); a CDRH3 sequence comprising ARPRIAARRGGFGY (SEQ ID NO:3); a CDRL1 sequence comprising TRSSGNIDNNYVQ (SEQ ID NO: 4); a CDRL2 sequence comprising EDNQRPS (SEQ ID NO: 5) and a CDRL3 sequence comprising QSYDYDTQGVV (SEQ ID NO: 6). According to some embodiments, the antibody, or the antigen-binding fragment thereof comprises a CDRH1 sequence comprising an amino acid sequence at least 85% identical to FTFRSYVMH (SEQ ID NO: 1); a CDRH2 sequence comprising an amino acid sequence at least 85% identical to VISHEGSLKYYADSVKG (SEQ ID NO: 2); a CDRH3 sequence comprising an amino acid sequence at least 85% identical to ARPRIAARRGGFGY (SEQ ID NO: 3); a CDRL1 sequence comprising an amino acid sequence at least 85% identical to TRSSGNIDNNYVQ (SEQ ID NO: 4); a CDRL2 sequence comprising an amino acid sequence at least 85% identical to EDNQRPS (SEQ ID NO: 5) and a CDRL3 sequence comprising an amino acid sequence at least 85% identical to QSYDYDTQGVV (SEQ ID NO: 6). According to some embodiments, the antibody, or the antigen-binding fragment thereof comprises a CDRH1 sequence comprising an amino acid sequence at least 90% identical to FTFRSYVMH (SEQ ID NO: 1); a CDRH2 sequence comprising an amino acid sequence at least 90% identical to VISHEGSLKYYADSVKG (SEQ ID NO: 2); a CDRH3 sequence comprising an amino acid sequence at least 90% identical to ARPRIAARRGGFGY (SEQ ID NO: 3); a CDRL1 sequence comprising an amino acid sequence at least 90% identical to TRSSGNIDNNYVQ (SEQ ID NO: 4); a CDRL2 sequence comprising an amino acid sequence at least 90% identical to EDNQRPS (SEQ ID NO: 5) and a CDRL3 sequence comprising an amino acid sequence at least 90% identical to QSYDYDTQGVV (SEQ ID NO: 6).

    [0277] According to some embodiments, the antibody, or the antigen-binding fragment thereof comprises a CDRH1 sequence comprising an amino acid sequence at least 95% identical to FTFRSYVMH (SEQ ID NO: 1); a CDRH2 sequence comprising an amino acid sequence at least 95% identical to VISHEGSLKYYADSVKG (SEQ ID NO: 2); a CDRH3 sequence comprising an amino acid sequence at least 95% identical to ARPRIAARRGGFGY (SEQ ID NO: 3); a CDRL1 sequence comprising an amino acid sequence at least 95% identical to TRSSGNIDNNYVQ (SEQ ID NO: 4); a CDRL2 sequence comprising an amino acid sequence at least 95% identical to EDNQRPS (SEQ ID NO: 5) and a CDRL3 sequence comprising an amino acid sequence at least 95% identical to QSYDYDTQGVV (SEQ ID NO: 6). According to some embodiments, the antibody, or the antigen-binding fragment thereof comprises a CDRH1 sequence comprising an amino acid sequence at least 97% identical to FTFRSYVMH (SEQ ID NO: 1); a CDRH2 sequence comprising an amino acid sequence at least 97% identical to VISHEGSLKYYADSVKG (SEQ ID NO: 2); a CDRH3 sequence comprising an amino acid sequence at least 97% identical to ARPRIAARRGGFGY (SEQ ID NO: 3); a CDRL1 sequence comprising an amino acid sequence at least 97% identical to TRSSGNIDNNYVQ (SEQ ID NO: 4); a CDRL2 sequence comprising an amino acid sequence at least 97% identical to EDNQRPS (SEQ ID NO: 5) and a CDRL3 sequence comprising an amino acid sequence at least 97% identical to QSYDYDTQGVV (SEQ ID NO: 6).

    [0278] According to some embodiments, the antibody, or the antigen-binding fragment thereof comprises a CDRH1 sequence comprising an amino acid sequence at least 98% identical to FTFRSYVMH (SEQ ID NO: 1); a CDRH2 sequence comprising an amino acid sequence at least 98% identical to VISHEGSLKYYADSVKG (SEQ ID NO: 2); a CDRH3 sequence comprising an amino acid sequence at least 98% identical to ARPRIAARRGGFGY (SEQ ID NO: 3); a CDRL1 sequence comprising an amino acid sequence at least 98% identical to TRSSGNIDNNYVQ (SEQ ID NO: 4); a CDRL2 sequence comprising an amino acid sequence at least 98% identical to EDNQRPS (SEQ ID NO: 5) and a CDRL3 sequence comprising an amino acid sequence at least 98% identical to QSYDYDTQGVV (SEQ ID NO: 6). According to some embodiments, the antibody, or the antigen-binding fragment thereof comprises a CDRH1 sequence comprising an amino acid sequence at least 99% identical to FTFRSYVMH (SEQ ID NO: 1); a CDRH2 sequence comprising an amino acid sequence at least 99% identical to VISHEGSLKYYADSVKG (SEQ ID NO: 2); a CDRH3 sequence comprising an amino acid sequence at least 99% identical to ARPRIAARRGGFGY (SEQ ID NO: 3); a CDRL1 sequence comprising an amino acid sequence at least 99% identical to TRSSGNIDNNYVQ (SEQ ID NO: 4); a CDRL2 sequence comprising an amino acid sequence at least 99% identical to EDNQRPS (SEQ ID NO: 5) and a CDRL3 sequence comprising an amino acid sequence at least 99% identical to QSYDYDTQGVV (SEQ ID NO: 6). According to some embodiments, the antibody, or the antigen binding fragment thereof, comprises a CDRH1 sequence consisting of FTFRSYVMH (SEQ ID NO: 1); a CDRH2 sequence consisting of VISHEGSLKYYADSVKG (SEQ ID NO: 2); a CDRH3 sequence consisting of ARPRIAARRGGFGY (SEQ ID NO:3); a CDRL1 sequence consisting of TRSSGNIDNNYVQ (SEQ ID NO: 4); a CDRL2 sequence consisting of EDNQRPS (SEQ ID NO: 5) and a CDRL3 sequence consisting of QSYDYDTQGVV (SEQ ID NO: 6).

    [0279] Optionally, one or more of the six CDRs may include one or more (e.g., 1 or 2) amino acid change(s).

    [0280] The amino acid sequences of the heavy chain variable region (HCVR) and the light chain variable region (LCVR) of the antibody AB42 set forth in Table 5 are provided below as SEQ ID NOs 7 and 8, respectively. In some embodiments, the antibody or an antigen-binding fragment thereof comprises a heavy chain variable domain (VH) and a light chain variable domain (VL), wherein, the VH comprises an amino acid sequence having at least 90% (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% and 100%) sequence identity to:

    TABLE-US-00008 (SEQIDNO:7) QVQLVESGGGVVQPGRSLRLSCAASGFTFRSYVMHWVRQAPGKGLEWVA VISHEGSLKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR PRIAARRGGFGYWGQGTLVTVSS
    and wherein the VL comprises an amino acid sequence having at least 90% (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% and 100%) sequence identity to:

    TABLE-US-00009 (SEQIDNO:8) NFMLTQPHSVSESPGKTVTISCTRSSGNIDNNYVQWYQQRPGSSPTTVI YEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDYDT QGVVFGGGTKLTVL

    [0281] In one embodiment, the antibody, or the antigen-binding fragment thereof, comprises a heavy chain variable region comprising CDR-H1: SEQ ID NO: 1; CDR-H2: SEQ ID NO: 2; and CDR-H3: SEQ ID NO: 3; and a light chain variable region comprising CDR-L1: SEQ ID NO: 4; CDR-L2: SEQ ID NO: 5; and CDR-L3: SEQ ID NO: 6, optionally comprising up to 3 amino acid changes, for example 1, 2 or 3 amino acid changes, for each of the CDRs.

    [0282] In any of the antibodies or antigen-binding fragments described herein, one or more conservative mutations can be introduced into the CDRs or framework sequences at positions where the residues are not likely to be involved in an antibody-antigen interaction. In some embodiments, such conservative mutation(s) can be introduced into the CDRs or framework sequences at position(s) where the residues are not likely to be involved in interacting with a LTBP1-TGF? complex and/or a LTBP3-TGF? complex, as determined based on the crystal structure. In some embodiments, the likely interface (e.g., residues involved in an antigen-antibody interaction) may be deduced from known structural information on another antigens sharing structural similarities.

    [0283] As used herein, a conservative amino acid substitution refers to an amino acid substitution that does not alter the relative charge or size characteristics of the protein in which the amino acid substitution is made. Variants can be prepared according to methods for altering polypeptide sequence known to one of ordinary skill in the art such as are found in references which compile such methods, e.g., Molecular Cloning: A Laboratory Manual, J. Sambrook, et al., eds., Second Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 1989, or Current Protocols in Molecular Biology, F. M. Ausubel, et al., eds., John Wiley & Sons, Inc., New York. Conservative substitutions of amino acids include substitutions made amongst amino acids within the following groups: (a) M, I, L, V; (b) F, Y, W; (c) K, R, H; (d) A, G; (e) S, T; (f) Q, N; and (g) E, D.

    [0284] In some embodiments, the antibodies provided herein comprise mutations that confer desirable properties to the antibodies. For example, to avoid potential complications due to Fab-arm exchange, which is known to occur with native IgG4 mAbs, the antibodies provided herein may comprise a stabilizing Adair mutation (Angal et al., A single amino acid substitution abolishes the heterogeneity of chimeric mouse/human (IgG4) antibody, Mol Immunol 30, 105-108; 1993), where serine 228 (EU numbering; residue 241 Kabat numbering) is converted to proline resulting in an IgGI-like (CPPCP (SEQ ID NO: 45)) hinge sequence. Accordingly, any of the antibodies may include a stabilizing Adair mutation or the amino acid sequence CPPCP (SEQ ID NO: 45). In one embodiment, an antibody described herein comprises a heavy chain immunoglobulin constant domain of a human IgG4 having a backbone substitution of Ser to Pro, that produces an IgG1-like hinge and permits formation of inter-chain disulfide bonds.

    [0285] According to some embodiments, the antibodies provided herein comprise a M252Y/S254T/T256E (YTE) mutation. Shown below is the sequence of Ab42-YTE-hulgG4, where the CDRs are underlined using IMGT numbering (SEQ ID NO: 10) or using Kabat numbering (SEQ ID NO: 12).

    TABLE-US-00010 SequenceofAb42-YTEhuG4:IMGTCDRsunderlined.M252Y,S254T,T256E. SEQIDNO:10 QVQLVESGGGVVQPGRSLRLSCAASGFTFRSYVMHWVRQAPGKGLEWVAVISHEGSLKYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARPRIAARRGGFGYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLV KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGP PCPPCPAPEFLGGPSVFLFPPKPKDTLYITREPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNST YRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG SequenceofAb42-YTEhuG4:KabatCDRsunderlined-M252Y,S254T,T256E SEQIDNO:12 QVQLVESGGGVVQPGRSLRLSCAASGFTFRSYVMHWVRQAPGKGLEWVAVISHEGSLKYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARPRIAARRGGFGYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLV KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGP PCPPCPAPEFLGGPSVFLFPPKPKDTLYITREPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNST YRVVSVLTVLHQDWLNGKEYKCK VSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG

    [0286] Shown below is the sequence of Ab42-YTE-huLambda, where the CDRs are underlined using IMGT numbering (SEQ ID NO: 11) or using Kabat numbering (SEQ ID NO: 13).

    TABLE-US-00011 SequenceofAb42-YTEhuLambda.IMGTCDRsunderlined. SEQIDNO:11 NEMLTQPHSVSESPGKTVTISCTRSSGNIDNNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSAS LTISGLKTEDEADYYCQSYDYDTQGVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAV TVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS SequenceofAb42-YTEhuLambda SEQIDNO:13 NEMLTQPHSVSESPGKTVTISCTRSSGNIDNNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSAS LTISGLKTEDEADYYCQSYDYDTQGVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAV TVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

    [0287] Antibodies (and antigen binding fragments thereof) of this disclosure that selectively bind to a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex may optionally comprise antibody constant regions or parts thereof. For example, a VL domain may be attached at its C-terminal end to a light chain constant domain such as CK or C.

    [0288] Similarly, a VH domain or portion thereof may be attached to all or part of a heavy chain such as IgA, IgD, IgE, IgG, and IgM, and any isotype subclass. Antibodies may include suitable constant regions (see, for example, Kabat et al., Sequences of Proteins of Immunological Interest, No. 91-3242, National Institutes of Health Publications, Bethesda, Md. (1991)). Therefore, antibodies within the scope of this may disclosure include VH and VL domains, or antigen binding fragment thereof, combined with any suitable constant region. In some embodiments, the antibodies, or antigen binding fragment thereof, comprise a heavy chain immunoglobulin constant domain containing all or a portion of a human IgGi or a human IgG4 constant domain. In some embodiments, the antibody, or antigen binding portion thereof, comprises a light chain immunoglobulin constant domain containing all or a portion of a human Ig lambda constant domain or a human Ig kappa constant domain.

    [0289] In some embodiments, antibodies that selectively bind to a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex may or may not include the framework region of the antibodies of SEQ ID NOs: 7 and 8. In some embodiments, antibodies that selectively bind to a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex are murine antibodies and include murine framework region sequences. In other embodiments, the antibodies are chimeric antibodies, or antigen binding fragments thereof. In another embodiment, the antibodies are humanized antibodies, or antigen binding fragments thereof. In another embodiment, the antibodies are fully human antibodies, or antigen binding fragments thereof. In one embodiment, the antibody comprises a framework region comprising a human germline amino acid sequence.

    [0290] The antibodies, and antigen-binding fragments thereof, described herein can have any configuration suitable for binding antigen. For example, in one embodiment, the antibody, or antigen binding portion thereof, comprises four polypeptide chains, including two heavy chain variable regions and two light chain variable regions. In another embodiment, the antibody, or antigen binding portion thereof, comprises one heavy chain variable region and one light chain variable region. In exemplary embodiments, the antibody, or antigen binding portion thereof, is a Fab fragment, a F(ab)2 fragment, a scFab fragment, an scFv, or a diabody.

    [0291] In one embodiment, the antibody, or antigen-binding fragment thereof, comprises a heavy chain immunoglobulin constant domain of a human Igd constant domain or a human IgG4 constant domain.

    [0292] In an exemplary embodiment, the heavy chain immunoglobulin constant domain is a human IgG4 constant domain. In one embodiment, the antibody, or antigen-binding portion thereof, binds a conformational epitope. In one embodiment, the antibody, or antigen-binding portion thereof, binds a combinatorial epitope.

    [0293] In one embodiment, the antibody, or antigen-binding fragment thereof, comprises a heavy chain immunoglobulin constant domain of a human IgG4 constant domain having a backbone substitution of Ser to Pro that produces an Igd-like hinge and permits formation of inter-chain disulfide bonds. In one embodiment, the antibody, or antigen-binding portion thereof, further comprises a light chain immunoglobulin constant domain comprising a human Ig lambda constant domain, or a human Ig kappa constant domain.

    [0294] In one embodiment, the antibody is an IgG having four polypeptide chains which are two heavy chains and two light chains. In exemplary embodiments, the antibody can be a humanized antibody, a human antibody, or a chimeric antibody. In one embodiment, the antibody comprises a framework having a human germline amino acid sequence.

    [0295] In one embodiment, the disclosure provides an antibody, or antigen-binding fragment thereof, that competes for binding with an antibody, or antigen-binding portion thereof, described herein. In one embodiment, the disclosure provides an antibody, or antigen-binding portion thereof, that binds to the same epitope as an antibody, or antigen-binding portion thereof, described herein. In one embodiment, the antibody, or antigen-binding fragment thereof, does not compete with Ab42 for binding to a human LTBP1-proTGF?1 complex.

    Nucleic Acids

    [0296] The disclosure includes nucleic acid sequences that encode any one of the amino acid sequences provided above. In some embodiments, antibodies, antigen binding fragment thereof, and/or compositions of the present disclosure may be encoded by nucleic acid molecules. Such nucleic acid molecules include, without limitation, DNA molecules, RNA molecules, polynucleotides, oligonucleotides, mRNA molecules, vectors, plasmids and the like. In some embodiments, the present disclosure may comprise cells programmed or generated to express nucleic acid molecules encoding compounds and/or compositions of the present disclosure.

    [0297] Encompassed herein are vectors (e.g., DNA plasmids, such as mammalian expression vectors, and related nucleic acid preparations) comprising the nucleic acid sequence; cells transfected with the vector(s); a cell line with stable expression of the nucleic acids; a cell culture comprising the cell, wherein optionally the cell culture comprises mammalian cells capable of large-scale production of the antibody or a protein construct comprising an antigen-binding fragment of the antibody.

    [0298] In some cases, nucleic acids of the disclosure include codon-optimized nucleic acids. Methods of generating codon-optimized nucleic acids are known in the art and may include, but are not limited to those described in U.S. Pat. Nos. 5,786,464 and 6,114,148, the contents of each of which are herein incorporated by reference in their entirety.

    Modifications

    [0299] Non-limiting variations, modifications, and features of any of the antibodies or antigen-binding fragments thereof encompassed by the present disclosure are briefly discussed below. Embodiments of related analytical methods are also provided.

    [0300] Naturally-occurring antibody structural units typically comprise a tetramer. Each such tetramer typically is composed of two identical pairs of polypeptide chains, each pair having one full-length light (in certain embodiments, about 25 kDa) and one full-length heavy chain (in certain embodiments, about 50-70 kDa). The amino-terminal portion of each chain typically includes a variable region of about 100 to 110 or more amino acids that typically is responsible for antigen recognition. The carboxy-terminal portion of each chain typically defines a constant region that can be responsible for effector function. Human antibody light chains are typically classified as kappa and lambda light chains. Heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon, and define the isotype of the antibody. An antibody can be of any type (e.g., IgM, IgD, IgG, IgA, IgY, and IgE) and class (e.g., IgG1, IgG2, IgG3, IgG4, IgM1, IgM2, IgA1, and IgA2). Within full-length light and heavy chains, typically, the variable and constant regions are joined by a J region of about 12 or more amino acids, with the heavy chain also including a D region of about 10 more amino acids (see, e.g., Fundamental Immunology, Ch. 7 (Paul, W., ed., 2.sup.nd ed. Raven Press, N.Y. (1989)) (incorporated by reference in its entirety)). The variable regions of each light/heavy chain pair typically form the antigen-binding site.

    [0301] In some embodiments, the percent identity of two amino acid sequences is determined using the algorithm of Karlin and Altschul Proc. Natl. Acad. Sci. USA 87:2264-68, 1990, modified as in Karlin and Altschul Proc. Natl. Acad. Sci. USA 90:5873-77, 1993. Such an algorithm is incorporated into the NBLAST and XBLAST programs (version 2.0) of Altschul, et al., J. Mol. Biol. 215:403-10, 1990. BLAST protein searches can be performed with the XBLAST program, score=50, word length=3 to obtain amino acid sequences homologous to the protein molecules of interest. Where gaps exist between two sequences, Gapped BLAST can be utilized as described in Altschul et al., Nucleic Acids Res. 25(17):3389-3402, 1997. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used.

    [0302] In any of the antibodies or antigen-binding fragments described herein, one or more conservative mutations can be introduced into the CDRs or framework sequences at positions where the residues are not likely to be involved in an antibody-antigen interaction. In some embodiments, such conservative mutation(s) can be introduced into the CDRs or framework sequences at position(s) where the residues are not likely to be involved in interacting with a LTBP1-TGF?1 complex, a LTBP3-TGF?1 complex, as determined based on the crystal structure. In some embodiments, likely interface (e.g., residues involved in an antigen-antibody interaction) may be deduced from known structural information on another antigen sharing structural similarities.

    [0303] As used herein, a conservative amino acid substitution refers to an amino acid substitution that does not alter the relative charge or size characteristics of the protein in which the amino acid substitution is made. Variants can be prepared according to methods for altering polypeptide sequence known to one of ordinary skill in the art such as are found in references which compile such methods, e.g., Molecular Cloning: A Laboratory Manual, J. Sambrook, et al., eds., Second Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 1989, or Current Protocols in Molecular Biology, F. M. Ausubel, et al., eds., John Wiley & Sons, Inc., New York. Conservative substitutions of amino acids include substitutions made amongst amino acids within the following groups: (a) M, I, L, V; (b) F, Y, W; (c) K, R, H; (d) A, G; (e) S, T; (f) Q, N; and (g) E, D.

    [0304] The variable regions typically exhibit the same general structure of relatively conserved framework regions (FR) joined by three hyper variable regions, also called complementarity determining regions or CDRs. The CDRs from the two chains of each pair typically are aligned by the framework regions, which can enable binding to a specific epitope. From N-terminal to C-terminal, both light and heavy chain variable regions typically comprise the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The assignment of amino acids to each domain is typically in accordance with the definitions of Kabat Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987 and 1991)), or Chothia & Lesk (1987) J. Mol. Biol. 196: 901-917; Chothia et al., (1989) Nature 342: 878-883. The CDRs of a light chain can also be referred to as L-CDR1, L-CDR2, and L-CDR3, and the CDRs of a heavy chain can also be referred to as H-CDR1, H-CDR2, and H-CDR3. In some embodiments, an antibody can comprise a small number of amino acid deletions from the carboxy end of the heavy chain(s). In some embodiments, an antibody comprises a heavy chain having 1-5 amino acid deletions in the carboxy end of the heavy chain. In certain embodiments, definitive delineation of a CDR and identification of residues comprising the binding site of an antibody is accomplished by solving the structure of the antibody and/or solving the structure of the antibody-ligand complex. In certain embodiments, that can be accomplished by any of a variety of techniques known to those skilled in the art, such as X-ray crystallography. In some embodiments, various methods of analysis can be employed to identify or approximate the CDR regions. Examples of such methods include, but are not limited to, the Kabat definition, the Chothia definition, the AbM definition, and the contact definition.

    [0305] An affinity matured antibody is an antibody with one or more alterations in one or more CDRs thereof, which result an improvement in the affinity of the antibody for antigen compared to a parent antibody, which does not possess those alteration(s). Exemplary affinity matured antibodies will have nanomolar or even picomolar affinities for the target antigen. Affinity matured antibodies are produced by procedures known in the art. Marks et al., (1992) Bio/Technology 10: 779-783 describes affinity maturation by VH and VL domain shuffling. Random mutagenesis of CDR and/or framework residues is described by Barbas, et al., (1994) Proc Nat. Acad. Sci. USA 91: 3809-3813; Schier et al., (1995) Gene 169: 147-155; Yelton et al., (1995) J. Immunol. 155: 1994-2004; Jackson et al., (1995) J. Immunol. 154(7): 3310-9; and Hawkins et al., (1992) J. Mol. Biol. 226: 889-896; and selective mutation at selective mutagenesis positions, contact or hypermutation positions with an activity enhancing amino acid residue is described in U.S. Pat. No. 6,914,128.

    [0306] The term CDR-grafted antibody refers to antibodies, which comprise heavy and light chain variable region sequences from one species but in which the sequences of one or more of the CDR regions of VH and/or VL are replaced with CDR sequences of another species, such as antibodies having murine heavy and light chain variable regions in which one or more of the murine CDRs (e.g., CDR3) has been replaced with human CDR sequences.

    [0307] The term chimeric antibody refers to antibodies, which comprise heavy and light chain variable region sequences from one species and constant region sequences from another species, such as antibodies having murine heavy and light chain variable regions linked to human constant regions.

    [0308] As used herein, the term framework or framework sequence refers to the remaining sequences of a variable region minus the CDRs. Because the exact definition of a CDR sequence can be determined by different systems, the meaning of a framework sequence is subject to correspondingly different interpretations. The six CDRs (L-CDR1, L-CDR2, and L-CDR3 of light chain and H-CDR1, H-CDR2, and H-CDR3 of heavy chain) also divide the framework regions on the light chain and the heavy chain into four sub-regions (FR1, FR2, FR3 and FR4) on each chain, in which CDR1 is positioned between FR1 and FR2, CDR2 between FR2 and FR3, and CDR3 between FR3 and FR4. Without specifying the particular sub-regions as FR1, FR2, FR3 or FR4, a framework region, as referred by others, represents the combined FR's within the variable region of a single, naturally occurring immunoglobulin chain. As used herein, a FR represents one of the four sub-regions, and FRs represents two or more of the four sub-regions constituting a framework region.

    [0309] In some embodiments, the antibody, or antigen-binding portion thereof, comprises a heavy chain immunoglobulin constant domain of a human IgM constant domain, a human IgG constant domain, a human IgG1 constant domain, a human IgG2 constant domain, a human IgG2A constant domain, a human IgG2B constant domain, a human IgG2 constant domain, a human IgG3 constant domain, a human IgG3 constant domain, a human IgG4 constant domain, a human IgA constant domain, a human IgA1 constant domain, a human IgA2 constant domain, a human IgD constant domain, or a human IgE constant domain. In some embodiments, the antibody, or antigen-binding portion thereof, comprises a heavy chain immunoglobulin constant domain of a human IgG1 constant domain or a human IgG4 constant domain. In some embodiments, the antibody, or antigen-binding portion thereof, comprises a heavy chain immunoglobulin constant domain of a human IgG4 constant domain. In some embodiments, the antibody, or antigen-binding portion thereof, comprises a heavy chain immunoglobulin constant domain of a human IgG4 constant domain having a backbone substitution of Ser to Pro that produces an IgG1-like hinge and permits formation of inter-chain disulfide bonds.

    [0310] In some embodiments, the antibodies provided herein comprise mutations that confer desirable properties to the antibodies. For example, to avoid potential complications due to Fab-arm exchange, which is known to occur with native IgG4 mAbs, the antibodies provided herein may comprise a stabilizing Adair mutation (Angal et al., A single amino acid substitution abolishes the heterogeneity of chimeric mouse/human (IgG4) antibody, Mol Immunol 30, 105-108; 1993), where serine 228 (EU numbering; residue 241 Kabat numbering) is converted to proline resulting in an IgG1-like (CPPCP (SEQ ID NO: 45)) hinge sequence. Accordingly, any of the antibodies may include a stabilizing Adair mutation or the amino acid sequence CPPCP (SEQ ID NO: 45).

    [0311] In some embodiments, the antibody or antigen-binding portion thereof, further comprises a light chain immunoglobulin constant domain comprising a human Ig lambda constant domain or a human Ig kappa constant domain.

    [0312] In some embodiments, the antibody is an IgG having four polypeptide chains which are two heavy chains and two light chains.

    [0313] In some embodiments, wherein the antibody is a humanized antibody, a diabody, or a chimeric antibody. In some embodiments, the antibody is a humanized antibody. In some embodiments, the antibody is a human antibody. In some embodiments, the antibody comprises a framework having a human germline amino acid sequence.

    [0314] In some embodiments, the antigen-binding portion is a Fab fragment, a F(ab)2 fragment, a scFab fragment, or an scFv fragment.

    [0315] As used herein, the term germline antibody gene or gene fragment refers to an immunoglobulin sequence encoded by non-lymphoid cells that have not undergone the maturation process that leads to genetic rearrangement and mutation for expression of a particular immunoglobulin (see, e.g., Shapiro et al., (2002) Crit. Rev. Immunol. 22(3): 183-200; Marchalonis et al., (2001) Adv. Exp. Med. Biol. 484: 13-30). One of the advantages provided by various embodiments of the present disclosure stems from the recognition that germline antibody genes are more likely than mature antibody genes to conserve essential amino acid sequence structures characteristic of individuals in the species, hence less likely to be recognized as from a foreign source when used therapeutically in that species.

    [0316] As used herein, the term neutralizing refers to counteracting the biological activity of an antigen when a binding protein specifically binds to the antigen. In an embodiment, the neutralizing binding protein binds to the antigen/target, e.g., cytokine, kinase, growth factor, cell surface protein, soluble protein, phosphatase, or receptor ligand, and reduces its biologically activity by at least about 20%, 40%, 60%, 80%, 85%, 90%, 95%. 96%, 97%, 98%, 99% or more.

    [0317] The term binding protein as used herein includes any polypeptide that specifically binds to an antigen (e.g., TGF?1), including, but not limited to, an antibody, or antigen-binding fragment thereof, a DVD-Ig?, a TVD-Ig, a RAb-Ig, a bispecific antibody and a dual specific antibody.

    [0318] The term monoclonal antibody or mAb when used in a context of a composition comprising the same may refer to an antibody preparation obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigen. Furthermore, in contrast to polyclonal antibody preparations that typically include different antibodies directed against different determinants (epitopes), each mAb is directed against a single determinant on the antigen. The modifier monoclonal is not to be construed as requiring production of the antibody by any particular method.

    [0319] The term recombinant human antibody, as used herein, is intended to include all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies expressed using a recombinant expression vector transfected into a host cell (described further in Section II C, below), antibodies isolated from a recombinant, combinatorial human antibody library (Hoogenboom, H. R. (1997) TIB Tech. 15: 62-70; Azzazy, H. and Highsmith, W. E. (2002) Clin. Biochem. 35: 425-445; Gavilondo, J. V. and Larrick, J. W. (2002) BioTechniques 29: 128-145; Hoogenboom, H. and Chames, P. (2000) Immunol. Today 21: 371-378, incorporated herein by reference), antibodies isolated from an animal (e.g., a mouse) that is transgenic for human immunoglobulin genes (see, Taylor, L. D. et al., (1992) Nucl. Acids Res. 20: 6287-6295; Kellermann, S-A. and Green, L. L. (2002) Cur. Opin. In Biotechnol. 13: 593-597; Little, M. et al., (2000) Immunol. Today 21: 364-370) or antibodies prepared, expressed, created or isolated by any other means that involves splicing of human immunoglobulin gene sequences to other DNA sequences. Such recombinant human antibodies have variable and constant regions derived from human germline immunoglobulin sequences. In certain embodiments, however, such recombinant human antibodies are subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo.

    [0320] In some embodiments, the antibody or antigen-binding portion, is an antibody fragment, e.g., (i) Fab fragments, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) Fd fragments consisting of the VH and CH1 domains; (iv) Fv fragments consisting of the VL and VH domains of a single arm of an antibody; (v) single-chain Fv (scFv) molecules; (vi) dAb fragments; or (vii) minimal recognition units consisting of the amino acid residues that mimic the hypervariable region of an antibody (e.g., an isolated complementarity determining region (CDR)). In some embodiments, the antibody or antigen-binding portion, is (i) a Dual Variable Domain Immunoglobulin or DVD-Ig?, (ii) a Triple Variable Domain Immunoglobulin or TVD-Ig, (iii) a Receptor-Antibody Immunoglobulin or RAb-Ig, (iv) a bispecific antibody, or (v) a dual-specific antibody,

    [0321] As used herein, Dual Variable Domain Immunoglobulin or DVD-Ig? and the like include binding proteins comprising a paired heavy chain DVD polypeptide and a light chain DVD polypeptide with each paired heavy and light chain providing two antigen-binding sites. Each binding site includes a total of 6 CDRs involved in antigen-binding per antigen-binding site. A DVD-Ig? is typically has two arms bound to each other at least in part by dimerization of the CH3 domains, with each arm of the DVD being bispecific, providing an immunoglobulin with four binding sites. DVD-Ig? are provided in US Patent Publication No. 2010/0260668 and U.S. Pat. No. 9,109,026, each of which is incorporated herein by reference including sequence listings.

    [0322] As used herein, Triple Variable Domain Immunoglobulin or TVD-Ig and the like are binding proteins comprising a paired heavy chain TVD binding protein polypeptide and a light chain TVD binding protein polypeptide with each paired heavy and light chain providing three antigen-binding sites. Each binding site includes a total of 6 CDRs involved in antigen-binding per antigen-binding site. A TVD binding protein may have two arms bound to each other at least in part by dimerization of the CH3 domains, with each arm of the TVD binding protein being trispecific, providing a binding protein with six binding sites.

    [0323] As used herein, Receptor-Antibody Immunoglobulin or RAb-Ig and the like are binding proteins comprising a heavy chain RAb polypeptide, and a light chain RAb polypeptide, which together form three antigen-binding sites in total. One antigen-binding site is formed by the pairing of the heavy and light antibody variable domains present in each of the heavy chain RAb polypeptide and the light chain RAb polypeptide to form a single binding site with a total of 6 CDRs providing a first antigen-binding site. Each the heavy chain RAb polypeptide and the light chain RAb polypeptide include a receptor sequence that independently binds a ligand providing the second and third antigen binding sites. A RAb-Ig is typically has two arms bound to each other at least in part by dimerization of the CH3 domains, with each arm of the RAb-Ig being trispecific, providing an immunoglobulin with six binding sites. RAb-Igs are described in US Patent Application Publication No. 2002/0127231, the entire contents of which including sequence listings are incorporated herein by reference).

    [0324] The term bispecific antibody, as used herein, and as differentiated from a bispecific half-Ig binding protein or bispecific (half-Ig) binding protein, refers to full-length antibodies that are generated by quadroma technology (see Milstein, C. and Cuello, A. C. (1983) Nature 305(5934): p. 537-540), by chemical conjugation of two different monoclonal antibodies (see Staerz, U. D. et al., (1985) Nature 314(6012): 628-631), or by knob-into-hole or similar approaches, which introduce mutations in the Fc region that do not inhibit CH3-CH3 dimerization (see Holliger, P. et al., (1993) Proc. Nat. Acad. Sci USA 90(14): 6444-6448), resulting in multiple different immunoglobulin species of which only one is the functional bispecific antibody. By molecular function, a bispecific antibody binds one antigen (or epitope) on one of its two binding arms (one pair of HC/LC), and binds a different antigen (or epitope) on its second arm (a different pair of HC/LC). By this definition, a bispecific antibody has two distinct antigen-binding arms (in both specificity and CDR sequences) and is monovalent for each antigen it binds to.

    [0325] The term dual-specific antibody, as used herein, and as differentiated from a bispecific half-Ig binding protein or bispecific binding protein, refers to full-length antibodies that can bind two different antigens (or epitopes) in each of its two binding arms (a pair of HC/LC) (see PCT Publication No. WO 02/02773). Accordingly, a dual-specific binding protein has two identical antigen-binding arms, with identical specificity and identical CDR sequences, and is bivalent for each antigen to which it binds.

    [0326] The term Kon, as used herein, is intended to refer to the on rate constant for association of a binding protein (e.g., an antibody) to the antigen to form the, e.g., antibody/antigen complex as is known in the art. The Kon also is known by the terms association rate constant, or ka, as used interchangeably herein. This value indicating the binding rate of an antibody to its target antigen or the rate of complex formation between an antibody and antigen also is shown by the equation: Antibody (Ab)+Antigen (Ag).fwdarw.Ab?Ag.

    [0327] The term Koff as used herein, is intended to refer to the off rate constant for dissociation of a binding protein (e.g., an antibody) from the, e.g., antibody/antigen complex as is known in the art. The Koff also is known by the terms dissociation rate constant or kdis as used interchangeably herein. This value indicates the dissociation rate of an antibody from its target antigen or separation of Ab?Ag complex over time into free antibody and antigen as shown by the equation: Ab+Ag?Ab?Ag.

    [0328] The terms equilibrium dissociation constant or K.sub.D, as used interchangeably herein, refer to the value obtained in a titration measurement at equilibrium, or by dividing the dissociation rate constant (koff) by the association rate constant (kon). The association rate constant, the dissociation rate constant, and the equilibrium dissociation constant are used to represent the binding affinity of a binding protein, e.g., antibody, to an antigen. Methods for determining association and dissociation rate constants are well known in the art. Using fluorescence-based techniques offers high sensitivity and the ability to examine samples in physiological buffers at equilibrium. Other experimental approaches and instruments, such as a BIACORE? (biomolecular interaction analysis) assay, can be used (e.g., instrument available from BIAcore International AB, a GE Healthcare company, Uppsala, Sweden). Additionally, a KINEXA? (Kinetic Exclusion Assay) assay, available from Sapidyne Instruments (Boise, Idaho), can also be used.

    [0329] The terms crystal and crystallized as used herein, refer to a binding protein (e.g., an antibody), or antigen-binding portion thereof, that exists in the form of a crystal. Crystals are one form of the solid state of matter, which is distinct from other forms such as the amorphous solid state or the liquid crystalline state. Crystals are composed of regular, repeating, three-dimensional arrays of atoms, ions, molecules (e.g., proteins such as antibodies), or molecular assemblies (e.g., antigen/antibody complexes). These three-dimensional arrays are arranged according to specific mathematical relationships that are well-understood in the field. The fundamental unit, or building block, that is repeated in a crystal is called the asymmetric unit. Repetition of the asymmetric unit in an arrangement that conforms to a given, well-defined crystallographic symmetry provides the unit cell of the crystal. Repetition of the unit cell by regular translations in all three dimensions provides the crystal. See Giege, R. and Ducruix, A. Barrett, Crystallization of Nucleic Acids and Proteins, a Practical Approach, 2nd ea., pp. 201-16, Oxford University Press, New York, New York, (1999).

    [0330] The term linker is used to denote polypeptides comprising two or more amino acid residues joined by peptide bonds and are used to link one or more antigen-binding fragment. Such linker polypeptides are well known in the art (see, e.g., Holliger, P. et al., (1993) Proc. Natl. Acad. Sci. USA 90: 6444-6448; Poljak, R. J. et al., (1994) Structure 2:1121-1123). Exemplary linkers include, but are not limited to, ASTKGPSVFPLAP (SEQ ID NO: 65), ASTKGP (SEQ ID NO: 66); TVAAPSVFIFPP (SEQ ID NO: 67); TVAAP (SEQ ID NO: 68); AKTTPKLEEGEFSEAR (SEQ ID NO: 69); AKTTPKLEEGEFSEARV (SEQ ID NO: 70); AKTTPKLGG (SEQ ID NO: 71); SAKTTPKLGG (SEQ ID NO: 72); SAKTTP (SEQ ID NO: 73); RADAAP (SEQ ID NO: 74); RADAAPTVS (SEQ ID NO: 75); RADAAAAGGPGS (SEQ ID NO: 76); RADAAAA(G4S)4 (SEQ ID NO: 77); SAKTTPKLEEGEFSEARV (SEQ ID NO: 78); ADAAP (SEQ ID NO: 79); ADAAPTVSIFPP (SEQ ID NO: 80); QPKAAP (SEQ ID NO: 81); QPKAAPSVTLFPP (SEQ ID NO: 82); AKTTPP (SEQ ID NO: 83); AKTTPPSVTPLAP (SEQ ID NO: 84); AKTTAP (SEQ ID NO: 85); AKTTAPSVYPLAP (SEQ ID NO: 86); GGGGSGGGGSGGGGS (SEQ ID NO: 87); GENKVEYAPALMALS (SEQ ID NO: 88); GPAKELTPLKEAKVS (SEQ ID NO: 89); GHEAAAVMQVQYPAS (SEQ ID NO: 90); TVAAPSVFIFPPTVAAPSVFIFPP (SEQ ID NO: 91); and ASTKGPSVFPLAPASTKGPSVFPLAP (SEQ ID NO: 92).

    [0331] Label and detectable label or detectable moiety mean a moiety attached to a specific binding partner, such as an antibody or an analyte, e.g., to render the reaction between members of a specific binding pair, such as an antibody and an analyte, detectable, and the specific binding partner, e.g., antibody or analyte, so labeled is referred to as detectably labeled. Antibodies, or antigen binding fragment thereof, of the disclosure may be modified with a detectable label or detectable moiety, including, but not limited to, an enzyme, prosthetic group, fluorescent material, luminescent material, bioluminescent material, radioactive material, positron emitting metal, nonradioactive paramagnetic metal ion, and affinity label for detection and/or isolation of a LTBP1-TGF?1 complex or a LTBP3-TGF?1 complex. The detectable substance or moiety may be coupled or conjugated either directly to the polypeptides of the disclosure or indirectly, through an intermediate (such as, for example, a linker (e.g., a cleavable linker)) using suitable techniques. Non-limiting examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, R-galactosidase, glucose oxidase, or acetylcholinesterase; non-limiting examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; non-limiting examples of suitable fluorescent materials include biotin, umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride, or phycoerythrin; an example of a luminescent material includes luminol; non-limiting examples of bioluminescent materials include luciferase, luciferin, and aequorin; and examples of suitable radioactive material include a radioactive metal ion, e.g., alpha-emitters or other radioisotopes such as, for example, iodine (.sup.131I, .sup.125I, .sup.123I, .sup.121I), carbon (.sup.14C), sulfur (.sup.35S), tritium (.sup.3H), indium (.sup.115mIn, .sup.113mIn, .sup.112In, .sup.11In), and technetium (.sup.99Tc, .sup.99mTc), thallium (.sup.201Ti), gallium (.sup.68Ga, .sup.67Ga), palladium (.sup.103Pd), molybdenum (.sup.99Mo), xenon (.sup.133Xe), fluorine (.sup.18F), .sup.153Sm, Lu, .sup.159Gd, .sup.149Pm .sup.140La, .sup.175Yb, .sup.166Ho, .sup.90Y, .sup.47Sc, .sup.86R, .sup.188Re, .sup.142Pr, .sup.105Rh, .sup.97Ru, .sup.68Ge, .sup.57Co, .sup.65Zn, .sup.85Sr, .sup.32P, .sup.153Gd, .sup.169Yb, .sup.51Cr, .sup.54Mn, .sup.75Se, and tin (.sup.113Sn, .sup.117Sn). The detectable substance may be coupled or conjugated either directly to the antibodies of the disclosure that bind selectively to a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex, or indirectly, through an intermediate (such as, for example, a linker) using suitable techniques. Any of the antibodies provided herein that are conjugated to a detectable substance may be used for any suitable diagnostic assays, such as those described herein.

    [0332] In addition, antibodies, or antigen binding fragment thereof, of the disclosure may also be modified with a drug to form, e.g., an antibody-drug conjugate. The drug may be coupled or conjugated either directly to the polypeptides of the disclosure, or indirectly, through an intermediate (such as, for example, a linker (e.g., a cleavable linker)) using suitable techniques. Representative examples of labels commonly employed for immunoassays include moieties that produce light, e.g., acridinium compounds, and moieties that produce fluorescence, e.g., fluorescein. Other labels are described herein. In this regard, the moiety itself may not be detectably labeled but may become detectable upon reaction with yet another moiety. Use of detectably labeled is intended to encompass the latter type of detectable labeling.

    [0333] In some embodiments, the binding affinity of an antibody, or antigen-binding portion thereof, to an antigen (e.g., protein complex), such as presenting molecule-proTGF?1 complexes, is determined using an Octet assay. In some embodiments, an Octet assay is an assay that determines one or more a kinetic parameters indicative of binding between an antibody and antigen. In some embodiments, an OCTET? system (FORTEBIO?, Menlo Park, CA) is used to determine the binding affinity of an antibody, or antigen-binding portion thereof, to presenting molecule-proTGF?1 complexes. For example, binding affinities of antibodies may be determined using the FORTEBIO? Octet QKe dip and read label free assay system utilizing bio-layer interferometry. In some embodiments, antigens are immobilized to biosensors (e.g., streptavidin-coated biosensors) and the antibodies and complexes (e.g., biotinylated presenting molecule-proTGF?1 complexes) are presented in solution at high concentration (50 ?g/mL) to measure binding interactions.

    [0334] The antibodies according to the present disclosure include pH-sensitive antibodies. In some embodiments, such antibodies or fragments thereof bind the target complex in a pH-dependent manner such that relatively high affinity binding occurs at a neutral or physiological pH, but the antibody dissociates from its antigen more rapidly at an acidic pH; or, dissociation rates are higher at acidic pH than at neutral pH. Such antibodies or fragments thereof may function as recycling antibodies. Such antibodies may also be referred to as pH-sensitive antibodies.

    [0335] Thus, the disclosure encompasses pH-sensitive antibodies that selectively bind a proTGF?1 complex characterized in that the antibodies have lower dissociation rates at a neutral pH (e.g., around pH 7) as compared to at an acidic pH (e.g., around pH 5).

    [0336] In some embodiments, such pH sensitive antibodies have a K.sub.dis (a.k.a. K.sub.off) of ?5?10.sup.?3 s.sup.?1 (e.g., ?5.1?10.sup.?3, ?5.2?10.sup.?3, ?5.3?10.sup.?3, ?5.4?10.sup.?3, ?5.5?10.sup.?3, ?5.6?10.sup.?3, ?5.7?10.sup.?3, ?5.8? 10.sup.?3, ?5.9?10.sup.?3, or ?6.0?10.sup.?3) at pH 5, as measured by a suitable affinity assay (e.g., biolayer interferometry, surface plasmon resonance, and/or solution equilibrium titration). In a particular embodiment, such pH-sensitive antibodies have a K.sub.dis?5.6?10.sup.?3 at pH 5.

    [0337] In some embodiments, such pH-sensitive antibodies have a pH 5 K.sub.dis to pH 7 K.sub.dis ratio (i.e., K.sub.dis at pH 5: K.sub.dis at pH7) of ?1.5 (e.g., ?1.6, ?1.7, ?1.8, ?1.9, or ?2.0), as measured by a suitable affinity assay (e.g., biolayer interferometry, surface plasmon resonance, and/or solution equilibrium titration). In a particular embodiment, such pH-sensitive antibodies have a K.sub.dis ratio of ?2.0, as measured by biolayer interferometry.

    Targeting Agents

    [0338] In some embodiments methods of the present disclosure comprise the use of one or more targeting agents to target an antibody, or antigen binding portion thereof, as disclosed herein, to a particular site in a subject for purposes of modulating mature TGF? release from a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex. For example, LTBP1-TGF?1 and LTBP3-TGF?1 complexes are typically localized to extracellular matrix. Thus, in some embodiments, antibodies disclosed herein can be conjugated to extracellular matrix targeting agents for purposes of localizing the antibodies to sites where LTBP1-TGF?1 and LTBP3-TGF?1 complexes reside. In such embodiments, selective targeting of antibodies leads to selective modulation of LTBP1-TGF?1 and/or LTBP3-TGF?1 complexes. In some embodiments, selective targeting of antibodies leads to selective inhibition of LTBP1-TGF?1 and/or LTBP3-TGF?1 complexes (e.g., for purposes of treating fibrosis). In some embodiments, extracellular matrix targeting agents include heparin binding agents, matrix metalloproteinase binding agents, lysyl oxidase binding domains, fibrillin-binding agents, hyaluronic acid binding agents, and others.

    [0339] In some embodiments, bispecific antibodies may be used having a first portion that selectively binds a LTBP1/3-TGF?1 complex and a second portion that selectively binds a component of a target site, e.g., a component of the ECM (e.g., fibrillin).

    Binding Kinetics of Antibodies

    [0340] The antibodies and antigen-binding fragments thereof (e.g., Fabs) disclosed herein are characterized by enhanced binding properties. The antibodies and the antigen-binding fragments are capable of specifically binding to each of the presenting molecule-proTGF?1 complexes (sometimes referred to as Large Latency Complex or LLC, which is a ternary complex comprised of a proTGF?1 dimer coupled to a single presenting molecule), namely, LTBP1-proTGF?1, LTBP3-proTGF?1, GARP-proTGF?1 and LRRC33-proTGF?1. Recombinantly produced, purified protein complexes may be used as antigens (e.g., antigen complexes) to screen, evaluate or confirm the ability of an antibody to bind the antigen complexes in suitable in vitro binding assays. Such assays are well known in the art and include but are not limited to: Bio-Layer Interferometry (BLI)-based assays (such as OCTET?) and surface plasmon resonance (SPR)-based assays (such as BIACORE?).

    [0341] In some embodiments, the inhibitory potency (e.g., IC.sub.50) of the novel antibodies of the present disclosure calculated based on cell-based assays (such as LN229 cell assays described elsewhere herein) may be less than 10 nM measured against each of the hLTBP1-proTGF?1 and hLTBP3-proTGF?1 complexes. In some embodiments, the antibodies have an IC50 of 5 nM or less (i.e., <5 nM) measured against each of the hLTBP1-proTGF?1 and hLTBP3-proTGF?1 complexes. In preferred embodiments, the IC50 of the antibody measured against at least one of the hLTBP1-proTGF?1 and hLTBP3-proTGF?1 complexes is less than 1 nM.

    [0342] In some embodiments, potency may be evaluated in suitable in vivo models as a measure of efficacy and/or pharmacodynamics effects. For example, if the first antibody is efficacious in an in vivo model at a certain concentration, and the second antibody is equally efficacious at a lower concentration than the first in the same in vivo model, then, the second antibody can be said to be more potent than the first antibody. Any suitable disease models known in the art may be used to assess relative potencies of TGF?1 inhibitors, depending on the particular indication of interest, e.g., fibrosis models. Preferably, multiple doses or concentrations of each test antibody are included in such studies.

    [0343] Similarly, pharmacodynamics (PD) effects may be measured to determine relative potencies of inhibitory antibodies. Commonly used PD measures for the TGF? signaling pathway include, without limitation, phosphorylation of SMAD2/3 and expression of downstream effector genes, the transcription of which is sensitive to TGF? activation, such as those with a TGF?3-responsive promoter element (e.g., SMAD-binding elements). In some embodiments, the antibodies of the present disclosure are capable of completely blocking disease-induced SMAD2/3 phosphorylation in preclinical fibrosis models when the animals are administered at a dose of 3 mg/kg or less. In some embodiments, the antibodies of the present disclosure are capable of suppressing fibrosis-induced expression of a panel of marker genes including MMP2, Coil a1, Col3a1, Fn1, CTGF, TIMP1, TGF?1, TGF?2, TGF?3, LTBP1, LTBP3, LRRC33, LRRC32/GARP, SERPINE1/PAI-1, THBS1, and Loxl2, when the animals are administered an antibody, or an antigen-binding fragment thereof, at a dose of 10 mg/kg or less in a model of lung fibrosis, for example an idiopathic pulmonary fibrosis (IPF) model as described hereinin the Examples.

    [0344] Method for measurements of antibody binding. The antibody or antigen-binding fragment thereof can bind a human LTBP1-proTGF?1 complex or a human LTBP3-TGF?1 complex with a K.sub.D of less than 5 nM as measured by bio-layer interferometry, and has one or more of the following properties: (i) is cross-reactive with mouse LTBP1-proTGF?1 complex; (ii) is cross-reactive with mouse LTBP3-proTGF?1 complex; (iii) binds a mouse LTBP1-proTGF?1 complex with a K.sub.D of less than or equal to 10 nM as measured by bio-layer interferometry; (iv) binds a mouse LTBP3-proTGF?1 complex with a K.sub.D of less than or equal to 10 nM as measured by bio-layer interferometry; (v) binds a human LTBP1-proTGF?1 complex or a human LTBP3-TGF?1 complex with a K.sub.D that is at least fifty times lower than the K.sub.D when binding to a human GARP-proTGF?1 complex under the same assay conditions; and (vi) shows less than 50-fold (preferably less than 100-fold) binding to a human GARP-proTGF?1 complex, as measured by bio-layer interferometry, under the same assay conditions as used to measure binding to human LTBP1-proTGF?1 complex or a human LTBP3-TGF?1 complex; (vii) shows less than 50-fold (preferably less than 100-fold) binding to an LRRC33-proTGF?1 complex as measured by bio-layer interferometry, under the same assay conditions as used to measure binding to human LTBP1-proTGF?1 complex or human LTBP3-TGF?1 complex.

    [0345] The antibody or antigen-binding fragment may bind a human LTBP1-proTGF?1 complex and a human LTBP3-TGF?1 complex with a K.sub.D of less than 5 nM as measured by bio-layer interferometry and has all the above properties (i)-(vii).

    [0346] In some embodiments, binding characteristics (kinetics, affinities, etc.) are measured using surface plasmon resonance-based assay, such as Biacore. As an example, monovalent (Fab) affinities of Ab42 as measured by Biacore according to the manufacturer's instruction are shown below.

    TABLE-US-00012 Ab42 monovalent (Fab) affinities Human antigen complex Ab42 K.sub.D (nM) ON rate (1/Ms) OFF rate (1/s) LTBP1-proTGF?1 0.38 2.93e5 1.11e?4 LTBP3-proTGF?1 0.57 1.91e5 1.09e?4 GARP-proTGF?1 144.61 4.15e4 6e?3 LRRC33-proTGF?1 134.25 2.02e4 2.71e?3

    [0347] Method for measurement of off-rates, k.sub.OFF. Advantageous isoform-selective inhibitors of TGF?1 activation may include monoclonal antibodies (including immunoglobulins and antigen-binding fragments or portions thereof) that exhibit slow dissociation rates, i.e., off-rates, k.sub.OFF. The disclosure is further based on the recognition that treatment of chronic and progressive disease such as fibrosis may require inhibitors with superior durability, which may be reflected on the dissociation rate of such antibody.

    [0348] The affinity of an antibody to its antigen can be measured as the equilibrium dissociation constant, or K.sub.D. The ratio of the experimentally measured off- and on-rates (k.sub.OFF/k.sub.ON) can be used to calculate the K.sub.D value. The k.sub.OFF value represents the antibody dissociation rate, which indicates how quickly it dissociates from its antigen, whilst the k.sub.ON value represents the antibody association rate which provides how quickly it binds to its antigen. The latter can be concentration-dependent, while the former is concentration-independent. The K.sub.D value relates to the concentration of antibody (the amount of antibody needed for a particular experiment) and so the lower the K.sub.D value (lower concentration) and thus the higher the affinity of the antibody. With respect to a reference antibody, a higher affinity antibody may have a lower k.sub.OFF rate, a higher k.sub.ON rate, or both.

    [0349] Both the k.sub.OFF and k.sub.ON rates contribute to the overall affinity of a particular antibody to its antigen, and relative importance or impact of each component may depend on the mechanism of action of the antibody. Neutralizing antibodies, which bind mature growth factors, e.g., soluble, transient TGF?1 ligand liberated from a latent complex, must compete with the endogenous high-affinity receptors for ligand binding in vivo. Because the ligand-receptor interaction is a local event and because the ligand is short-lived, such antibodies must be capable of rapidly targeting and sequestering the soluble growth factor before the ligand finds its cellular receptor (thereby activating the TGF?1 signaling pathway) in the tissue. Therefore, for ligand-targeting neutralizing antibodies to be potent, the ability to bind the target growth factor fast, i.e., high association rates (k.sub.ON), may be especially important.

    [0350] To illustrate, the measured on rates and off rates of Ab42 are provided in the above table for each of the four human LLCs. As can be seen, sub-nanomolar affinities for the LTBP1/3 complexes are achieved by a combination of high association kinetics and slow dissociation kinetics.

    Potency; Inhibitory Activity

    [0351] Antibodies disclosed herein may be broadly characterized as functional antibodies for their ability to inhibit TGF?1 signaling. As used herein, a functional antibody confers one or more biological activities by virtue of its ability to bind an antigen (e.g., antigen complexes). Functional antibodies therefore broadly include those capable of modulating the activity/function of target molecules (i.e., antigen). Such modulating antibodies include inhibiting antibodies (or inhibitory antibodies) and activating antibodies. The present disclosure is drawn to antibodies which can inhibit a biological process mediated by TGF?1 signaling associated with multiple contexts of TGF?1. Inhibitory agents used to carry out the present disclosure, such as the antibodies described herein, are intended to be TGF?31-selective and not to target or interfere with TGF?2 and TGF?3 when administered at a therapeutically effective dose (dose at which sufficient efficacy is achieved within acceptable toxicity levels). The novel antibodies of the present disclosure have enhanced inhibitory activities (potency) as compared to previously identified activation inhibitors of TGF?1.

    [0352] Pharmacodynamics (PD) effects may be measured to determine relative potencies of inhibitory antibodies. Commonly used PD measures for the TGF? signaling pathway include, without limitation, phosphorylation of SMAD2/3 and expression of downstream effector genes, the transcription of which is sensitive to TGF? activation, such as those with a TGF?3-responsive promoter element (e.g., SMAD-binding elements). In some embodiments, the antibodies of the present disclosure are capable of completely blocking disease-induced SMAD2/3 phosphorylation in preclinical fibrosis models when the animals are administered at a dose of 3 mg/kg or less. In some embodiments, the antibodies of the present disclosure are capable of reducing and/or completely blocking disease-induced SMAD2/3 phosphorylation. In some embodiments, the antibodies of the present disclosure are capable of reducing and/or completely blocking disease-induced SMAD2 phosphorylation (e.g., regardless of any change in SMAD3). In some embodiments, reduction is measured as a ratio of phosphorylated SMAD2/3 over total SMAD2/3. In some embodiments, reduction is measured as a ratio of phosphorylated SMAD2 over total SMAD2. In some embodiments, the antibodies of the present disclosure are capable of reducing nuclear localization of phosphorylated SMAD2, as measured, for example, by IHC. Without being bound by theory, in some embodiments, measuring SMAD2 phosphorylation (without measuring SMAD3) may improve the accurate detection of a treatment-related effect. Denis et al., Development 143: 3481-90 (2016); Liu et al., J. Biol. Chem. 278: 11721-8 (2003); David et al., Oncoimmunology 6: e1349589 (2017). n some embodiments, the antibodies of the present disclosure are capable of suppressing fibrosis-induced expression of a panel of marker genes including MMP2, Col1a1, Col3a1, Fn1, CTGF, TIMP1, TGF?1, TGF?2, TGF?3, LTBP1, LTBP3, LRRC33, LRRC32/GARP, SERPINE1/PAI-1, THBS1, and Loxl2 when the animals are administered an antibody or antigen-binding fragment of the present disclosure, at a dose of 30 mg/kg or less in a model of lung fibrosis, for example an idiopathic pulmonary fibrosis (IPF) model as described hereinin the Examples. In some embodiments, the antibodies of the present disclosure are capable of suppressing fibrosis-induced expression of a panel of marker genes including MMP2, Col1a1, Col3a1, Fn1, CTGF, TIMP1, TGFB1, TGFB2, TGFB3, LTBP1, LTBP3, LRRC33, LRRC32/GARP, SERPINE1/PAI-1, THBS1, and Loxl2 when the animals are administered an antibody or antigen-binding fragment of the present disclosure, at a dose of 10 mg/kg or less in a model of lung fibrosis, for example an idiopathic pulmonary fibrosis (IPF) model as described hereinin the Examples. In some embodiments, the antibodies of the present disclosure are capable of suppressing fibrosis-induced expression of a panel of marker genes including MMP2, Col1a1, Col3a1, Fn1, CTGF, TIMP1, TGFB1, TGFB2, TGFB3, LTBP1, LTBP3, LRRC33, LRRC32/GARP, SERPINE1/PAI-1, THBS1, and Loxl2 when the animals are administered an antibody or antigen-binding fragment of the present disclosure, at a dose of 3 mg/kg or less in a model of lung fibrosis, for example an idiopathic pulmonary fibrosis (IPF) model as described herein.

    [0353] In some embodiments, potency of an inhibitory antibody may be measured in suitable cell-based assays, such as CAGA reporter assays described herein. Generally, cultured cells, such as heterologous cells and primary cells, may be used for carrying out cell-based potency assays. Cells that express endogenous TGF?1 and/or a presenting molecule of interest, such as LTBP1, LTBP3, GARP and LRRC33, may be used. Alternatively, exogenous nucleic acids encoding protein(s) of interest, such as TGF?1 and/or a presenting molecule of interest, such as LTBP1, LTBP3, GARP and LRRC33, may be introduced into such cells, for example by transfection (e.g., stable transfection or transient transfection) or by viral vector-based infection. In some embodiments, LN229 cells are employed for such assays. The cells expressing TGF?1 and a presenting molecule of interest (e.g., LTBP1, LTBP3, GARP or LRRC33) are grown in culture, which present the large latent complex either on cell surface (when associated with GARP or LRRC33) or deposit into the ECM (when associated with an LTBP). Activation of TGF?1 may be triggered by integrin, expressed on another cell surface.

    [0354] The integrin-expressing cells may be the same cells co-expressing the large latent complex or a separate cell type. Reporter cells are added to the assay system, which incorporates a TGF?-responsive element. In this way, the degree of TGF? activation may be measured by detecting the signal from the reporter cells (e.g., TGF?3-responsive reporter genes, such as luciferase coupled to a TGF?3-responsive promoter element) upon TGF? activation. Using such cell-based assay systems, inhibitory activities of the antibodies can be determined by measuring the change (reduction) or difference in the reporter signal (e.g., luciferase activities as measured by fluorescence readouts) either in the presence or absence of test antibodies.

    Pharmaceutical Compositions

    [0355] The disclosure further provides pharmaceutical compositions used as a medicament suitable for administration in human and non-human subjects. One or more isoform-specific antibodies encompassed by the disclosure can be formulated or admixed with a pharmaceutically acceptable carrier (excipient), including, for example, a buffer, to form a pharmaceutical composition. Such formulations may be used for the treatment of a disease or disorder that involves TGF? signaling. In particularly preferred embodiments, such formulations may be used for diseases or disorders involving fibrosis.

    [0356] The pharmaceutical compositions of the disclosure may be administered to patients for alleviating a TGF?-related indication (e.g., fibrosis, immune disorders, and/or cancer). Acceptable means that the carrier is compatible with the active ingredient of the composition (and preferably, capable of stabilizing the active ingredient) and not deleterious to the subject to be treated. Examples of pharmaceutically acceptable excipients (carriers), including buffers, would be apparent to the skilled artisan and have been described previously. See, e.g., Remington: The Science and Practice of Pharmacy 20.sup.th Ed. (2000) Lippincott Williams and Wilkins, Ed. K. E. Hoover. In one example, a pharmaceutical composition described herein contains more than one antibody that specifically binds a GARP-proTGF?1 complex, a LTBP1-proTGF?1 complex, a LTBP3-proTGF?1 complex, and a LRRC33-proTGF?1 complex where the antibodies recognize different epitopes/residues of the complex.

    [0357] The disclosure further provides pharmaceutical compositions used as a medicament suitable for administration in human and non-human subjects. One or more antibodies that selectively binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex can be formulated or admixed with a pharmaceutically acceptable carrier (excipient), including, for example, a buffer, to form a pharmaceutical composition. Such formulations may be used for the treatment of a disease or disorder that involves TGF? signaling. In some embodiments, such disease or disorder associated with TGF? signaling involves one or more contexts, i.e., the TGF? is associated with a particular type or types of presenting molecules. In some embodiments, such context occurs in a cell type-specific and/or tissue-specific manner. In some embodiments, for example, such context-dependent action of TGF? signaling is mediated in part via GARP, LRRC33, LTBP1 and/or LTBP3.

    [0358] In some embodiments, the antibody of the present disclosure binds selectively to a single context of TGF?, such that the antibody binds TGF? in a complex with LTBP presenting molecules, e.g., LTBP1 and/or LTBP3. Thus, such pharmaceutical compositions may be administered to patients for alleviating a TGF?-related indication (e.g., fibrosis) associated with TGF?1 activation/release from LTBP1 and/or LTBP3.

    [0359] A pharmaceutically acceptable carrier (excipient) means that the carrier is compatible with the active ingredient of the composition (and preferably, capable of stabilizing the active ingredient) and not deleterious to the subject to be treated. Examples of pharmaceutically acceptable excipients (carriers), including buffers, would be apparent to the skilled artisan and have been described previously. See, e.g., Remington: The Science and Practice of Pharmacy 20th Ed. (2000) Lippincott Williams and Wilkins, Ed. K. E. Hoover. In one example, a pharmaceutical composition described herein contains more than one antibody that selectively binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex, where the antibodies recognize different epitopes/residues of the LTBP1-TGF?1 complex and/or LTBP3-TGF?1 complex.

    [0360] The pharmaceutical compositions to be used in the present methods can comprise pharmaceutically acceptable carriers, excipients, or stabilizers in the form of lyophilized formulations or aqueous solutions (Remington: The Science and Practice of Pharmacy 20th Ed. (2000) Lippincott Williams and Wilkins, Ed. K. E. Hoover). Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations used, and may comprise buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrans; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as TWEEN?, PLURONICS? or polyethylene glycol (PEG). Pharmaceutically acceptable excipients are further described herein.

    [0361] In some examples, the pharmaceutical composition described herein comprises liposomes containing an antibody that selectively binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex, which can be prepared by any suitable method, such as described in Epstein et al., Proc. Natl. Acad. Sci. USA 82:3688 (1985); Hwang et al. Proc. Natl. Acad. Sci. USA 77:4030 (1980); and U.S. Pat. Nos. 4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S. Pat. No. 5,013,556. Particularly useful liposomes can be generated by the reverse phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.

    [0362] The antibodies that selectively bind a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions. Exemplary techniques have been described previously, see, e.g., Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing (2000).

    [0363] In other examples, the pharmaceutical composition described herein can be formulated in sustained-release format. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g. films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and 7 ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT? (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), sucrose acetate isobutyrate, and poly-D-(?)-3-hydroxybutyric acid.

    [0364] The pharmaceutical compositions to be used for in vivo administration must be sterile. This is readily accomplished by, for example, filtration through sterile filtration membranes. Therapeutic antibody compositions are generally placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.

    [0365] The pharmaceutical compositions described herein can be in unit dosage forms such as tablets, pills, capsules, powders, granules, solutions or suspensions, or suppositories, for oral, parenteral or rectal administration, or administration by inhalation or insufflation.

    [0366] For preparing solid compositions such as tablets, the principal active ingredient can be mixed with a pharmaceutical carrier, e.g., conventional tableting ingredients such as corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other pharmaceutical diluents, e.g., water, to form a solid preformulation composition containing a homogeneous mixture of a compound of the present disclosure, or a non-toxic pharmaceutically acceptable salt thereof. When referring to these preformulation compositions as homogeneous, it is meant that the active ingredient is dispersed evenly throughout the composition so that the composition may be readily subdivided into equally effective unit dosage forms such as tablets, pills and capsules. This solid preformulation composition is then subdivided into unit dosage forms of the type described above containing from 0.1 mg to about 500 mg of the active ingredient of the present disclosure. The tablets or pills of the novel composition can be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged action. For example, the tablet or pill can comprise an inner dosage and an outer dosage component, the latter being in the form of an envelope over the former. The two components can be separated by an enteric layer that serves to resist disintegration in the stomach and permits the inner component to pass intact into the duodenum or to be delayed in release. A variety of materials can be used for such enteric layers or coatings, such materials including a number of polymeric acids and mixtures of polymeric acids with such materials as shellac, cetyl alcohol and cellulose acetate.

    [0367] Suitable surface-active agents include, in particular, non-ionic agents, such as polyoxyethylenesorbitans (e.g. TWEEEN? 20, 40, 60, 80 or 85) and other sorbitans (e.g. SPAN? 20, 40, 60, 80 or 85). Compositions with a surface-active agent will conveniently comprise between 0.05 and 5% surface-active agent, and can be between 0.1 and 2.5%. It will be appreciated that other ingredients may be added, for example mannitol or other pharmaceutically acceptable vehicles, if necessary.

    [0368] Suitable emulsions may be prepared using commercially available fat emulsions, such as INTRALIPID?, LIPSYN?, INFONUTROL?, LIPOFUNDIN? and LIPIPHYSAN?. The active ingredient may be either dissolved in a pre-mixed emulsion composition or alternatively it may be dissolved in an oil (e.g. soybean oil, safflower oil, cottonseed oil, sesame oil, corn oil or almond oil) and an emulsion formed upon mixing with a phospholipid (e.g. egg phospholipids, soybean phospholipids or soybean lecithin) and water. It will be appreciated that other ingredients may be added, for example glycerol or glucose, to adjust the tonicity of the emulsion. Suitable emulsions will typically contain up to 20% oil, for example, between 5 and 20%.

    [0369] The emulsion compositions can be those prepared by mixing an antibody that selectively binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex with INTRALIPID? or the components thereof (soybean oil, egg phospholipids, glycerol and water).

    [0370] Pharmaceutical compositions for inhalation or insufflation include solutions and suspensions in pharmaceutically acceptable, aqueous or organic solvents, or mixtures thereof, and powders. The liquid or solid compositions may contain suitable pharmaceutically acceptable excipients as set out above. In some embodiments, the compositions are administered by the oral or nasal respiratory route for local or systemic effect.

    [0371] Compositions in preferably sterile pharmaceutically acceptable solvents may be nebulized by use of gases. Nebulized solutions may be breathed directly from the nebulizing device or the nebulizing device may be attached to a face mask, tent or intermittent positive pressure breathing machine. Solution, suspension or powder compositions may be administered, preferably orally or nasally, from devices which deliver the formulation in an appropriate manner.

    TGF? Inhibitors Suitable for Therapeutic Use

    [0372] According to aspects described herein, the disclosure provides improved TGF? inhibitors and methods of choosing therapeutically effective TGF? inhibitors that can selectively target matrix-associated proTGF? complexes. The isoform-selective inhibitors of TGF?1 activation have advantageous features for the treatment of fibrosis, e.g., lung fibrosis (e.g., idiopathic pulmonary fibrosis (IPF)), kidney fibrosis (e.g., Alport syndrome), or muscle fibrosis (e.g., muscle fibrosis in Duchene's muscular dystrophy (DMD), which has clinical and preclinical evidence for LTBP involvement). The isoform-selective inhibitors of TGF?1 activation have advantageous features for the treatment of fibrosis when the fibrotic condition involves extracellular matrix dysregulation.

    [0373] The methods disclosed and claimed herein are based on in vivo data from preclinical fibrosis models, which demonstrate surprisingly effective therapeutic results such as reduction in the amount of collagen present in a fibrotic tissue, reduction in the amount of new collagen synthesis, and/or reduction in the amount of phosphorylated Smad2 in a fibrotic tissue. Moreover, the disclosure provides therapeutic dosing strategies, including a loading/maintenance dosing strategy demonstrated to be surprisingly therapeutically effective in vivo. The methods described herein provide a strong basis for a dosage determination and administration schedule for the isoform-selective inhibitors of TGF?1 activation, which can be confirmed further in human clinical trials.

    Use of Inhibitors that Selectively Bind a LTBP1/3-TGF?1 Complex

    [0374] The inhibitors, e.g., antibodies and antigen binding fragments thereof, described herein that selectively bind a LTBP1/3-TGF?1 complex can be used in a wide variety of applications in which modulation of TGF?1 activity associated with LTBP1 or LTBP3 is desired.

    [0375] In one embodiment, the disclosure provides a method of inhibiting TGF?1 activation by exposing a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex to an inhibitor, e.g., antibody, or antigen binding portion thereof, which selectively binds a LTBP1/3-TGF?1 complex. The foregoing method can be performed in vitro, e.g., to inhibit TGF?1 activation in cultured cells. The foregoing method can also be performed in vivo, e.g., in a subject in need of TGF?1 inhibition, or in an animal model in which the effect of TGF?1 inhibition is to be assessed.

    [0376] Any inhibitor, e.g., an antibody, or an antigen binding fragment thereof, described herein which selectively binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex, and any pharmaceutical composition comprising such antibody, is suitable for use in the methods of the disclosure. For example, in one embodiment, the inhibitor, e.g., antibody, or antigen-binding portion thereof, selectively binds to a LTBP1-TGF?1 complex and a LTBP3-TGF?1 complex, but does not bind to one or more targets selected from LTBP1 alone, mature TGF?1 alone, a GARP-TGF?1 complex, a LRRC33-TGF?1 complex, and combinations thereof. Exemplary inhibitor, e.g., antibodies, can inhibit the release of mature TGF?1 from a LTBP1-proTGF?1 complex and/or a LTBP3-proTGF?1 complex, without inhibiting the release of mature TGF?1 from a GARP-proTGF?1 complex and/or a LRRC33-proTGF?1 complex.

    [0377] The antibody, or antigen-binding portion thereof, can, in some embodiments, bind a LTBP1-proTGF?1 complex and/or a LTBP3-proTGF?1 complex with a dissociation constant (K.sub.D) of about 10-6 M or less, 10-7 M or less, 10-8 M or less. In one embodiment, the antibody, or antigen binding portion thereof, comprises at least one (e.g., one, two, or three) heavy chain CDRs shown in Table 5, and/or at least one (e.g., one, two, three) light chain CDRs shown in Table 5. In an exemplary embodiment, the antibody, or antigen binding portion thereof, comprises a heavy chain variable region comprising SEQ ID NO:7, and/or a light chain variable region comprising SEQ ID NO:8. Antibodies and antigen binding fragment thereof which bind the same epitope as the foregoing antibodies, and/or which compete for binding with the foregoing antibodies to LTBP1/3-proTGF?1, are also useful in the methods described herein. Additional features of the antibodies, or antigen-binding fragment thereof, that are suitable for practicing the methods of the disclosure are described herein.

    [0378] In one embodiment, contacting a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex with the inhibitor, e.g., antibody, or antigen binding portion thereof, inhibits the release of mature TGF?1 from the LTBP1-TGF?1 complex and/or the LTBP3-TGF?1 complex. In one embodiment, said contacting does not inhibit the release of mature TGF?1 from presenting molecules other than LTBP1 and LTBP3. For example, exposing a GARP-TGF?1 complex or a LRRC33-TGF?1 complex to a context-specific inhibitor, e.g., antibody, that selectively binds LTBP1/3-TGF?1 but does not bind TGF?1 in the context of GARP or LRRC33 will not inhibit the release of mature TGF?1 from the GARP-TGF?1 complex or the LRRC33-TGF?1 complex. LTBP1 and LTBP3 are generally deposited in the extracellular matrix. Accordingly, in one embodiment, complexes comprising LTBP1-TGF?1 and/or LTBP3-TGF?1 are associated with the extracellular matrix, e.g., bound to the extracellular matrix. In some embodiments, the LTBP1/3-TGF?1 complexes are bound to extracellular matrix comprising fibrillin, and/or a protein containing an RGD motif.

    [0379] The disclosure also provides a method of reducing TGF?1 activation in a subject, by administering to the subject an inhibitor, e.g., antibody, or antigen binding portion thereof, which selectively binds a LTBP1/3-TGF?1 complex, as described herein. Any antibody, or antigen binding portion thereof, described herein which selectively binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex, and any pharmaceutical composition comprising such antibody, is suitable for use in the methods of the disclosure.

    [0380] Exemplary LTBP1/3 inhibitors, e.g., antibodies, bind a LTBP1/3-TGF?1 complex, and inhibit TGF?1 activation in a context-specific manner, by inhibiting release of TGF?1 presented by LTBP1 and LTBP3, without inhibiting release of TGF?1 presented by GARP and/or LRRC33. Such antibodies are useful for blocking a particular subset of TGF?1 activity in vivo. In one embodiment, the context-specific antibodies provided herein can be used to inhibit TGF?1 localized to the extracellular matrix.

    [0381] In another embodiment, the context-specific antibodies can inhibit TGF?1 without modulating TGF?1-associated immune activity or immune response, which is primarily mediated by TGF?1 presented by GARP and LRRC33. In another embodiment, the context-specific antibodies can be used to inhibit TGF?1 activity associated with the extracellular matrix (e.g., LTBP1-associated TGF?1 activity and LTBP3-associated TGF?1 activity) without modulating TGF?1 activity associated with hematopoietic cells, e.g., hematopoietic cells that express GARP and/or LRRC33.

    Possible Effects of TGF?2 and/or TGF?3 Inhibition

    [0382] Traditional approach to TGF? inhibition has been to block multiple isoforms of TGF? (i.e., TGF?1, TGF?2 and TGF?3, or at least two of the three isoforms), based at least on the assumption that it would be necessary to do so in order to achieve efficacy, given that all three isoforms signal through the same receptors. However, Applicant's recent observations in murine fibrosis models suggest detrimental effects of TGF?3 inhibition in tissues with dysregulated ECM, raising the possibility that role of TGF?3 expands beyond homeostasis. Applicant previously found that TGF?1-selective inhibitors are capable of mitigating fibrosis in multiple preclinical models, including mouse liver fibrosis model where both the TGF?1 and TGF?3 isoforms are expressed in fibrotic liver tissue, albeit in discrete cell types. Surprisingly, inhibition of TGF?3 promoted pro-fibrotic phenotypes. The exacerbation of fibrosis was observed when the TGF?3 inhibitor was used alone. Furthermore, when used in combination with a TGF?1-selective inhibitor, the TGF?3-selective inhibitor attenuated the anti-fibrotic effect of the TGF?1 inhibitor, indicating that TGF?3 may counteract the anti-fibrotic effects of TGF?1 and that inhibition of TGF?3 is in fact detrimental for the treatment of fibrosis. These observations point to isoform-selective inhibition of TGF?1 as the preferred approach in treating fibrosis.

    [0383] In addition to the possible concerns of inhibiting TGF?3 addressed above, Takahashi et al., (Nat Metab. 2019, 1(2): 291-303) recently reported a beneficial role of TGF?2 in regulating metabolism. The authors identified TGF?2 as an exercise-induced adipokine, which stimulated glucose and fatty acid uptake in vitro, as well as tissue glucose uptake in vivo; which improved metabolism in obese mice; and, which reduced high fat diet-induced inflammation. Moreover, the authors observed that lactate, a metabolite released from muscle during exercise, stimulated TGF?2 expression in human adipocytes and that a lactate-lowering agent reduced circulating TGF?2 levels and reduced exercise-stimulated improvements in glucose tolerance. These observations suggest that therapeutic use of a TGF? inhibitor with inhibitory activity towards the TGF?2 isoform may be harmful, at least in the metabolic aspect.

    [0384] Accordingly, the present disclosure provides a TGF? inhibitor for use in the treatment of a TGF?-related indication (e.g., fibrosis) in a subject, wherein, the TGF? inhibitor not only selectively inhibits TGF?1 but also in a context-specific manner, e.g., TGF?1 associated with LTBP1 and/or LTBP3 in the extracellular matrix, where it can provide anti-fibrotic effect without further aggravating inflammation of the tissue. In some embodiments, the subject benefits from improved metabolism, wherein optionally, the subject has or is at risk of developing a metabolic disease, such as obesity, high fat diet-induced inflammation, glucose or insulin dysregulation (e.g., type 1 diabetes and type 2 diabetes). In some embodiments, the TGF?-related indication is a fibrotic disorder involving inflammation. In preferred embodiments, the subject suffers from a condition in which regulatory T cells serve a positive role, such as dampening overstimulation of the immune system or preventing or attenuating autoimmunity. In some embodiments, LTBP-selective TGF?1 inhibitors are used in conjunction with a genotoxic therapy (such as radiation therapy and chemotherapy), or in a subject exposed to a genotoxic agent (such as radiation/irradiation and carcinogens), aimed to inhibit ROS-induced TGF?1 activation without depleting Tregs and immunosuppressive macrophages which are beneficial for reducing treatment-induced inflammation.

    Possible effects of TGF?2 and/or TGF?3 inhibition

    [0385] Traditional approach to TGF? inhibition has been to block multiple isoforms of TGF? (i.e., TGF?1, TGF?2 and TGF?3, or at least two of the three isoforms), based at least on the assumption that it would be necessary to do so in order to achieve efficacy, given that all three isoforms signal through the same receptors. However, Applicant's recent observations in murine fibrosis models suggest detrimental effects of TGF?3 inhibition in tissues with dysregulated ECM, raising the possibility that role of TGF?3 expands beyond homeostasis. Applicant previously found that TGF?1-selective inhibitors are capable of mitigating fibrosis in multiple preclinical models, including mouse liver fibrosis model where both the TGF?1 and TGF?3 isoforms are expressed in fibrotic liver tissue, albeit in discrete cell types. Surprisingly, inhibition of TGF?3 promoted pro-fibrotic phenotypes. The exacerbation of fibrosis was observed when the TGF?3 inhibitor was used alone. Furthermore, when used in combination with a TGF?1-selective inhibitor, the TGF?3-selective inhibitor attenuated the anti-fibrotic effect of the TGF?1 inhibitor, indicating that TGF?3 may counteract the anti-fibrotic effects of TGF?1 and that inhibition of TGF?3 is in fact detrimental for the treatment of fibrosis. These observations point to isoform-selective inhibition of TGF?1 as the preferred approach in treating fibrosis.

    Clinical Applications of Context-Specific Inhibitors of L TBP1-Associated and/or LTBP3-Associated TGF?1

    [0386] Applicant previously described so-called context-independent inhibitors of TGF?1 (see, for example: PCT/US2017/021972, PCT/US2018/012601, PCT/US2019/041390 and PCT/US2019/041373) which may be useful for treating various diseases and disorders involving TGF?1 dysregulation, including, but are not limited to, cancer and fibrosis. Unlike traditional TGF?1 antagonists, these context-independent TGF?1 inhibitors are capable of selectively targeting the TGF?1 isoform. Within the multifaceted biological functions driven by the TGF?1 isoform, however, the context-independent inhibitors do not discriminate among tissue-specific (thus context-specific) proTGF?1 complexes, such that such inhibitors are capable of binding and thereby inhibiting release of mature growth factor from any of the presenting molecule-proTGF?1 complexes (e.g., LTBP1-proTGF?1, LTBP3-proTGF?1, GARP-proTGF?1 and LRRC33-proTGF?1).

    [0387] Based at least in part on the recognition that it may be advantageous to provide even greater selectivity in targeting only a subset of TGF?1 activities, context-selective inhibitors of the present disclosure have been generated. It is contemplated that by further fine-tuning particular biological contexts in which to inhibit TGF?1 function, greater safety and efficacy may be achieved in a subset of disease conditions or patient populations. Specifically, the inventors of the present disclosure have recognized that in certain conditions, systemic perturbation of immune regulation may be particularly undesirable. Because TGF?1 plays an important role in mediating immune response and maintaining immune homeostasis, broad inhibition of TGF?1 activities effectuated in a context-independent manner may lead to unwanted side effects without justifiable benefits. In these circumstances, it is envisaged that it is advantageous to specifically target and inhibit matrix-associated TGF?1 function using a context-selective inhibitor, such as those encompassed herein, which does not inhibit the immune components of TGF?1 function. Thus, this approach may be particularly advantageous in situations where regulatory T cells and/or immunosuppressive macrophages (such as M2-type) serve a protective role to reduce inflammation and/or autoimmunity. In some embodiments, the inflammation is triggered by a tissue repair response. In some embodiments, the inflammation is triggered by oxidative stress associated with reactive oxygen species (ROS).

    [0388] Accordingly, the context-specific antibodies can be used to inhibit LTBP1/3-associated TGF?1 activity in applications in which TGF?1 activation in the context of LTBP1 or LTBP3 is desirable, and in which TGF?1 activation in the context of GARP and/or or LRRC33 is detrimental.

    Rationale for the Development of Matrix-Targeted TGF?1 Inhibitors that do not Inhibit GARP-Associated TGF?1

    [0389] The disclosure includes therapeutic use of potent context-specific inhibitors of LTBP1-associated and/or LTBP3-associated TGF?1. Such inhibitors therefore are capable of specifically targeting the ECM-associated latent TGF?1 complexes (e.g., LTBP1-proTGF?1 and/or LTBP3-proTGF?1) thereby inhibiting the release of mature TGF?1 growth factor from the latent complex at disease environments, e.g., fibrotic tissues. Such inhibitors preferably show no significant binding activities towards a GARP-proTGF?1 complex, thereby minimizing unwanted systemic immune modulations. To that end, use of TGF?1 inhibitors that selectively and potently target extracellular matrix-associated TGF?1 (e.g., LTBP1-proTGF?1 and LTBP3-proTGF?1 complexes) is considered advantageous as a therapy to treat fibrosis involving inflammation.

    [0390] At least three rationales for supporting potential benefits of a TGF?1 inhibitor that does not target the GARP-proTGF?1 complex expressed on regulatory T cells are discussed below.

    [0391] First, GARP-expressing T regulatory cells are a component of the immune system that suppress or dampen immune responses of other cells. This notion may be referred to as tolerance. This is an important self-check built into the immune system to prevent excessive reactions that in some situations can result in life-threatening conditions, such as sepsis, cytokine release syndrome and cytokine storm. TGF?1 inhibition therapies that exert Treg-inhibitory effects may, therefore, pose certain risk when the normal Treg function is impaired, particularly for a prolonged duration of time, e.g., therapeutic regimen involving treatment of six months or longer, and chronic treatment that is administered for an indefinite period of time. For this reason, patients in need of TGF?1 inhibition therapies, particularly to avoid the risk of eliciting autoimmunity, may benefit from TGF?1 inhibitors that do not directly perturb the normal Treg function. For example, patient populations in need of a long-term TGF?1 inhibition therapy may include those with genetic or congenital conditions, such as DMD, CF and others. In addition, patient populations that suffer from conditions that include inflammation may benefit from a context-specific inhibitor that does not perturb the GARP/Treg function so as to minimize the risk of exacerbating the existing inflammatory conditions.

    [0392] Second, increasing evidence points to a link between disproportionate Th17/Treg ratios and pathologies involving inflammation and/or fibrosis. It is generally accepted that the differentiation of the two cell types, Th17 and Treg, is negatively regulated with an inverse relationship. TGF?1 appears to be a master gatekeeper of this process, such that, TGF?1 exposure promotes na?ve T cells to differentiate into Foxp3+ Tregs, whereas TGF?1 in combination with IL-6, promotes na?ve T cells to differentiate into ROR?t+Th17 cells instead. In addition, once differentiated, these cell populations negatively regulate each other.

    [0393] Lines of evidence suggest that an imbalance in Th17/Treg ratios correlates with the pathogenesis and/or progression of fibrotic conditions involving chronic inflammation, or severity thereof.

    [0394] For example, Shoukry et al. reported that Th17 cytokines drive liver fibrosis by regulating TGF? signaling. The authors examined ex vivo the frequency of Th17 and Treg populations in liver biopsy samples and found that increased Th17/Treg ratio correlated with advanced fibrosis, as compared to moderate fibrosis or healthy tissue samples. Consistent with the observation, a strong bias towards Th17 cytokines, IL-22 in particular, was also detected in fibrotic livers. These data suggest that increased Th17/Treg ratios lead to an imbalance in pro-fibrotic Th17 cytokines, which correlate with severity of liver fibrosis.

    [0395] Similarly, Rau et al. reported that progression from NAFLD to NASH is marked by a higher frequency of Th17 cells in the liver and an increased Th17/Treg ratio in peripheral blood and in the liver (J. Immunol 2016, 196: 97-105).

    [0396] Similar inverse correlations of Th17 and Treg populations are observed in other diseases.

    [0397] For example, increased muscle expression of IL-17 has been reported in patients with Duchenne muscular dystrophy (DMD), which is a condition that manifests chronic inflammation. De Pasquale et al. (Neurology 78(17): 1309-14) found that DMD muscle biopsy samples contained higher levels of IL-17 (a Th17 marker) and lower levels of Foxp3 (a Treg marker) mRNA compared to control. Elevations in other proinflammatory cytokines, such as TNF-? and MCP-1, were also observed and were found to be associated with worse clinical outcome of patients. The authors concluded that the data point to a possible pathogenic role of IL-17.

    [0398] Similarly, Jamshidian et al. (J Neuroimmunol 2013, 262(1-2): 106-12) reported biased Treg/Th17 balance away from regulatory toward inflammatory phenotype in patients with relapsed multiple sclerosis and its correlation with severity of clinical symptoms.

    [0399] A role of regulatory T cells is also implicated in the pathogenesis of cystic fibrosis (CF). In particular, CF lungs affected by the disease are associated with exaggerated Th17 and Th2 cell responses, indicative of a classic inflammatory phenotype, but also with a deficiency in numbers or function (i.e., impairment) of Treg cells (McGuire (2015) Am J Respir Crit Care Med 191(8): 866-8).

    [0400] Furthermore, Zhuang et al. (Scientific Reports (2017) 7: 40141) found imbalance of Th17/Treg cells in patients with acute anterior uveitis (anterior segment intraocular inflammation with the positive of human class I major histocompatibility complex), in which both a marked increase in Th17 cells and a marked decrease in Treg cells were seen.

    [0401] Taken together, the inventors of the present disclosure recognized that what appears to be a common feature in these various diseases associated with elevated Th17/Treg ratios is that the patient suffers from a fibrotic condition accompanied by an inflammatory component.

    [0402] Thus, it is envisaged in the present disclosure that TGF?1 inhibition therapy that spares the Treg/GARP-arm of the TGF?1 function may be particularly advantageous for an effective treatment of diseases characterized by an elevated level of Th17/Treg ratios. In this way, the context-selective inhibitors of TGF?1 according to the disclosure are aimed to avoid more systemic effects of TGF?1 inhibition that may interfere with Treg function, which may lead to exacerbation of existing fibrotic/inflammatory conditions in patients. Thus, the isoform-specific, matrix-targeted TGF?1 inhibitors described herein are used in a method for treating a patient who has or at risk of developing a fibrotic disorder that comprises inflammation. In some embodiments, the patient has an elevated Th17-to-Treg cell ratio. In some embodiments, the elevated Th17/Treg ratio may be predominantly caused by an increased number of Th17 cells, while in other embodiments, the elevated Th17/Treg ratio may be predominantly caused by a decreased number of Treg cells in the patient (or a biological sample collected from the patient). Yet in further embodiments, the elevated Th17/Treg ratio may be caused by a combination of an increased number of Th17 cells and a decreased number of Treg cells. In some embodiments, elevated levels of IL-17 and/or IL-22 detected in patients (or measured in samples collected from the patients) are also indicative of fibrotic conditions accompanied by chronic inflammation. Such patients may be therefore selected as candidates for receiving a context-selective TGF?1 inhibitor therapy disclosed herein.

    [0403] The third line of reasoning for keeping the GARP-TGF?1 axis intact in a TGF?1 inhibition therapy relates to the benefit of maintaining normal Treg function. As mentioned, GARP is expressed on the cell surface of Tregs and are thought to play a role in TGF?1-mediated immunomodulation. Because Tregs are indispensable for immune homeostasis and the prevention of autoimmunity, unnecessary perturbation of which may put certain patient populations at higher risk of, for example, infections (reviewed, for example, by: Richert-Spuhler and Lund (2015) Prog Mol Biol Transl Sci. 136:217-243).

    [0404] And finally, a further line of reasoning for keeping the GARP-TGF?1 axis intact in a TGF?1 inhibition therapy is that regulatory T cells function as a break to modulate or dampen over-reactive immune response. The discovery of Foxp3 as the master regulator of Treg cell development and function was critical for the understanding of Treg cell biology. Inactivating mutations in Foxp3 result in the spontaneous development of severe autoimmunity with a scurfy phenotype in mice and IPEX syndrome (immune dysregulation, polyendocrinopathy, enteropathy, X-linked) in humans (see Dominguez-Villear and Haler, Nature Immunology 19, 665-673, 2018). Thus, it raises the possibility that TGF?1 therapy that elicits inhibitory effects of the Treg/GARP arm of TGF?1 function, especially in a prolonged treatment, may cause or exacerbate autoimmune response.

    [0405] Increasing evidence suggests that Tregs not only act to dampen overexuberant effector immune responses, they also have the ability to potentiate appropriate immune responses to pathogens, by participating in pathogen clearance and protection of the host from collateral damage. Such diverse function of Treg cells is particularly apparent in delicate tissues such as the lung, which is constantly exposed to an external environment from which a variety of pathogens and other foreign components (e.g., viral pathogens, bacterial pathogens, fungal pathogens, and allergens) may gain access to host cells.

    [0406] For example, influenza virus infection elicits a strong proinflammatory cytokine response with abundance immune cell infiltration. In acute and/or severe infections, such response can cause serious sequelae in susceptible individuals. Tregs provide a mechanism for dampening viral infection-associated pathology by controlling the magnitude of immune response in the host. Indeed, pathogen-exposed Tregs retain protective effects in adoptive transfer. Moreover, such adoptive transfer of primed Tregs have been shown to ameliorate influenza virus-associated morbidity and to prolong survival in severe immunocompromised animal models.

    [0407] Accordingly, the disclosure provides use of an ECM-targeted, context-selective TGF?1 inhibitor (e.g., LTBP1-selective or LTBP1/3-selective inhibitors of TGF?1 activation inhibitors) for the treatment of a disease that involves matrix-associated TGF?1 dysregulation in a subject. The subject is suffering from or at risk of an infection. The infection can be viral infections (e.g., influenza virus, respiratory syncytial virus or RSV, human immunodeficiency virus or HIV, MARS, SARS, herpes simplex virus or HSV, hepatitis A virus or HAV, hepatitis B virus or HBV, hepatitis C virus or HCV, CMV, Dengue virus, lymphocytic choriomeningitis virus, and West Nile virus), bacterial infections (meningitis, Mycobacterium tuberculosis, Listeria monocytogenes, Citrobacter rodentium, Salmonella, and E. coli), and/or fungal infections (e.g., Candida, Pneumocytis, Aspergillus, Cryptococcus, and Coccidioides).

    [0408] Typically, high-risk or at-risk populations (individuals that are considered particularly susceptible to severe infections or infection-triggered responses) include pediatric populations (infants, young children, e.g., human individuals under the age of 7); elderly populations (those who are 65 years or older); those with compromised immune system due to medical condition, health status, life styles such as smoking, and/or medications with immunosuppressive effects, etc.

    [0409] For example, certain medications cause weakened immunity, such as chemotherapy, therapies that target hematopoietic cells such as CD33 therapy, steroids, immunosuppressants, and statins.

    [0410] In some embodiments, high-risk or at-risk populations are those with existing medical conditions, such as those with chronic infections such as HIV, those with bone marrow transplantation, pre-diabetic individuals, diabetic individuals, those with autoimmune disorders such as RA, asthma and allergy.

    [0411] Thus, matrix-targeted, context-selective TGF?1 inhibitors encompassed herein may be particularly advantageous for treating patients who require a long-term or chronic TGF?1 therapy since in these scenarios it is beneficial to avoid impairment of immune homeostasis and the normal immune function that provides the ability to respond effectively to possible infections caused by a variety of pathogens such as those listed above.

    [0412] Accordingly, antibodies, and antigen binding fragment thereof, that selectively bind LTBP-TGF?1 (e.g., LTBP1-TGF?1 and LTBP3-TGF?1), and that do not inhibit TGF?1 in the context of the immune-associated TGF?1 presenters GARP and LRRC33, are therapeutic candidates for the treatment of fibrotic indications such as organ fibrosis, and are aimed to avoid TGF?-related global immune activation. In one embodiment, the context-specific antibodies can be used to inhibit LTBP1/3-associated TGF?1 activity in applications in which TGF?1-mediated immune suppression is beneficial, e.g., in a subject who has received a transplant, who is a candidate for receiving a transplant, or who is expected to receive a transplant. In some embodiments, the subject has an advanced stage fibrosis and/or a bone marrow disease.

    [0413] The foregoing methods can be used to treat a subject having a condition for which inhibition or reduction in LTBP-associated TGF?1 activity is beneficial. For example, the subject may have or be at risk for developing a disorder in which extracellular matrix-associated TGF?1 activity has been implicated.

    [0414] Integrin-mediated activation of latent TGF?1 in the extracellular matrix is a key contributor to fibrosis. Without wishing to be bound by theory, it is presently understood that integrins, including ?V?6 and ?V?8, can trigger the release of TGF?1 from presenting molecules including LTBP1 and LTBP3. Inhibiting release of TGF?1 in this context can reduce or eliminate fibrosis, and/or symptoms associated therewith.

    [0415] As described, LTBP1 and LTBP3 are produced and are deposited extracellularly as components of the ECM, where they can present a proTGF?1 complex (latent, inactive precursor of TGF?1) within the ECM. Upon stimulation, the LTBP1/3-proTGF?1 complex releases the TGF?1 growth factor (the active, mature form of growth factor) which in turn is thought to be involved in the regulation of the local tissue microenvironment, such as ECM maintenance/remodeling and the process of fibrosis, possibly by responding to various cytokines, chemokines and growth factors, and by interacting with other ECM components, such as fibronectin, Fibrillin, collagen, elastin, and matrix metallopeptidases (MMPs).

    [0416] In the normal wound healing process that occurs in response to an injury, for example, TGF? is thought to facilitate granular tissue formation, angiogenesis, and collagen synthesis and production. TGF? signaling is also implicated in abnormal tissue fibrogenesis (i.e., fibrosis), which results in formation of excess fibrous connective tissue in an organ or tissue in a reparative or reactive process characterized by the pathological accumulation of extracellular matrix (ECM) components, such as collagens. In these and other situations, the TGF? axis may affect further aspects (in addition to fibrotic aspect), such as inflammation, recruitment and phenotypic switch of various cell types, which may be mediated by its interaction with one or more of the other presenting molecules, such as GARP/LRRC32 and LRRC33. In certain instances, it is advantageous to preferentially inhibit the LTBP1/3-context of TGF?1 activation, without significantly inhibiting one or more of the other contexts of TGF?1 activation, in situations where ECM-associated TGF?1 that drives fibrosis is to be selectively inhibited.

    [0417] Reactive oxygen species (ROS) has been reported to mediate TGF?1-induced activation of fibroblasts. A conserved methionine residue present only on the TGF?1 isoform, and not on TGF?2 and TGF?3 isoforms, may mediate this process. ROS-induced TGF?1 activation has been reported to cause an increased level of alpha-smooth muscle actin (?-SMA), which is a myofibroblast marker (reviewed, for example, in Zhao et al., Signal Transduction and Targeted Therapy (2022) 7:206). Kraaij et al reported that macrophage-derived ROS caused Treg induction which protected mice from autoimmune conditions such as arthritis (PNAS (2010), 107(41): 17686-17691). These observations raise a possible benefit of sparing TGF?1 signaling associated with LRRC33-expressing macrophages.

    Therapeutic Use of LTBP-Selective TGF?1 Inhibitors

    [0418] According to the present disclosure, a LTBP-selective TGF?1 inhibitor is used in the treatment of tissue or organ lesions caused by tissue-damaging agents, such as chemical agents, toxic metabolites, hypoxia, ROS, and metabolic dysregulation. Repeated, prolonged, or chronic exposure to such tissue-damaging agents can cause progressive deterioration of the affected organ, typically characterized by initial repair responses (e.g., immune responses) followed by fibrogenesis that accompany hardening of the tissue, and ultimately leading to organ failure. It is therefore contemplated that the LTBP-selective approach of TGF?1 inhibition described herein may serve dual purposes of i) normalizing the ECM function by reducing collagen deposits (e.g., anti-fibrotic effect); and, ii) maintaining the immunosuppressive axis of the TGF?1 pathway (e.g., GARP-proTGF?1 and LRRC33-proTGF?1).

    [0419] Accordingly, in one embodiment, the disclosure provides a method of reducing TGF?1 activation in a subject having, or at risk of developing, a fibrotic disorder by administering to the subject an antibody, or antigen binding portion thereof, which selectively binds a LTBP1/3-TGF?1 complex, as described herein. In another embodiment, the disclosure provides a method of treating a fibrotic disorder by administering to the subject an antibody, or antigen binding portion thereof, which selectively binds a LTBP1/3-TGF?1 complex, as described herein. Such methods are particularly advantageous for the treatment of a disease involving both fibrosis and inflammation, such as those included below. With any of the therapeutic use disclosed herein, in preferred embodiments, the LTBP-selective TGF?1 inhibitor for use is Ab42 or a variant thereof. In other embodiments, the LTBP-selective TGF?1 inhibitor for use is an antibody or antigen-binding fragment thereof that competes antigen binding with Ab42, wherein optionally, the antibody or the fragment binds an epitope comprising one or more residues of the N-terminal stretch of amino acids DMELVKRKRIEAIR (SEQ ID NO: 46) within the so-called alpha-1 helix region of the prodomain of the latent proTGF?1 complex, wherein the antibody is not Ab42. In some embodiments, the antibody or the fragment contacts one or more of the following residues within the prodomain: Asp27 (D); Leu30 (L); Arg33 (R); Ile36 (I); Glu37 (E) (shown in bold above). Additionally or alternatively, in some embodiments, the inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the amino acid sequence YIDFRKDLGWK (SEQ ID NO: 93) within the TGF?1 growth factor domain (e.g., the finger-1 domain), wherein the antibody is not Ab42. In some embodiments, the antibody or fragment thereof contacts one or more of the following residues: Tyr289 (Y); Lys294 (K); Asp295 (D) (shown in bold above). In some embodiments, such antibody binds a conformational epitope comprising one or more residues of DMELVKRKRIEAIR (SEQ ID NO: 46) and one or more residues of YIDFRKDLGWK (SEQ ID NO: 93), wherein the antibody is not Ab42.

    [0420] In one embodiment, the subject has organ fibrosis, for example, kidney fibrosis (e.g., fibrosis associated with chronic kidney disease (CKD)), liver fibrosis (e.g., fibrosis associated with nonalcoholic steatohepatitis (NASH)), lung fibrosis (e.g., idiopathic pulmonary fibrosis (IPF)), cardiac fibrosis, and/or skin fibrosis (e.g., scleroderma). In one embodiment, the subject has desmoplasia.

    [0421] In some embodiments, the subject can have advanced organ fibrosis. For example, the subject may be in need of an organ transplant. In one embodiment, the subject may be in need of an organ transplant, and the compounds and compositions described herein are administered to prevent allograft fibrosis from developing in the subject following receipt of the transplant.

    [0422] A recent study examined whether inhibiting integrin ?V?6 could prevent TGF?-mediated allograft fibrosis after kidney transplantation (Lo et al., Am. J. Transplant. (2013), 13:3085-3093). Surprisingly, animals treated with an inhibitory anti-?V?6 antibody experienced a significant decrease in rejection-free survival compared to placebo animals. The authors conclude that this result cautions against TGF? inhibition in kidney transplantation, because the immunosuppressive properties of TGF? help prevent allograft rejection. The inhibitors, e.g., antibodies, and antigen binding fragment thereof, described herein advantageously inhibit activation of TGF?1 presented by LTBP1 or LTBP3 in the extracellular matrix, but do not inhibit activation of TGF?1 presented by GARP or LRRC33 on immune cells. Accordingly, the context-specific LTBP1/3-TGF?1 inhibitors, e.g., antibodies, described herein can prevent or reduce allograft fibrosis, without eliminating the immunosuppressive properties of TGF?1 that are useful for preventing allograft rejection. Accordingly, in one aspect, the disclosure provides a method for treating a fibrotic disorder in a subject, comprising administering to the subject a therapeutically effective amount of an inhibitor of TGF?1 signaling, wherein the inhibitor is a selective inhibitor of ECM-associated TGF?1; and, wherein the subject benefits from suppressed immunity. In one embodiment, the subject has a fibrotic condition and would benefit from an allograft transplant, or has received an allograft transplant.

    [0423] Additional fibrotic conditions for which antibodies and/or compositions of the present disclosure may be used therapeutically include, but are not limited to, lung indications (e.g. idiopathic pulmonary fibrosis (IPF), chronic obstructive pulmonary disorder (COPD), allergic asthma, cystic fibrosis (CF), acute lung injury, eosinophilic esophagitis, pulmonary arterial hypertension and chemical gas-injury), kidney indications (e.g., diabetic glomerulosclerosis, focal segmental glomeruloclerosis (FSGS), chronic kidney disease, fibrosis associated with kidney transplantation and chronic rejection, IgA nephropathy, and hemolytic uremic syndrome), liver fibrosis (e.g., non-alcoholic steatohepatitis (NASH), chronic viral hepatitis, parasitemia, inborn errors of metabolism, toxin-mediated fibrosis, such as alcohol fibrosis, non-alcoholic steatohepatitis-hepatocellular carcinoma (NASH-HCC), primary biliary cirrhosis, and sclerosing cholangitis), cardiovascular fibrosis (e.g., cardiomyopathy, hypertrophic cardiomyopathy, atherosclerosis and restenosis,) systemic sclerosis, skin fibrosis (e.g. skin fibrosis in systemic sclerosis, diffuse cutaneous systemic sclerosis, scleroderma, pathological skin scarring, keloid, post-surgical scarring, scar revision surgery, radiation-induced scarring and chronic wounds), eye-related conditions such as subretinal fibrosis, uveitis syndrome, uveitis associated with idiopathic retroperitoneal fibrosis, extraocular muscle fibrosis, eye diseases associated with the major histocompatibility complex (MHC class I) or histocompatibility antigens, and cancers or secondary fibrosis (e.g. myelofibrosis, head and neck cancer, M7 acute megakaryoblastic leukemia and mucositis). Other diseases, disorders or conditions related to fibrosis that may be treated using compounds and/or compositions of the present disclosure, include, but are not limited to Marfan's syndrome, stiff skin syndrome, scleroderma, rheumatoid arthritis, bone marrow fibrosis, Crohn's disease, ulcerative colitis, systemic lupus erythematosus, muscular dystrophy, (such as DMD), Dupuytren's contracture, Camurati-Engelmann disease, neural scarring, dementia, proliferative vitreoretinopathy, corneal injury, complications after glaucoma drainage surgery, and multiple sclerosis (MS). Many such fibrotic indications are also associated with inflammation of the affected tissue(s), indicating involvement of an immune component. Such inflammation may be accompanied by aberrant immune cell populations, such as increased numbers of Th17 cells, reduced numbers of Treg cells, and/or both. In each case, the affected patient may exhibit increased Th17/Treg cell ratios.

    [0424] In another aspect, the disclosure provides a method of selecting an isoform-specific TGF?1 inhibitor for the treatment of a fibrotic disorder in a subject, comprising: (a) determining whether the subject manifests clinical presentations including fibrosis and one or more of the following: (i) inflammation; (ii) immune suppression; (iii) proliferative dysregulation; (iv) need for an allograft transplant; (v) at risk of severe infection; (vi) in need of a long-term TGF?1 inhibition therapy; and (vii) manifestation of an autoimmune conditions(s); and (b) selecting an isoform-specific, context-dependent TGF?1 inhibitor or an isoform-specific, context-independent TGF?1 inhibitor for treatment of the fibrotic disorder based on the clinical presentations determined in step (a).

    [0425] In another aspect, the disclosure provides a method of treating a subject having a fibrotic disorder, comprising (a) selecting a treatment regimen comprising an isoform-specific TGF?1 inhibitor for the subject, said selection comprising (i) determining whether the fibrotic disorder manifests clinical presentations including fibrosis and one or more of the following: inflammation, immune suppression, proliferative dysregulation, and need for an allograft transplant; and (ii) selecting a treatment regimen comprising an isoform-specific, context-dependent TGF?1 inhibitor or an isoform-specific, context-independent TGF?1 inhibitor, based on the clinical presentations determined in step (i); and (b) administering the selected treatment regimen to the subject.

    [0426] In one embodiment of the foregoing aspects, the fibrotic disorder manifests clinical presentations comprising fibrosis, inflammation, immune suppression, and proliferative dysregulation. In an exemplary embodiment, the fibrotic disorder is myelofibrosis, and the selected isoform-specific TGF?1 inhibitor is an isoform-specific, context-independent TGF?1 inhibitor.

    [0427] In another embodiment, the fibrotic disorder manifests clinical presentations comprising fibrosis, inflammation, and need for an allograft transplant. In one embodiment, the fibrotic disorder manifests clinical presentations comprising fibrosis and inflammation. In another embodiment, the fibrotic disorder is a degenerative disease.

    [0428] In one embodiment, the fibrotic disorder manifests clinical presentations comprising immune suppression and proliferative dysregulation. In an exemplary embodiment, the fibrotic disorder is associated with a solid tumor, and the selected isoform-specific TGF?1 inhibitor is an isoform-specific LTBP1/3-specific inhibitor. In one embodiment, the solid tumor is a malignant tumor. In another embodiment, the tumor is a benign tumor. In one embodiment, the subject has desmoplasia, for example, pancreatic desmoplasia. In another embodiment, the subject has fibroids.

    [0429] In another aspect, the disclosure provides a method of treating a subject having a fibrotic disorder with an isoform-specific, LTBP1/3-specific TGF?1 inhibitor, comprising determining whether the fibrotic disorder manifests clinical presentations including fibrosis and the need for an allograft transplant; and administering an effective amount of an isoform-specific, LTBP1/3-specific TGF?1 inhibitor to the subject if the fibrotic disorder manifests fibrosis and the need for an allograft transplant.

    [0430] In one embodiment, the fibrotic disorder is an organ fibrosis, wherein optionally, the organ fibrosis is an advanced organ fibrosis. In a further embodiment, the organ fibrosis is selected from the group consisting of kidney fibrosis, liver fibrosis (hepatic fibrosis), lung fibrosis, cardiac fibrosis, pancreatic fibrosis, skin fibrosis, scleroderma (systemic sclerosis), muscle fibrosis, uterine fibrosis and endometriosis. In another further embodiment, the fibrotic disorder comprising chronic inflammation is a muscular dystrophy, multiple sclerosis (MS), or Cystic Fibrosis (CF). In a further embodiment, the muscular dystrophy is Duchenne muscular dystrophy (DMD). In another further embodiment, the MS comprises perivascular fibrosis. In a further embodiment, the lung fibrosis is idiopathic pulmonary fibrosis (IPF). In another further embodiment, the subject has chronic kidney disease (CKD). In another embodiment, the subject has nonalcoholic steatohepatitis (NASH).

    [0431] In exemplary embodiments, the fibrotic disorder is fibrosis, Alport syndrome, scleroderma, fibroids, desmoplasia, amyotrophic lateral sclerosis (ALS), or Duchenne muscular dystrophy (DMD).

    Diseases Involving Endothelial-to-Mesenchymal Transition (EndMT)

    [0432] Endothelial-to-mesenchymal transition (EndMT) is observed in vitro on exposure of endothelial cells to various tissue-damaging agents or conditions, such as TGF?, high glucose concentrations, radiation and hypoxia. TGF? is a key regulator of the endothelial-mesenchymal transition (EndMT) observed in normal development, such as heart formation. However, the same or similar phenomenon is also seen in many diseases, such as cancer stroma. In some disease processes, endothelial markers such as CD31 become downregulated upon TGF?1 exposure and instead the expression of mesenchymal markers such as FSP-1, ?-SMA and fibronectin becomes induced. Indeed, stromal CAFs may be derived from vascular endothelial cells. Thus, isoform-specific inhibitors of TGF?1, such as those described herein, may be used to treat a disease that is initiated or driven by EndMT. It is contemplated that LTBP-selective approach to inhibiting the TGF?1 signaling pathway is advantageous in controlling inflammation often associated with tissue/organ injury. In preferred embodiments, the isoform-selective activation inhibitor of TGF?1 is Ab42, a derivative thereof, or an engineered molecule comprising an antigen-binding fragment thereof.

    Disease Involving Epithelial-to-Mesenchymal Transition (EMT)

    [0433] EMT (epithelial mesenchymal transition) is the process by which epithelial cells with tight junctions switch to mesenchymal properties (phenotypes) such as loose cell-cell contacts. The process is observed in a number of normal biological processes as well as pathological situations, including embryogenesis, wound healing, cancer metastasis and fibrosis (reviewed in, for example, Shiga et al., (2015) Cancer-Associated Fibroblasts: Their Characteristics and Their Roles in Tumor Growth. Cancers, 7: 2443-2458). Generally, it is believed that EMT signals are induced mainly by TGF?. In preferred embodiments, the isoform-selective activation inhibitor of TGF?1 is Ab42, a derivative thereof, or an engineered molecule comprising an antigen-binding fragment thereof.

    [0434] Epithelial cells have also been proposed to give rise to myofibroblasts by undergoing the process of EMT in several fibrotic tissues such as kidney, lung and in the liver. EMT takes place when epithelial cells lose their cuboidal shape, lose the expression of adherence and tight junction proteins, which leads to weak cell-cell contacts and reorganization of their actin cytoskeleton; while the cells acquire the expression of mesenchymal proteins (fibronectin, vimentin, N-cadherin), they adopt a fibroblast-like architecture favoring cell migration and invasion. EMT is induced by many growth factors, among them TGF? being a very potent inducer, which regulate the expression and activity of several transcription factors known as EMT-TFs (Snail1/Snail, Snail2/Slug, ZEB1, ZEB2, Twist1/Twist and more) that are the responsible actors to execute the change in cell differentiation that is EMT. The gene and protein markers used to identify the generation of mesenchymal cells after EMT in the context of fibrosis are FSP1 (Fibroblast-specific protein 1), ?-SMA and collagen I along with vimentin and desmin, whose expression increases concomitant with a reduction in levels of expression of epithelial markers (E-cadherin and certain cytokeratins). Cells that co-express epithelial and mesenchymal markers represent an intermediate stage of EMT (reviewed by, for example: Caja et al., Int. J. Mol. Sci. 2018, 19(5), 1294).

    Disease Involving Proteases

    [0435] Activation of TGF? from its latent complex may be triggered by integrin in a force-dependent manner, and/or by proteases. Evidence suggests that certain classes of proteases may be involved in the process, including but are not limited to Ser/Thr proteases such as Kallikreins, chemotrypsin, elastases, plasmin, thrombin, as well as zinc metalloproteases of ADAM family such as ADAM 10 and ADAM 17, as well as MMP family, such as MMP-2, MMP-9 and MMP-13. MMP-2 degrades the most abundant component of the basement membrane, Collagen IV, raising the possibility that it may play a role in ECM-associated TGF?1 regulation. MMP-9 has been implicated to play a central role in tumor progression, angiogenesis, stromal remodeling and metastasis. Thus, protease-dependent activation of TGF?1 in the ECM may be important for treating certain fibrotic diseases.

    [0436] Kallikreins (KLKs) are trypsin- or chymotrypsin-like serine proteases that include plasma Kallikreins and tissue Kallikreins. The ECM plays a role in tissue homeostasis acting as a structural and signaling scaffold and barrier to suppress malignant outgrowth. KLKs may play a role in degrading ECM proteins and other components which may facilitate tumor expansion and invasion. For example, KLK1 is highly upregulated in certain breast cancers and can activate pro-MMP-2 and pro-MMP-9. KLK2 activates latent TGF?1, rendering prostate cancer adjacent to fibroblasts permissive to cancer growth. KLK3 has been widely studied as a diagnostic marker for prostate cancer (PSA). KLK3 may directly activate TGF?1 by processing plasminogen into plasmin, which proteolytically cleaves LAP. KLK6 may be a potential marker for Alzheimer's disease.

    [0437] Known activators of TGF?1, such as plasmin, TSP-1 and ?V?6 integrin, all interact directly with LAP. It is postulated that proteolytic cleavage of LAP may destabilize the LAP-TGF? interaction, thereby releasing active TGF?1. It has been suggested that the region containing 54-LSKLRL-59 (SEQ ID NO: 301) is important for maintaining TGF?1 latency. Thus, agents (e.g., antibodies) that stabilize the interaction, or block the proteolytic cleavage of LAP may prevent TGF? activation.

    [0438] Many of these proteases associated with pathological conditions (e.g., cancer) function through distinct mechanisms of action. Thus, targeted inhibition of particular proteases, or combinations of proteases, may provide therapeutic benefits for the treatment of conditions involving the protease-TGF? axis. Accordingly, it is contemplated that inhibitors (e.g., TGF?1 antibodies) that selectively inhibit protease-induced activation of TGF?1 may be advantageous in the treatment of such diseases (e.g., fibrosis and cancer). Similarly, selective inhibition of TGF?1 activation by one protease over another protease may also be preferred, depending on the condition being treated. In preferred embodiments, the isoform-selective activation inhibitor of TGF?1 is Ab42, a derivative thereof, or an engineered molecule comprising an antigen-binding fragment thereof.

    [0439] Plasmin is a serine protease produced as a precursor form called Plasminogen. Upon release, Plasmin enters circulation and therefore is detected in serum. Elevated levels of Plasmin appear to correlate with cancer progression, possibly through mechanisms involving disruption of the extracellular matrix (e.g., basement membrane and stromal barriers) which facilitates tumor cell motility, invasion, and metastasis. Plasmin may also affect adhesion, proliferation, apoptosis, cancer nutrition, oxygen supply, formation of blood vessels, and activation of VEGF (Didiasova et al., Int. J. Mol. Sci, 2014, 15, 21229-21252). In addition, Plasmin may promote the migration of macrophages into the tumor microenvironment (Philips et al., Cancer Res. 2011 Nov. 1; 71(21):6676-83 and Choong et al., Clin. Orthop. Relat. Res. 2003, 415S, S46-S58). Indeed, tumor-associated macrophages (TAMs) are well characterized drivers of tumorigenesis through their ability to promote tumor growth, invasion, metastasis, and angiogenesis.

    [0440] Plasmin activities have been primarily tied to the disruption of the ECM. However, there is mounting evidence that Plasmin also regulate downstream MMP and TGF beta activation. Specifically, Plasmin has been suggested to cause activation of TGF beta through proteolytic cleavage of the Latency Associated Peptide (LAP), which is derived from the N-terminal region of the TGF beta gene product (Horiguchi et al., J Biochem. 2012 October; 152(4):321-9), resulting in the release of active growth factor. Since TGF?1 may promote cancer progression, this raises the possibility that plasmin-induced activation of TGF? may at least in part mediate this process. In preferred embodiments, the isoform-selective activation inhibitor of TGF?1 is Ab42, a derivative thereof, or an engineered molecule comprising an antigen-binding fragment thereof.

    [0441] TGF?1 has also been shown to regulate expression of uPA, which is a critical player in the conversion of Plasminogen into Plasmin (Santibanez, Juan F., ISRN Dermatology, 2013: 597927). uPA has independently been shown to promote cancer progression (e.g., adhesion, proliferation, and migration) by binding to its cell surface receptor (uPAR) and promoting conversion of Plasminogen into Plasmin. Moreover, studies have shown that expression of uPA and/or plasminogen activator inhibitor-1 (PAI-1) are predictors of poor prognosis in colorectal cancer (D. Q. Seetoo, et al., Journal of Surgical Oncology, vol. 82, no. 3, pp. 184-193, 2003), breast cancer (N. Harbeck et al., Clinical Breast Cancer, vol. 5, no. 5, pp. 348-352, 2004), and skin cancer (Santibanez, Juan F., ISRN Dermatology, 2013: 597927). Thus, without wishing to be bound by a particular theory, the interplay between Plasmin, TGF?1, and uPA may create a positive feedback loop towards promoting cancer progression. Accordingly, inhibitors that selectively inhibit Plasmin-dependent TGF?1 activation may be particularly suitable for the treatment of cancers reliant on the Plasmin/TGF?1 signaling axis.

    [0442] Thrombin may be involved in the activation of GARP-associated TGF?1. Platelets are reported to express GARP-proTGF?1. Therefore, thrombin may mediate TGF?1 activation by targeting this axis in an integrin-independent manner.

    [0443] In one aspect of the disclosure, the isoform-specific inhibitors of TGF?1 described herein include inhibitors that can inhibit protease-dependent activation of TGF?1. In some embodiments, the inhibitors can inhibit protease-dependent TGF?1 activation in an integrin-independent manner. In some embodiments, such inhibitors can inhibit TGF?1 activation irrespective of the mode of activation, e.g., inhibit both integrin-dependent activation and protease-dependent activation of TGF?1. In some embodiments, the protease is selected from the group consisting of: serine proteases, such as Kallikreins, Chemotrypsin, Trypsin, Elastases, Plasmin, thrombin, as well as zinc metalloproteases (MMP family) such as MMP-2, MMP-9 and MMP-13.

    [0444] In some embodiments, the inhibitors can inhibit Plasmin-induced activation of TGF?1. In some embodiments, the inhibitors can inhibit Plasmin- and integrin-induced TGF?1 activation. In some embodiments, the inhibitors are monoclonal antibodies that specifically bind TGF?1. In some embodiments, the inhibitors can inhibit plasma kallikrein-induced activation of TGF?1. In some embodiments, the inhibitors can inhibit plasma kallikrein-induced and Plasmin-induced activation of TGF?1. In some embodiments, the inhibitors can inhibit Plasmin-induced, plasma kallikrein-induced and integrin-induced activation of TGF?1. In some embodiments, the inhibitors do not significantly inhibit integrin-induced activation of TGF?1 but inhibit protease-induced activation of TGF?1. In some embodiments, the antibody is a monoclonal antibody that specifically binds proTGF?1. In some embodiments, the antibody binds latent proTGF?1 thereby inhibiting release of mature growth factor from the latent complex. In some embodiments, the inhibitor of TGF?1 activation suitable for use in the method of inhibiting Plasmin-dependent activation of TGF?1 is any one of the isoform-specific inhibitors disclosed herein. In some embodiments, the inhibitor is an antibody or fragment thereof that binds an epitope that comprises one or more amino acid residues of VKRKRIEA (SEQ ID NO: 9) within the ?1 region of the LAP. In some embodiments, the inhibitor is an antibody or fragment thereof that binds an epitope that comprises one or more amino acid residues of DMELVKRKRIEAIR (SEQ ID NO: 46) within the ?1 region of the LAP. In preferred embodiments, the isoform-selective activation inhibitor of TGF?1 is Ab42, a derivative thereof, or an engineered molecule comprising an antigen-binding fragment thereof.

    Liver Fibrosis and Related Conditions

    [0445] Liver fibrosis is often a result of chronic liver injury and is the leading cause of mortality from chronic liver diseases. Examples of chronic liver diseases include but are not limited to: chronic infection with hepatitis virus (e.g., HBV and HCV), NAFLD, alcoholic liver diseases, and autoimmune liver diseases. These conditions can progress to advanced liver fibrosis and eventually to liver cirrhosis. NAFLD is a spectrum of hepatic diseases associated with metabolic and cardiovascular disorders, such as obesity, insulin resistance, hypertension, dyslipidemia and type 2 diabetes. NAFLD is characterized by increased liver fat content, typically with a threshold of >5%, in the absence of significant alcohol consumption (defined as 30 grams/day and 20 grams/day for men and women, respectively). NAFLD can progress to nonalcoholic steatohepatitis (NASH), which can then progress to cirrhosis. However, main cause of morbimortality is associated with the cardiometabolic aspects of the liver disease. As noted previously, certain immune cells, including regulatory T cells, may impact disease progression from NAFLD to NASH, such that Tregs may serve a protective role. Thus, it is advantageous to avoid suppressing of Tregs.

    [0446] Accordingly, a LTBP-selective TGF?1 inhibitor (such as those described herein) is used in the treatment of a liver disease in a subject, wherein the treatment comprises administration of the LTBP-selective TGF?1 inhibitor in an amount effective to treat the liver disease, wherein optionally the liver disease is selected from: non-alcoholic fatty liver disease (NAFLD), e.g., non-alcoholic fatty liver (NAFL) and non-alcoholic steatohepatitis (NASH), which may include: noncirrhotic NASH with liver fibrosis, liver cirrhosis, NASH with compensated cirrhosis, NASH with decompensated cirrhosis, liver inflammation with fibrosis, liver inflammation without fibrosis; stage 2 and 3 liver fibrosis, stage 4 fibrosis (NASH cirrhosis or cirrhotic NASH with fibrosis), primary biliary cholangitis (PBC) (formerly known as primary biliary cirrhosis), and/or primary sclerosing cholangitis (PSC). In some embodiments, the subject has obesity, metabolic syndrome, and/or type 2 diabetis.

    [0447] In preferred embodiments, the TGF?1 inhibitor is Ab42 or a variant thereof. Alternatively, in some embodiments, the TGF?1 inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the N-terminal stretch of amino acids DMELVKRKRIEAIR (SEQ ID NO: 46) within the so-called alpha-1 helix region of the prodomain of the latent proTGF?1 complex. In some embodiments, the antibody or the fragment contacts one or more of the following residues within the prodomain: Asp27 (D); Leu30 (L); Arg33 (R); Ile36 (I); Glu37 (E) (shown in bold above). Additionally or alternatively, in some embodiments, the inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the amino acid sequence YIDFRKDLGWK (SEQ ID NO: 93) within the TGF?1 growth factor domain (e.g., the finger-1 domain). In some embodiments, the antibody or fragment thereof contacts one or more of the following residues: Tyr289 (Y); Lys294 (K); Asp295 (D) (shown in bold above). In some embodiments, such antibody binds a conformational epitope comprising one or more residues of DMELVKRKRIEAIR (SEQ ID NO: 46) and one or more residues of YIDFRKDLGWK (SEQ ID NO: 93), wherein the antibody is not Ab42.

    [0448] Combination therapy or adjunct/add-on therapy may be considered to treat the liver disease, in which two or more therapeutic agents are used in conjunction to treat the disease, wherein the combination therapy or adjunct/add-on therapy comprises a LTBP-selective TGF?1 inhibitor.

    [0449] In some embodiments, the subject is further treated with one or more additional therapy/therapies aimed to address metabolic dysregulation associated with the liver disease. In some embodiments, the additional therapies comprise a myostatin pathway inhibitor. The myostatin pathway inhibitor may be any agent capable of suppressing myostatin signaling. In some embodiments, the myostatin pathway inhibitors useful for carrying out the present invention may be myostatin-selective inhibitors. In some embodiments, the inhibitors of the myostatin signaling pathway useful for carrying out the present invention may be myostatin non-selective inhibitors. In various embodiments, myostatin pathway inhibitor may include low molecular weight compounds (i.e., small molecules) that inhibit the pathway, as well as biologics, such as antibodies or antigen-binding fragments thereof, and engineered protein constructs that comprise ligand-binding domains (such as soluble receptor ligand traps, follistatin-based engineered constructs, and adnectins). In some embodiments, the myostatin pathway inhibitors are antibodies (e.g., antigen-binding fragments thereof or engineered constructs that comprise such fragments) that bind mature myostatin (also known as GDF-8 or GDF8). Such antibodies are typically referred to as neutralizing antibodies because they bind the growth factor thereby blocking its ability to bind endogenous receptors for activating the signaling pathway. In some embodiments, a myostatin pathway inhibitor binds a myostatin receptor thereby interfering with ligand binding. These include antibodies that bind the extracellular portion(s) of the receptor. Non-limiting examples of such antibodies include bimagrumab (BYM338) which binds ActRIIB. In preferred embodiments, the inhibitors of the myostatin signaling pathway useful for carrying out the invention are myostatin-selective inhibitors. In some embodiments, the myostatin-selective inhibitors are neutralizing antibodies that selectively bind mature myostatin (but not other growth factors such as GDF11 or Activin A). One example of such myostatin-selective antibody is trevogrumab, also known as REGN1033. In some embodiments, the myostatin-selective inhibitors are antibodies or antigen-binding fragments thereof that bind the pro/latent myostatin complex, thereby inhibiting activation (e.g., release) of mature myostatin. Such antibodies or antigen-binding fragments are referred to as activation inhibitors of myostatin. Non-limiting examples of myostatin-selective activation inhibitors include apitegromab (also known as SRK-015) and variants thereof, GYM329 and variants thereof, or a MST1032 variant as described in PCT/JP2015/006323.

    [0450] Accordingly, a LTBP-selective TGF?1 inhibitor (such as those described herein) is used in conjunction with a myostatin pathway inhibitor in the treatment of a liver disease in a subject, wherein the treatment comprises administration of the LTBP-selective TGF?1 inhibitor in an amount effective to treat the liver disease, wherein optionally the liver disease is selected from: non-alcoholic fatty liver disease (NAFLD), e.g., non-alcoholic fatty liver (NAFL) and non-alcoholic steatohepatitis (NASH), which may include: noncirrhotic NASH with liver fibrosis, liver cirrhosis, NASH with compensated cirrhosis, NASH with decompensated cirrhosis, liver inflammation with fibrosis, liver inflammation without fibrosis; stage 2 and 3 liver fibrosis, stage 4 fibrosis (NASH cirrhosis or cirrhotic NASH with fibrosis), primary biliary cholangitis (PBC) (formerly known as primary biliary cirrhosis), and/or primary sclerosing cholangitis (PSC), wherein optionally the subject has or is at risk of developing obesity, metabolic syndrome, and/or type 2 diabetes.

    [0451] In some embodiments, the LTBP-selective TGF?1 inhibitor (such as those described herein) is used in the treatment of a liver disease in a subject who is treated with a myostatin pathway inhibitor such as those listed above. In some embodiments, the myostatin pathway inhibitor (such as those listed above) is used in the treatment of a liver disease in a subject who is treated with a LTBP-selective TGF?1 inhibitor (such as those described herein). In some embodiments, a combination of the LTBP-selective TGF?1 inhibitor (such as those described herein) and the myostatin pathway inhibitor are used in the treatment of a liver disease in a subject in amounts effective to treat the disease. In preferred embodiments, the myostatin pathway inhibitor is a myostatin-selective inhibitor, wherein optionally the myostatin-selective inhibitor is an antibody or antigen-binding fragment thereof which binds the myostatin growth factor without binding GDF11 or Activin A, or, which binds pro/latent myostatin thereby inhibiting activation of myostatin (such as apitegromab and GYM329/RO7204239).

    [0452] In some embodiments, the subject is further treated with one or more additional therapy/therapies aimed to address metabolic dysregulation associated with the liver disease. In some embodiments, the additional therapies comprise a GLP-1 pathway activator (such as GLP-1 receptor agonists). The GLP-1 pathway activator may be any agent capable of enhancing GLP-1 signaling. In preferred embodiments, the GLP-1 pathway activators useful for carrying out the present invention may be GLP-1 receptor agonists, such as GLP-1 analogs.

    [0453] In some embodiments, the activators of the GLP-1 signaling pathway useful for carrying out the invention are GLP-1 receptor agonists, such as GLP-1 analogs. Endogenous GLP-1 is susceptible to degradation by peptidases and has a short half-life. Therefore, certain modifications can be introduced to the peptide hormone to generate GLP-1 analogs, aimed to prolong or stabilize its activity. In some embodiments, the GLP-1 analog may comprise the amino acid sequence EGTFTSD (SEQ ID NO: 116). In some embodiments, GLP-1 analogs comprise the amino acid sequence HXXGXFTXD (SEQ ID NO: 117), wherein X is any amino acid residue. Non-limiting examples of GLP-1 analogs include semaglutide, exenatide ER, liraglutide, lixisenatide, tirzepatide, dulaglutide, XW003, Noiiglutide, MED10382, and albiglutide. In some embodiments, the activators of the GLP-1 signaling pathway useful for carrying out the invention are inhibitors of peptidases responsible for the degradation of GLP-1. In some embodiments, the peptidase inhibitor inhibits dipeptidyl peptidase 4 (DPP-4) and/or neutral endopeptidase (NEP). In some embodiments, the activators of the GLP-1 signaling pathway useful for carrying out the invention are agents capable of modulating GLP-1 receptor trafficking (e.g., agents that cause slower internalization of the receptor); agents that increase expression of cell-surface GLP-1 receptors; agents that enhance ligand-induced activation of the GLP-1 receptor; agents that enhance pathways such as cAMP signaling that are downstream of the GLP-1 receptor, and/or agents that antagonize the phosphatase responsible for de-phosphorylating the GLP-1 receptor.

    [0454] Non-limiting examples of GLP-1 analogs include albiglutide, taspoglutide, semaglutide, exenatide, BPI-3016, GW002, glutazumab, exendin-4, exenatide, GLP-1 (7-36)NH2, everestmab, liraglutide, lixisenatide, tirzepatide, XW003, Noiiglutide, MED10382, and dulaglutide. In one embodiment, the GLP-1 analog is liraglutide, which is currently approved for type 2 diabetes and obesity.

    [0455] Liraglutide (Victoza?, Saxenda?, CAS Number 204656-20-2) is an acylated GLP-1 agonist derived from GLP-1(7-37). While wild-type GLP-1 has a plasma half-life of 1.5-2 minutes due to degradation by the enzyme dipeptidyl peptidase-4 (DPP-IV) and/or neutral endopeptidases, liraglutide is an acylated form of GLP-1 engineered to bind albumin when administered to a subject, thus greatly extending its half-life compared to GLP-1(7-37), with a plasma half-life of 13 hours. Liraglutide is also available in combination with insulin degludec under the name Xultophy?, Semaglutide (Ozempic?, Rybelsus?, Wegovy?, CAS Number 910463-68-2) is a modified GLP-1 peptide comprising two amino acid replacements: 2-aminoisobutyric acid replaces the alanine moiety at position 8 and arginine replaces the lysine moiety at position 34. The substitution at position 8 prevents breakdown by the enzyme DPP-IV. Semaglutide was approved by the USFDA in 2017. See, e.g., Novo Nordisk A/S. Ozempic (semaglutide) injection, for subcutaneous use; prescribing information; 2020.

    [0456] Dulaglutide (Trulicity?, CAS Number 923950-08-7) comprises GLP-1(7-37) covalently linked to an Fc fragment of human IgG4. Dulaglutide is approved for adults with type 2 diabetes mellitus (combined with diet and exercise). See, e.g., Meece J., Adv Ther. 2017; 34:638-657.

    [0457] Exenatide (Byetta?, Bydureon?, CAS Number 141758-74-9) is a synthetic form of the GLP-1 mimetic exendin-4 (a Gila monster saliva hormone) approved by the USFDA in 2005 for treatment of diabetes mellitus type 2 combined with diet and exercise.

    [0458] Glutazumab is an antibody fusion protein engineered by linking the human GLP-1 derivative to a humanized GLP-1R antibody via a peptide linker. Li et al., Biochem Pharmacol. 2018 April; 150:46-53.

    [0459] Lixisenatide (Lyxumia?, Adlyxin?, CAS Number 320367-13-3) is a GLP-1 mimetic approved for treatment of diabetes mellitus type 2 in conjunction with diet and exercise. See, e.g., Sanofi-Aventis US. Adlyxin (lixisenatide), prescribing information, 2016. Lixisenatide is also available in combination with insulin glargine under the name Soliqua?/Suliqua?.

    [0460] Everestmab is a long-acting GLP-1/anti-GLP1R fusion protein comprising a mutated GLP-1(A8G) fused to tandem bispecific humanized GLP-1R targeting and albumin-binding nanobodies designed for treatment of diabetes mellitus type 2. Pan et al., ARTIFICIAL CELLS, NANOMEDICINE, AND BIOTECHNOLOGY 2020, VOL. 48, NO. 1, 854-866.

    [0461] Albiglutide (Eperzan?, Tanzeum?, CAS Number 782500-75-8) is a GLP-1R agonist that was approved for type 2 diabetes mellitus. Its manufacture was discontinued in 2018 due to lack of sales. See, e.g., GlaxoSmithKline LLC. Tanzeum? (albiglutide) for injection, for subcutaneous use prescribing information; 2017.

    [0462] Taspoglutide is a GLP-1R agonist that was previously under clinical investigation for treatment of diabetes mellitus type 2.

    [0463] Tirzepatide (LY3298176) is a dual glucose-dependent insulinotropic polypeptide, GIP and GLP-1 receptor agonist that is under clinical investigation for the treatment of type 2 diabetes. It was made by engineering GLP-1 activity into the GIP sequence and has been shown to improve glycemic control and to reduce body weight (Rosenstock et al., Lancet (2020) 398:143-155).

    [0464] BP3016 is a long-acting hGLP-1 analog comprising human GLP-1(7-37) with engineered resistance to DPP-IV cleavage. See, e.g., Pharmacol Res. 2017 August; 122:130-139.

    [0465] XW003 is an acylated human glucagon-like peptide-1 (GLP-1) analog that has been shown to induce dose-dependent weight reductions in early clinical trials. The drug is currently in phase 2 stage of development for the treatment of obesity. See, e.g., ClinicalTrials.gov identifier NCT05111912.

    [0466] Noiiglutide is a 40-mer exenatide analog, which acts as a glucagon-like peptide-1 (GLP-1) agonist. The drug is being developed by Jiangsu Hansoh Pharmaceutical for the treatment of obesity. It is currently in phase 2 clinical development. See, e.g., Cabri et al. Front Mol Biosci. 2021; 8: 697586.

    [0467] MED10382 is an oxyntomodulin-like peptide with targeted GLP-1 and glucagon receptor activity. It is currently in phase 2 stage of clinical development for the treatment of obesity. See, e.g., Ambery et al. Lancet. 2018 Jun. 30; 391(10140):2607-2618.

    [0468] According to the present disclosure, GLP-1 pathway activators include danuglipron (Pfizer), GLP-1 receptor agonist/GIP receptor antagonist combination such as AMG 133 (Amgen), mas receptor activators, e.g., Sarconeos, GLP-1/GIP combination such as tirzepatide (Eli Lilly), amylin/GLP-1 combination such as cagrilintide/semaglutide combination (Novo Nordisk), GLP-1/glucagon combination such as DD01 (Neuraly), GLP-1/glucagon combination such as ALT-801 (Altimmune), GLP-1/GIP such as CT-388 (Carmot), GLP-1/glucagon dual agonist such as 1B1362 (mazdutide) (LY-330567 (Innovent/Eli Lilly), danuglipron (PF-06882961) (Pfizer), setmelanotide (Rhythm), GLP-1/GIP/Glucagon triple receptor agonist such as LY3437943 (Eli Lilly) and a dual GIP/GLP-1 receptor agonist such as LY3298176 (Eli Lilly).

    [0469] GLP-1 pathway activators further encompass agents that act on multiple pathways, including the GLP-1 pathway, such as metformin and derivatives thereof. Rena et al., Diabetologia 60:1577-85 (2017). Non-limiting examples of metaformin include Fortamet, Glucophage, Glucophage XR, Glumetza, Riomet, Obimet, Gluformin, Dianben, Diabex, Diaformin, Metsol, Siofor, Metforgamma and Glifor. GLP-1 pathway activators also include metformin-containing medications that include additional active agents. Examples include, but are not limited to, thiazolidinediones (glitazones) and rosiglitazone. In some embodiments, the GLP-1 pathway activator is FGF-2 or a peptide derived therefrom.

    [0470] Accordingly, a LTBP-selective TGF?1 inhibitor (such as those described herein) is used in conjunction with a GLP-1 pathway activator in the treatment of a liver disease in a subject, wherein the treatment comprises administration of the LTBP-selective TGF?1 inhibitor and the GLP-1 pathway activator in amounts effective to treat the liver disease, wherein optionally the liver disease is selected from: non-alcoholic fatty liver disease (NAFLD), e.g., non-alcoholic fatty liver (NAFL) and non-alcoholic steatohepatitis (NASH), which may include: noncirrhotic NASH with liver fibrosis, liver cirrhosis, NASH with compensated cirrhosis, NASH with decompensated cirrhosis, liver inflammation with fibrosis, liver inflammation without fibrosis; stage 2 and 3 liver fibrosis, stage 4 fibrosis (NASH cirrhosis or cirrhotic NASH with fibrosis), primary biliary cholangitis (PBC) (formerly known as primary biliary cirrhosis), and/or primary sclerosing cholangitis (PSC), wherein optionally the subject has or is at risk of developing obesity, metabolic syndrome, and/or type 2 diabetis.

    [0471] In some embodiments, the LTBP-selective TGF?1 inhibitor (such as those described herein) is used in the treatment of a liver disease in a subject who is treated with a GLP-1 pathway activator such as those listed above. In some embodiments, the GLP-1 pathway activator (such as those listed above) is used in the treatment of a liver disease in a subject who is treated with a LTBP-selective TGF?1 inhibitor (such as those described herein). In some embodiments, a combination of the LTBP-selective TGF?1 inhibitor (such as those described herein) and the GLP-1 pathway activator are used in the treatment of a liver disease in a subject in amounts effective to treat the disease. In preferred embodiments, the GLP-1 pathway activator is a GLP-1 analog which acts as a GLP-1 receptor agonist.

    [0472] In some embodiments, triple combination/adjunct/add-on therapy is contemplated, in which a LTBP-selective TGF?1 inhibitor, myostatin pathway inhibitor and a GLP-1 pathway activator are used in conjunction to treat the liver disease in the subject, wherein optionally the liver disease is NAFLD or NASH, wherein further optionally the subject has or is at risk of developing a metabolic disease such as obesity, metabolic syndrome and/or type 2 diabetes. In preferred embodiments, the myostatin pathway inhibitor is a myostatin-selective inhibitor. Examples of myostatin-selective inhibitors include nautralizing antibodies that bind myostatin but not GDF11 or Activin (such as REGN1033 and variants thereof), as well as activation inhibiting antibodies that bind pro/latent myostatin thereby inhibiting release of the growth factor from the latent complex (such as apitegromab, GYM329, and variants thereof). In further preferred embodiments, the GLP-1 pathway activator is a GLP-1 receptor agonist, such as GLP-1 analogs. Applicant has obtained preclinical mouse data showing that a combination of a myostatin-selective inhibitor and a GLP-1 receptor agonist (e.g., liraglutide) can achieve overall body weight loss, enhanced fat mass reduction, retention of lean mass, and overall enhancement of body composition, as compared to the GLP-1 receptor agonist alone, in a diet-induced obesity model. Based on these observations, together with the anti-fibrotic effects observed with LTBP-selective inhibition approach, it is contemplated herein that addition of a LTBP-selective TGF?1 inhibitor to the myostatin inhibitor/GLP-1 combination may further provide anti-fibrotic effects in NASH, or potentially prevent or delay the disease progression from NAFLD to NASH in a subject, by addressing both the metabolic aspect and liver injury-induced fibrosis.

    [0473] In some embodiments, the subject also receives a FGF21 receptor agonist or a FGF19 receptor agonist. Zhao et al., Signal Transduction and Targeted Therapy (2022) 7:206. In some embodiments, the subject also receives, or has received, one or more of the following therapeutics to treat the liver disease: Hydronidone, B1089-100, Efruxifermin, Pegbelfermin, Aldafermin, MK-3655, PRI-724, Selonsertib, CC-90001, Epeleuton, Elafibranor, Saroglitazar, Lanifibranor, Pemafibrate, ZSP0678, Obeticholic Acid, Cilofexor, Nidufexor, TERN-101, Vonafexor, EDP-305, Tropifexor, JKB-121, JKB-122, Semaglutide, Tirzepatide, Cotadutide, HM-15211, Resmetirom, VK2809, Cenicriviroc, Belapectin, GB1211, Azemiglitazone potassium, Deuterium-Stabilized (R)-Pioglitazone, Aramchol, PF-05221304, Firsocostat, ZSP1601, Epeleuton, PXL-770, ALS-L1023, Namodenoson, TVB-2640, LPCN 1144, HepaStem, BMS-986263, Foralumab, Elobixibat, Apararenone, PF-06835919, ARO-HSD, and CB4211.

    [0474] In some embodiments, the subject also receives, or has received, one or more of Treg-enhancing agents, such as all-trans retinoic acid (ATRA), vitamin D3, indoleamine-pyrrole 2,3-dioxygenase (IDO), short-chain fatty acids (e.g., butyrate), and/or AKT/mTOR pathway inhibitors such as rapamycin.

    Renal (Kidney) Fibrosis and Related Conditions

    [0475] Renal fibrosis is a progressive pathological feature of chronic kidney diseases (CKD) and may be associated with conditions such as diabetes, proteinuria, hypertension, glomerular disease and crystal deposition. Chronic kidney disease is defined based on the presence of either kidney damage or decreased kidney function for three or more months, irrespective of cause. Chronic kidney disease (CKD) is common in people with both type 1 and type 2 diabetes. It is defined by the presence of reduced glomerular filtration rate (GFR) and/or increased urinary albumin excretion for at least three months.

    [0476] Patients with end-stage kidney disease (ESKD) are known to display a cellular immune dysfunction, such as micro-inflammation and atherogenesis which may be in part mediated by reduced Tregs in these patients. Indeed, in most, if not all, studies on inflammatory diseases, including acute and chronic renal disease, depletion of Tregs worsens the disease, whereas Treg supplementation offers robust protection (reviewed for example by Sharma & Kinsey (2017) Am J Physiol Renal Physiol 314: F679-F698).

    [0477] For example, in acute kidney injury, Treg depletion worsened the inflammation, acute tubular necrosis and renal function assessed by plasma creatinine, whereas Treg transfer showed the protective effect of Tregs. Similarly, in cisplatin-induced renal injury model, Tregs were shown to protect from cisplatin-induced renal dysfunction and damage. By contrast, Treg depletion in wild type mice exacerbated the cisplatin-induced injury.

    [0478] Role of Tregs in glomerulopathies have been reported. Autoimmune diseases such as systemic lupus erythematosus (SLE or lupus), Goodpasture's syndrome, IgA nephropathy (idiopathic), and others often have glomerular manifestations. SLE is a systemic autoimmune disease manifested as increased production of autoantibodies, immune complex deposition, and multiorgan inflammation. Kidneys are affected in over 50% of lupus patients, leading to glomerulonephritis, with a fifth of these patients proceeding to ESRD. Clinical and experimental studies show that Treg deficiency correlates with incidence and severity of lupus.

    [0479] Diabetic kidney disease represents the leading cause of kidney failure (e.g., ESRD and mortality). In fact, about 1 in 3 adults with diabetes has CKD. Both type 1 and type 2 diabetes are affected. Tregs play a role in suppressing inflammation (e.g., in type 2 diabetes) and preventing severe autoimmune diseases (e.g., in type 1 diabetes).

    [0480] Therefore, when the ability of Tregs to become activated, proliferate and/or be recruited to disease loci is impaired, tissue inflammation induced by various factors (e.g., ischemia reperfusion, nephrotoxic drugs, lupus nephritis, diabetic nephropathy, etc.) cannot be sufficiently suppressed, ultimately leading to end-stage renal disease. Advantageously, the LTBP-selective inhibitors of TGF?1 activation can selectively target matrix-associated TGF?1, sparing Tregs expressing cell-surface GARP.

    [0481] Accordingly, the present disclosure includes therapeutic use of LTBP-selective TGF?1 inhibitors for treating CKD. In some embodiments, a LTBP-selective TGF?1 inhibitor is used in the treatment of CKD in a subject, wherein the treatment comprises administration of the LTBP-selective TGF?1 inhibitor in an amount sufficient to treat CKD. In some embodiments, the subject has diabetes, wherein optionally the diabetes is type 2 diabetes or type 1 diabetes.

    [0482] In preferred embodiments, the TGF?1 inhibitor is Ab42 or a variant thereof. Alternatively, in some embodiments, the TGF?1 inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the N-terminal stretch of amino acids DMELVKRKRIEAIR (SEQ ID NO: 46) within the so-called alpha-1 helix region of the prodomain of the latent proTGF?1 complex. In some embodiments, the antibody or the fragment contacts one or more of the following residues within the prodomain: Asp27 (D); Leu30 (L); Arg33 (R); Ile36 (I); Glu37 (E) (shown in bold above). Additionally or alternatively, in some embodiments, the inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the amino acid sequence YIDFRKDLGWK (SEQ ID NO: 93) within the TGF?1 growth factor domain (e.g., the finger-1 domain). In some embodiments, the antibody or fragment thereof contacts one or more of the following residues: Tyr289 (Y); Lys294 (K); Asp295 (D) (shown in bold above). In some embodiments, such antibody binds a conformational epitope comprising one or more residues of DMELVKRKRIEAIR (SEQ ID NO: 46) and one or more residues of YIDFRKDLGWK (SEQ ID NO: 93), wherein the antibody is not Ab42.

    [0483] In some embodiments, CKD is associated with a genetic mutation. In some embodiments, the subject has Alport syndrome. Alport syndrome is a rare genetic disorder of specialized basement membranes in the kidney, ear, and eye and is caused by mutations in genes for type IV collagen (Col4A3, Col4A4 and Col4A5). Most affected individuals experience progressive loss of kidney function due in part to impaired renal filtration, which may lead to end-stage kidney disease. People with Alport syndrome also frequently develop sensorineural hearing loss in late childhood or early adolescence.

    [0484] A 2021 report by Chimenz et al. (J Nephrol. 2021 December; 34(6):1915-1924) evaluated urinary (u) and serum (s) levels of tumor growth factor (TGF)-beta(?) and high mobility group box (HMGB)-1 in ALP patients with normal renal function, albuminuria and proteinuria. This group found that ALP patients had significantly higher levels of serum and urinary TGF-?1 compared to healthy subjects, and thus concluded that high levels of HMGB1 and TGF-?1 characterized ALP patients with normal renal function, highlighting the subclinical pro-fibrotic and inflammatory mechanisms triggered before the onset of proteinuria.

    [0485] Currently there are limited treatment options for Alport syndrome, focused primarily on supportive care. These include, but are not limited to: angiotensin converting enzyme (ACE) inhibitors and angiotensin II type 1 receptor blockers (ARBs), and renal transplant.

    [0486] In some embodiments, a LTBP-selective TGF?1 inhibitor is used in the treatment of Alport syndrome in a subjec, wherein the treatment comprises administration of the TGF?1 inhibitor in an amount effective to treat the disease, wherein optionally the subject is treated with an ACE inhibitor, an ARB and/or an endothelin antagonist.

    [0487] In some embodiments, the subject suffering from kidney fibrosis or CKD may be further treated with a background therapy aimed to manage or treat diabetes. In some embodiments, the subject is on a background therapy containing a biguanide such as metformin or a derivative thereof. Non-limiting examples of metaformin include Fortamet, Glucophage, Glucophage XR, Glumetza, Riomet, Obimet, Gluformin, Dianben, Diabex, Diaformin, Metsol, Siofor, Metforgamma and Glifor, as well as metformin-containing medications that include additional active. Examples include, but are not limited to, thiazolidinediones (glitazones) and rosiglitazone. In some embodiments, the subject is on a medication for type 2 diabetes. The anti-diabetic medication may be an alpha-glucosidase inhibitor; a dipeptidyl peptidase-4 (DPP-4) inhibitor such as alogliptin, linagliptin, saxagliptin or sitagliptin; a sodium-glucose cotransporter-2 (SGLT-2) inhibitor such as dapagliflozin, canagliflozin, empagliflozin, or ertugliflozin; a sulfonylurea; or a thiazolidinedione.

    [0488] In some embodiments, the subject also receives, or has received, one or more of Treg-enhancing agents, such as all-trans retinoic acid (ATRA), vitamin D3, indoleamine-pyrrole 2,3-dioxygenase (IDO), short-chain fatty acids (e.g., butyrate), and/or AKT/mTOR pathway inhibitors such as rapamycin.

    [0489] A significant fraction of CKD patients suffer from anemia (i.e., anemia of chronic kidney disease). Anemia associated with CKD may in part be caused by myelophthisis, characterized by the presence of immature erythrocytes in the peripheral blood due to infiltration of the bone marrow by abnormal tissue. Myelophthisic anemia results from fibrosis and crowding out of the normal bone marrow owing to infiltration by non-hematopoietic or abnormal cells. Therefore, in addition to treating kidney fibrosis, LTBP-selective TGF?1 inhibitors described herein may also treat fibrosis in the bone marrow and alleviate anemia. In addition, the patients may further receive a therapy aimed to address anemia.

    Lung Fibrosis and Related Conditions

    [0490] Chronic respiratory diseases may be caused by various factors, including but are not limited to allergens, chemicals, radiation, microbial agents, and environmental particles. Prolonged exposure to such factors may result in lung fibrosis. In some embodiments, chronic respiratory diseases comprise pneumoconiosis. In some embodiments, chronic respiratory diseases comprise IPF. In some embodiments, chronic respiratory diseases are associated with a gene mutation. In some embodiments, chronic respiratory diseases comprise a chronic infection.

    [0491] An inflammatory disease with dysregulated TGFb1 includes certain infections, e.g., viral infections and bacterial infections. In some embodiments, the viral infection is a severe acute respiratory syndrome, such as COVID19, which manifests an inflammatory response. Patients with severe acute respiratory syndrome may develop a pulmonary fibrosis. According to the present disclosure, LTBP-selective TGFb1 inhibitors may be used to treat such conditions.

    [0492] Patients with acute respiratory distress syndrome who are mechanically ventilated often develop pulmonary fibrosis. It has been suggested that stress induced by mechanical ventilation may cause tissue damage that induces fibrogenesis, such as damage to the alveolar epithelium, biotrauma, etc, via epithelial-mesenchymal transition. Such exposure to mechanical stress could trigger wound/repair response in the lung tissue, involving inflammation. Therefore, it is contemplated that LTBP-selective approach to inhibiting TGF?1 may be advantageous in treating the condition.

    [0493] Radiation is a well-established therapy for thoracic neoplasms. However, the lung is a radiosensitive organ and radiation-induced lung injury (e.g., radiation-induced pneumonitis and pulmonary fibrosis) poses a treatment challenge. Regulatory T cells (Tregs) may play a key role in the pathogenesis of radiation-induced lung injury, a frequent and potentially life-threatening complication of thoracic radiotherapy. Therefore, use of LTBP-selective TGF?1 inhibitors may provide an advantageous treatment option.

    [0494] Accordingly, a LTBP-selective TGF?1 inhibitor (such as Ab42) is used as an adjunct therapy in the treatment of radiation-induced lung injury in a subject who receives radiation therapy aimed to treat thoracic neoplasm (e.g., lung cancer, head and neck cancer, etc.).

    [0495] In some embodiments, the subject also receives, or has received, one or more of Treg-enhancing agents, such as all-trans retinoic acid (ATRA), vitamin D3, indoleamine-pyrrole 2,3-dioxygenase (IDO), short-chain fatty acids (e.g., butyrate), and/or AKT/mTOR pathway inhibitors such as rapamycin.

    [0496] In preferred embodiments, the TGF?1 inhibitor is Ab42 or a variant thereof. Alternatively, in some embodiments, the TGF?1 inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the N-terminal stretch of amino acids DMELVKRKRIEAIR (SEQ ID NO: 46) within the so-called alpha-1 helix region of the prodomain of the latent proTGF?1 complex. In some embodiments, the antibody or the fragment contacts one or more of the following residues within the prodomain: Asp27 (D); Leu30 (L); Arg33 (R); Ile36 (I); Glu37 (E) (shown in bold above). Additionally or alternatively, in some embodiments, the inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the amino acid sequence YIDFRKDLGWK (SEQ ID NO: 93) within the TGF?1 growth factor domain (e.g., the finger-1 domain). In some embodiments, the antibody or fragment thereof contacts one or more of the following residues: Tyr289 (Y); Lys294 (K); Asp295 (D) (shown in bold above). In some embodiments, such antibody binds a conformational epitope comprising one or more residues of DMELVKRKRIEAIR (SEQ ID NO: 46) and one or more residues of YIDFRKDLGWK (SEQ ID NO: 93), wherein the antibody is not Ab42.

    Skeletal Muscle Fibrosis and Related Conditions

    [0497] Accumulating evidence indicates that TGF? plays an important role in muscle homeostasis, repair, and regeneration. In skeletal muscle, TGF? plays a variety of roles including inhibition of proliferation and differentiation, induction of atrophy, and development of fibrosis. The hallmark of DMD is excessive, and progressive, fibrosis. TGF?1 has been implicated in human muscular dystrophies. Duchenne muscular dystrophy (DMD) is a severe, progressive, and ultimately fatal disease caused by the absence of dystrophin (Bushby, K., et al., Lancet Neurol, 2010. 9(1): p. 77-93). Lack of dystrophin results in increased susceptibility to contraction-induced injury, leading to continual muscle degeneration (Petrof, B. J., et al., Proc Natl Acad Sci USA, 1993. 90(8): p. 3710-4; Dellorusso, C., et al., J Muscle Res Cell Motil, 2001. 22(5): p. 467-75; Pratt, S. J., et al., Cell Mol Life Sci, 2015. 72(1): p. 153-64). Repeated rounds of repair contribute to chronic inflammation, fibrosis, exhaustion of the satellite cell pool, eventual loss of mobility and death (Bushby, K., et al., Lancet Neurol, 2010. 9(1): p. 77-93; McDonald, C. M., et al., Muscle Nerve, 2013. 48(3): p. 343-56). Expression of TGF?1 is significantly increased in patients with DMD and correlates with the extent of fibrosis observed in these patients (Bernasconi, P., et al., J Clin Invest, 1995. 96(2): p. 1137-44; Chen, Y. W., et al., Neurology, 2005. 65(6): p. 826-34). Excessive ECM deposition has detrimental effects on the contractile properties of the muscle and can limit access to nutrition as the myofibers are isolated from their blood supply (Klingler, W., et al., Acta Myol, 2012. 31(3): p. 184-95). In human patients, there is a strong correlation between the extent of TGF?1 upregulation and fibrosis, and a strong link between the extent of fibrosis and negative mobility outcomes.

    [0498] For these reasons, multiple groups have previously evaluated TGF? pathway inhibitors, such as neutralizing antibodies (pan-inhibitors of TGF?1, 2, and 3 such as 1 D11), TGF? receptor antagonists (e.g., Alk5 inhibitors and dominant-negative receptors) aimed to address fibrosis associated with DMD and observed some anti-fibrotic effects at least in preclinical models. None has to date succeeded in the clinic.

    [0499] As alluded to above, apart from severe fibrosis, muscular dystrophies such as DMD manifest inflammation. While TGF? inhibition may address the fibrotic feature of the disease by reducing excess ECM deposit such as collagen build-up, TGF? also has immunosuppressive effects. Therefore, broad inhibition of this pathway may cause immune stimulation, which could exacerbate inflammation of the dystrophic muscle. Indeed, this notion is supported by literature. For example, Villalta et al. (Sci Transl Med. 6(258): 258ra142) reported that regulatory T cells suppressed muscle inflammation and injury in a murine muscular dystrophy model. Although Tregs were largely absent in the muscle of wild-type mice and normal human muscle, they were present in necrotic lesions, and depletion of Tregs exacerbated muscle injury and the severity of muscle inflammation. These findings suggest that Tregs modulate the progression of muscular dystrophy by suppressing inflammation in muscle associated with muscle fiber injury.

    [0500] Applicant recognized the need for a therapy that addresses muscle fibrosis, while minimizing the risk of Treg inhibition for the treatment of muscle conditions involving both fibrosis and inflammation. Agents, such as monoclonal antibodies described herein, that selectively modulate LTBP-associated TGF?1 signaling may be effective for treating damaged muscle fibers, such as in chronic/genetic muscular dystrophies, congenital fibrosis of ocular/extraocular muscles, and acute muscle injuries, without the toxicities associated with more broadly-acting TGF? inhibitors.

    [0501] Accordingly, the present disclosure provides methods for treating damaged muscle fibers using an agent that preferentially modulates a subset, but not all, of TGF? effects in vivo. Such agents can selectively modulate TGF?1 signaling (isoform-specific modulation) in a particular context, i.e., when presented by LTBP1 or LTBP3. In preferred embodiments, the agent is an antibody that selectively binds LTBP1/3-proTGF?1 thereby inhibiting release of TGF?1 from the latent complex, wherein optionally the antibody is Ab42 or a variant thereof. Alternatively, in some embodiments, the agent is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the N-terminal stretch of amino acids DMELVKRKRIEAIR (SEQ ID NO: 46) within the so-called alpha-1 helix region of the prodomain of the latent proTGF?1 complex. In some embodiments, the antibody or the fragment contacts one or more of the following residues within the prodomain: Asp27 (D); Leu30 (L); Arg33 (R); Ile36 (I); Glu37 (E) (shown in bold above).

    [0502] Additionally or alternatively, in some embodiments, the agent is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the amino acid stretch YIDFRKDLGWK (SEQ ID NO: 93) within the TGF?1 growth factor domain (e.g., the finger-1 domain). In some embodiments, the antibody or fragment thereof contacts one or more of the following residues: Tyr289 (Y); Lys294 (K); Asp295 (D) (shown in bold above). In some embodiments, such antibody binds a conformational epitope comprising one or more residues of DMELVKRKRIEAIR (SEQ ID NO: 46) and one or more residues of YIDFRKDLGWK (SEQ ID NO: 93), wherein the antibody is not Ab42.

    [0503] In some embodiments, the subject also receives, or has received, one or more of Treg-enhancing agents, such as all-trans retinoic acid (ATRA), vitamin D3, indoleamine-pyrrole 2,3-dioxygenase (IDO), short-chain fatty acids (e.g., butyrate), and/or AKT/mTOR pathway inhibitors such as rapamycin.

    [0504] In preferred embodiments, the TGF?1 inhibitor is Ab42 or a variant thereof. Alternatively, in some embodiments, the TGF?1 inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the N-terminal stretch of amino acids DMELVKRKRIEAIR (SEQ ID NO: 46) within the so-called alpha-1 helix region of the prodomain of the latent proTGF?1 complex. In some embodiments, the antibody or the fragment contacts one or more of the following residues within the prodomain: Asp27 (D); Leu30 (L); Arg33 (R); Ile36 (I); Glu37 (E) (shown in bold above). Additionally or alternatively, in some embodiments, the inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the amino acid sequence YIDFRKDLGWK (SEQ ID NO: 93) within the TGF?1 growth factor domain (e.g., the finger-1 domain). In some embodiments, the antibody or fragment thereof contacts one or more of the following residues: Tyr289 (Y); Lys294 (K); Asp295 (D) (shown in bold above). In some embodiments, such antibody binds a conformational epitope comprising one or more residues of DMELVKRKRIEAIR (SEQ ID NO: 46) and one or more residues of YIDFRKDLGWK (SEQ ID NO: 93), wherein the antibody is not Ab42.

    [0505] In some embodiments, the LTBP-selective TGF?1 inhibitor is used in conjunction with another therapy aimed to treat the muscle, such as dystrophin-directed therapy. Such therapies include, but are not limited to: exon skipping therapies (e.g., Golodirsen, Eteplirsen, Viltolarsen, Casimersen, SRP-5051, DS-514-1 b); stop codon readthrough therapies (e.g., Ataluren, NPC14/Arbekacin sulfate); gene addition therapies (e.g., PF-06939926, rAAVrh74.MHCK7, SGT-001); genome editing therapies (CRISPR-Cas9); protein replacement therapies (C1100/Ezutromid, rAAVrh74.MCK.GALGT2); myoblast transplantation (e.g., donor-derived myoblasts). Thus, the LTBP-selective TGF?1 inhibitor is used in the treatment of DMD in a subject, wherein the treatment comprises administration of the LTBP-selective TGF?1 inhibitor in an amount effective to treat DMD-associated inflammation and/or fibrosis, wherein the subject is treated with any one of the therapies listed above (e.g., dystrophin-directed therapies).

    [0506] In some embodiments, the subject also receives, or has received, one or more of Treg-enhancing agents, such as all-trans retinoic acid (ATRA), vitamin D3, indoleamine-pyrrole 2,3-dioxygenase (IDO), short-chain fatty acids (e.g., butyrate), and/or AKT/mTOR pathway inhibitors such as rapamycin.

    Cardiac Fibrosis and Related Conditions

    [0507] Cardiac fibrosis is often associated with cardiovascular disorders (e.g., atherosclerosis, hypertension, heart failure, pulmonary arterial hypertension, abnormal aortic aneurysm, left venticular hypertrophy, atrial fibriation, postischemic neovascularization, myocardititis and dilated cardiomyopathy and myocardial infarction) and manifests as either reactive interstitial fibrosis or replacement fibrosis. The latter typically occurs in response to ischemia, ischemia.reperfusion, inflammation, and/or toxic injury to the cardiac tissues. Ischemic injury triggers an inflammatory response that is essential for tissue repair, but excessive and prolonged or chronic immune responses can lead to cardiovascular diseases, including cardiac fibrosis. Regulatory T cells (Tregs) serve an important role in regulating self-tolerance and immune suppression thereby preventing excessive inflammation and participate in tissue repair following an ischemic event (reviewed in, for example, Zhuang & Feinberg (2020) J Mol Cell Cardiol, 147: 1-11).

    [0508] Therefore, it is contemplated that LTBP-selective TGF?1 inhibitors may be used in the treatment of cardiovascular disorders (e.g., cardiac fibrosis) in a subject in an amount effective to treat the disorder, wherein the cardiovascular disorder involves inflammation of the affected tissue.

    [0509] In some embodiments, the subject also receives, or has received, one or more of Treg-enhancing agents, such as all-trans retinoic acid (ATRA), vitamin D3, indoleamine-pyrrole 2,3-dioxygenase (IDO), short-chain fatty acids (e.g., butyrate), and/or AKT/mTOR pathway inhibitors such as rapamycin.

    [0510] In preferred embodiments, the TGF?1 inhibitor is Ab42 or a variant thereof. Alternatively, in some embodiments, the TGF?1 inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the N-terminal stretch of amino acids DMELVKRKRIEAIR (SEQ ID NO: 46) within the so-called alpha-1 helix region of the prodomain of the latent proTGF?1 complex. In some embodiments, the antibody or the fragment contacts one or more of the following residues within the prodomain: Asp27 (D); Leu30 (L); Arg33 (R); Ile36 (I); Glu37 (E) (shown in bold above). Additionally or alternatively, in some embodiments, the inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the amino acid sequence YIDFRKDLGWK (SEQ ID NO: 93) within the TGF?1 growth factor domain (e.g., the finger-1 domain). In some embodiments, the antibody or fragment thereof contacts one or more of the following residues: Tyr289 (Y); Lys294 (K); Asp295 (D) (shown in bold above). In some embodiments, such antibody binds a conformational epitope comprising one or more residues of DMELVKRKRIEAIR (SEQ ID NO: 46) and one or more residues of YIDFRKDLGWK (SEQ ID NO: 93), wherein the antibody is not Ab42.

    Systemic Sclerosis, Skin Fibrosis and Related Conditions

    [0511] In some embodiments, the subject has scleroderma. Scleroderma is a chronic, autoimmune disease in which normal tissue is replaced with dense, thick fibrous tissue. Abnormal vasculature, inflammation, and fibrosis are main characteristics of the disease. Lung fibrosis is a major cause of mortality in patients with systemic sclerosis (SSc), a form of scleroderma. Even though characteristics of the disease have been well documented, the pathogenesis of scleroderma remains largely unknown. Fibrosis of the skin due to an accumulation of collagen is a common presenting finding of the disease, and the extent of skin involvement is one way in which scleroderma or SSc is classified.

    [0512] Increased serum and tissue levels of TGF?1 have been observed in patients with scleroderma suggesting its role in the pathogenesis of fibrosis associated with the disease. Dantas et al. (Disease Markers 14 Nov. 2016) found raised active TGF?1 serum levels in SSc patients, and a significant association between active TGF?1 serum levels and vascular (digital ulcers) and fibrotic (lung and skin) manifestations in SSc patients, suggesting that raised levels could be evaluated as a marker of more advanced disease.

    [0513] Due to inherent challenges of studying scleroderma or SSc in patients, many inducible and genetic animal models have been developed for the study of initial events, genes, and other influences on manifestation of the disease. For example, tight skin 1 mice (Tsk1+/+) with a homozygous lethal mutation that causes thickened skin firmly bound to the subcutaneous tissue have proven useful for studying the efficacy of drugs that target fibrosis. Another animal model utilizes mice with double heterozygous deficiency of two transcription factors, Friend leukemia integration 1 (Fli1) and Kruppel-like factor 5 (KLF5), to mimic the epigenetic phenotype of SSc skin (Noda et al., Nat Commun. 2014; 5: 5797).

    [0514] In some embodiments, the subject also receives, or has received, one or more of Treg-enhancing agents, such as all-trans retinoic acid (ATRA), vitamin D3, indoleamine-pyrrole 2,3-dioxygenase (IDO), short-chain fatty acids (e.g., butyrate), and/or AKT/mTOR pathway inhibitors such as rapamycin.

    [0515] In preferred embodiments, the TGF?1 inhibitor is Ab42 or a variant thereof. Alternatively, in some embodiments, the TGF?1 inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the N-terminal stretch of amino acids DMELVKRKRIEAIR (SEQ ID NO: 46) within the so-called alpha-1 helix region of the prodomain of the latent proTGF?1 complex. In some embodiments, the antibody or the fragment contacts one or more of the following residues within the prodomain: Asp27 (D); Leu30 (L); Arg33 (R); Ile36 (I); Glu37 (E) (shown in bold above). Additionally or alternatively, in some embodiments, the inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the amino acid sequence YIDFRKDLGWK (SEQ ID NO: 93) within the TGF?1 growth factor domain (e.g., the finger-1 domain). In some embodiments, the antibody or fragment thereof contacts one or more of the following residues: Tyr289 (Y); Lys294 (K); Asp295 (D) (shown in bold above). In some embodiments, such antibody binds a conformational epitope comprising one or more residues of DMELVKRKRIEAIR (SEQ ID NO: 46) and one or more residues of YIDFRKDLGWK (SEQ ID NO: 93), wherein the antibody is not Ab42.

    [0516] The inhibitors, e.g., antibodies, described herein can be administered to a subject in an amount effective to treat or reduce symptoms of fibrosis. The effective amount of such an inhibitor is an amount effective to achieve both therapeutic efficacy and clinical safety in the subject. In one embodiment, an effective amount is an amount effective to reduce TGF?1 activity in the extracellular matrix. In another embodiment, an effective amount is an amount effective to reduce fibrosis in a subject. In another embodiment, the effective amount does not inhibit TGF?31-mediated immune suppression. In some embodiments, such an inhibitor, e.g., antibody, is a context-specific inhibitor that can block activation of TGF?1 that is mediated by an LTBP-containing, ECM-associated TGF?1. In some embodiments, the LTBP is LTBP1 and/or LTBP3. Assays useful for determining the efficacy of the inhibitors, e.g., antibodies, and/or compositions of the present disclosure for the alteration of fibrosis include, but are not limited to, histological assays for counting fibroblasts and basic immunohistochemical analyses known in the art.

    Cardiovascular Diseases/Ischemia

    [0517] Hypoxia (such as prolonged or chronic hypoxia) can trigger cardiac repair pathways that lead to scarring or cardiac fibrosis.

    [0518] In preferred embodiments, the TGF?1 inhibitor is Ab42 or a variant thereof. Alternatively, in some embodiments, the TGF?1 inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the N-terminal stretch of amino acids DMELVKRKRIEAIR (SEQ ID NO: 46) within the so-called alpha-1 helix region of the prodomain of the latent proTGF?1 complex. In some embodiments, the antibody or the fragment contacts one or more of the following residues within the prodomain: Asp27 (D); Leu30 (L); Arg33 (R); Ile36 (1); Glu37 (E) (shown in bold above). Additionally or alternatively, in some embodiments, the inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the amino acid sequence YIDFRKDLGWK (SEQ ID NO: 93) within the TGF?1 growth factor domain (e.g., the finger-1 domain). In some embodiments, the antibody or fragment thereof contacts one or more of the following residues: Tyr289 (Y); Lys294 (K); Asp295 (D) (shown in bold above). In some embodiments, such antibody binds a conformational epitope comprising one or more residues of DMELVKRKRIEAIR (SEQ ID NO: 46) and one or more residues of YIDFRKDLGWK (SEQ ID NO: 93), wherein the antibody is not Ab42.

    [0519] In some embodiments, the subject also receives, or has received, one or more of Treg-enhancing agents, such as all-trans retinoic acid (ATRA), vitamin D3, indoleamine-pyrrole 2,3-dioxygenase (IDO), short-chain fatty acids (e.g., butyrate), and/or AKT/mTOR pathway inhibitors such as rapamycin.

    Other Diseases and Uses

    [0520] In some embodiments, non-fibrotic conditions may be treated with the compositions comprising a LTBP-selective TGF?1 inhibitor and/or methods described herein. In preferred embodiments, the TGF?1 inhibitor is Ab42 or a variant thereof. Alternatively, in some embodiments, the TGF?1 inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the N-terminal stretch of amino acids DMELVKRKRIEAIR (SEQ ID NO: 46) within the so-called alpha-1 helix region of the prodomain of the latent proTGF?1 complex. In some embodiments, the antibody or the fragment contacts one or more of the following residues within the prodomain: Asp27 (D); Leu30 (L); Arg33 (R); Ile36 (1); Glu37 (E) (shown in bold above). Additionally or alternatively, in some embodiments, the inhibitor is an antibody which is not Ab42 and competes binding with Ab42 and binds an epitope comprising one or more residues of the amino acid sequence YIDFRKDLGWK (SEQ ID NO: 93) within the TGF?1 growth factor domain (e.g., the finger-1 domain). In some embodiments, the antibody or fragment thereof contacts one or more of the following residues: Tyr289 (Y); Lys294 (K); Asp295 (D) (shown in bold above). In some embodiments, such antibody binds a conformational epitope comprising one or more residues of DMELVKRKRIEAIR (SEQ ID NO: 46) and one or more residues of YIDFRKDLGWK (SEQ ID NO: 93), wherein the antibody is not Ab42.

    [0521] LTBP-selective TGF?1 inhibitors are contemplated to be used in conjunction with a genotoxic therapy (such as radiation therapy and chemotherapy), or in a subject exposed to a genotoxic or tissue-damaging agent (such as radiation/irradiation and carcinogens). Such use is aimed to inhibit ROS-induced TGF?1 activation without depleting Tregs and immunosuppressive macrophages which are beneficial for reducing treatment-induced or tissue-damaging agent-induced inflammation.

    [0522] Genotoxic agents such as radiation therapy and chemotherapy can induce oxidative stress involving reactive oxygen species. This can also trigger a rapid immune response (e.g., inflammation) which can lead to tissue damage and/or scarring. Without being bound by a particular theory, it is believed that this process is at least in part mediated by ROS-induced activation of TGF?1. Tregs are effective in dampening or preventing an excessive immune response and reducing fibrosis. At the same time, Tregs can promote polarization of macrophages into a more immunosuppressive phenotype. For these reasons, it is envisaged that it is beneficial to avoid the inhibition of GARP-associated and LRRC33-associated TGF?1.

    [0523] As cancer combination or adjunct therapy, the present disclosure provides a LTBP-selective TGF?1 inhibitor for use in the treatment of cancer in a subject who receives a genotoxic therapy (e.g., radiation therapy and/or chemotherapy) wherein the treatment comprises administration of an effective amount of the LTBP-selective TGF?1 inhibitor to treat the cancer. In some embodiments, the cancer comprises a solid tumor. In some embodiments, the cancer is a blood cancer. In some embodiments, the cancer is myelofibrosis, wherein optionally the myelofibrosis is primary myelofibrosis (PMF). In some embodiments, the LTBP-selective TGF?1 inhibitor and the genotoxic therapy (e.g., radiation therapy and/or chemotherapy) are used in combination for the treatment of cancer in a subject in amounts effective to treat the cancer. In some embodiments, the LTBP-selective TGF?1 inhibitor is administered to the subject prior to the subject receiving the genotoxic therapy.

    [0524] In various embodiments, the cancer to be treated with the LTBP-selective TGF?1 inhibitor may be carcinoma, wherein optionally the carcinoma is a basal cell carcinoma, squamous cell carcinoma, transitional cell carcinoma, renal cell carcinoma, adenocarcinoma. In some embodiments, the basal cell carcinoma is basal cell carcinoma of the skin. In some embodiments, the squamous cell carcinoma (SCC) is squamous cell carcinoma of the skin (cutaneous SCC), SCC of the lung, SCC of the esophagus, SCC of the head and neck. In some embodiments, the transitional cell carcinoma is a transitional cell carcinoma of the kidney. In some embodiments, the adenocarcinoma is breast adenocarcinoma, colorectal adenocarcinoma, lung adenocarcinoma, pancreatic adenocarcinoma, or prostate adenocarcinoma. Preferably, the LTBP-selective TGF?1 inhibitor is used in conjunction with a genotoxic therapy, wherein optionally the genotoxic therapy comprises radiation therapy and/or chemotherapy.

    [0525] In various embodiments, the cancer to be treated with the LTBP-selective TGF?1 inhibitor is: uterine corpus endometrial carcinoma (UCEC), thyroid carcinoma (THCA), testicular germ cell tumors (TGCT), skin cutaneous melanoma (SKCM), prostate adenocarcinoma (PRAD), ovarian serous cystadenocarcinoma (OV), lung squamous cell carcinoma (LUSC), lung adenocarcinoma (LUAD), liver hepatocellular carcinoma (LIHC), kidney renal clear cell carcinoma (KIRC), head and neck squamous cell carcinoma (HNSC), glioblastoma multiforme (GMB), esophageal carcinoma (ESCA), colon adenocarcinoma (COAD), breast invasive carcinoma (BRCA), or bladder urothelial carcinoma (BLCA).

    [0526] Antibodies or antigen-binding fragments thereof encompassed by the present disclosure may be used in the treatment of cancer, including, without limitation: myelofibrosis, melanoma, adjuvant melanoma, renal cell carcinoma (RCC), including clear cell RCC, papillary RCC, chromophobe RCC, collecting duct RCC, or unclassified RCC, bladder cancer, colorectal cancer (CRC) (e.g., microsatellite-stable CRC, mismatch repair deficient colorectal cancer), colon cancer, rectal cancer, anal cancer, breast cancer, triple-negative breast cancer (TNBC), HER2-negative breast cancer, HER2-positive breast cancer, BRCA-mutated breast cancer, hematologic malignancies, non-small cell carcinoma, non-small cell lung cancer/carcinoma (NSCLC), small cell lung cancer/carcinoma (SCLC), extensive-stage small cell lung cancer (ES-SCLC), lymphoma (classical Hodgkin's and non-Hodgkin's), primary mediastinal large B-cell lymphoma (PMBCL), T-cell lymphoma, diffuse large B-cell lymphoma, histiocytic sarcoma, follicular dendritic cell sarcoma, interdigitating dendritic cell sarcoma, myeloma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), small lymphocytic lymphoma (SLL), head and neck cancer (e.g., head and neck squamous cell cancer), urothelial cancer e.g., metastatic urothelial carcinoma), merkel cell carcinoma (e.g., metastatic merkel cell carcinoma), merkel cell skin cancer, cancer with high microsatellite instability (MSI-H), cancer with mismatch repair deficiency (dMMR), tumor mutation burden high cancer, mesothelioma (e.g., malignant pleural mesothelioma), gastric cancer, gastroesophageal junction cancer (GEJ), gastric adenocarcinoma, neuroendocrine tumors, gastrointestinal stromal tumors (GIST), gastric cardia adenocarcinoma, renal cancer, biliary cancer, cholangiocarcinoma, pancreatic cancer, prostate cancer, adenocarcinoma, squamous cell carcinoma, non-squamous cell carcinoma, cutaneous squamous cell carcinoma (CSCC), ovarian cancer, endometrial cancer, fallopian tube cancer, cervical cancer, peritoneal cancer, stomach cancer, brain cancers, malignant glioma, glioblastoma, gliosarcoma, neuroblastoma, thyroid cancer, adrenocortical carcinoma, oral intra-epithelial neoplasia, esophageal cancer, nasal cavity and paranasal sinus squamous cell carcinoma, nasopharynx carcinoma, salivary gland cancer, liver cancer, basal cell carcinoma; and hepatocellular cancer (HCC). However, any cancer (e.g., patients with such cancer) in which TGF?1 is overexpressed or is at least a predominant isoform, as determined by, for example biopsy, may be treated with an isoform-selective inhibitor of TGF?1 in accordance with the present disclosure.

    [0527] In some embodiments, isoform-specific inhibitors of TGF?1 described herein can be used to treat or prevent heterotopic ossification. Heterotopic ossification (HO) is a diverse pathologic process, defined as the formation of extraskeletal bone in muscle and soft tissues. The classic presentation of nongenetic HO is in young adults with a clear history of local trauma or surgery. HO is well documented to occur at increased frequency with certain predisposing conditions, including orthopedic surgery, bone fracture or dislocation, high-energy extremity trauma, traumatic brain and spinal cord injury and other neurologic disorders, and severe burns. See., e.g., Meyers et al., JBMR Plus. 2019 April; 3(4): e10172, incorporated by reference in its entirety herein.

    [0528] In some embodiments, isoform-specific inhibitors of TGF?1 described herein can be used to treat or prevent osteogenesis imperfecta. Osteogenesis imperfecta (01) is a group of genetic disorders that mainly affect the bones. There are at least 19 recognized forms of osteogenesis imperfecta, designated type I through type XIX. Several types are distinguished by their signs and symptoms, although their characteristic features overlap. Increasingly, genetic causes are used to define rarer forms of osteogenesis imperfecta. Type I (also known as classic non-deforming osteogenesis imperfecta with blue sclera) is the mildest form of osteogenesis imperfecta. Type II (also known as prenatally lethal osteogenesis imperfecta) is the most severe. Other types of this condition, including types III (progressively deforming osteogenesis imperfecta) and IV (common variable osteogenesis imperfecta with normal sclera), have signs and symptoms that fall somewhere between these two extremes. The milder forms of osteogenesis imperfecta, including type I, are characterized by bone fractures during childhood and adolescence that often result from minor trauma, such as falling while learning to walk. Other types of osteogenesis imperfecta are more severe, causing frequent bone fractures that are present at birth and result from little or no trauma. Additional features of these types can include blue sclera of the eyes, short stature, scoliosis, joint deformities (contractures), hearing loss, respiratory problems, and a disorder of tooth development called dentin genesis imperfecta. The most severe forms of osteogenesis imperfecta, particularly type II, can include an abnormally small, fragile rib cage and underdeveloped lungs.

    [0529] In the treatment of various conditions discussed herein where Tregs serve a beneficial (e.g., protective) function, LTBP-selective TGF?1 inhibitors such as those disclosed herein may be used in conjunction with one or more Treg-enhancing agents which are capable of promoting or enhancing the maintenance, proliferation, recruitment and/or function of Tregs. Non-limiting examples of Treg-enhancing agents include: all-trans retinoic acid (ATRA), vitamin D3, indoleamine-pyrrole 2,3-dioxygenase (IDO), short-chain fatty acids such as butyrate, and AKT/mTOR pathway inhibitors, such as rapamycin. Because Tregs dampen inflammation and/or alleviate or prevent autoimmune responses, Treg-enhancing agents may help regulate an immune response, while the LTBP-selective TGF?1 inhibitors can inhibit TGF?1 activation in the affected tissue or organ without significantly suppressing immunosuppressive Tregs and macrophages.

    Administration

    [0530] To practice the method disclosed herein, an effective amount of the pharmaceutical composition described above can be administered to a subject (e.g., a human) in need of the treatment via a suitable route, such as intravenous administration, e.g., as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerebrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, inhalation or topical routes. Commercially available nebulizers for liquid formulations, including jet nebulizers and ultrasonic nebulizers are useful for administration. Liquid formulations can be directly nebulized and lyophilized powder can be nebulized after reconstitution. Alternatively, inhibitors, e.g., antibodies, or antigen binding fragment thereof, that selectively bind a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex can be aerosolized using a fluorocarbon formulation and a metered dose inhaler, or inhaled as a lyophilized and milled powder.

    [0531] The subject to be treated by the methods described herein can be a mammal, more preferably a human. Mammals include, but are not limited to, farm animals, sport animals, pets, primates, horses, dogs, cats, mice and rats. A human subject who needs the treatment may be a human patient having, at risk for, or suspected of having a TGF?-related indication, such as those noted above. A subject having a TGF?-related indication can be identified by routine medical examination, e.g., laboratory tests, organ functional tests, CT scans, or ultrasounds. A subject suspected of having any of such indication might show one or more symptoms of the indication. A subject at risk for the indication can be a subject having one or more of the risk factors for that indication.

    [0532] As used herein, the terms effective amount and effective dose refer to any amount or dose of a compound or composition that is sufficient to fulfill its intended purpose(s), i.e., a desired biological or medicinal response in a tissue or subject at an acceptable benefit/risk ratio. For example, in certain embodiments of the present disclosure, the intended purpose may be to inhibit TGF?-1 activation in vivo, to achieve clinically meaningful outcome associated with the TGF?-1 inhibition. Effective amounts vary, as recognized by those skilled in the art, depending on the particular condition being treated, the severity of the condition, the individual patient parameters including age, physical condition, size, gender and weight, the duration of the treatment, the nature of concurrent therapy (if any), the specific route of administration and like factors within the knowledge and expertise of the health practitioner. These factors are well known to those of ordinary skill in the art and can be addressed with no more than routine experimentation. It is generally preferred that a maximum dose of the individual components or combinations thereof be used, that is, the highest safe dose according to sound medical judgment. It will be understood by those of ordinary skill in the art, however, that a patient may insist upon a lower dose or tolerable dose for medical reasons, psychological reasons or for virtually any other reasons.

    [0533] Empirical considerations, such as the half-life, generally will contribute to the determination of the dosage. For example, antibodies that are compatible with the human immune system, such as humanized antibodies or fully human antibodies, may be used to prolong half-life of the antibody and to prevent the antibody being attacked by the host's immune system. Frequency of administration may be determined and adjusted over the course of therapy, and is generally, but not necessarily, based on treatment and/or suppression and/or amelioration and/or delay of a TGF?-related indication. Alternatively, sustained continuous release formulations of an antibody that selectively binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex may be appropriate. Various formulations and devices for achieving sustained release would be apparent to the skilled artisan and are within the scope of this disclosure.

    [0534] In one example, dosages for an inhibitor, e.g., antibody, that selectively binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex as described herein may be determined empirically in individuals who have been given one or more administration(s) of the inhibitor. Individuals are given incremental dosages of the inhibitor. To assess efficacy, an indicator of the TGF?-related indication can be followed. For example, methods for measuring for myofiber damage, myofiber repair, inflammation levels in muscle, and/or fibrosis levels in muscle are well known to one of ordinary skill in the art.

    [0535] The present disclosure encompasses the recognition that agents capable of modulating the activation step of TGF?s in an isoform-specific manner, and a context-specific manner, may provide improved safety profiles when used as a medicament. Accordingly, the disclosure includes inhibitors, e.g., antibodies and antigen-binding fragments thereof, that selectively bind and inhibit activation of TGF?1, but not TGF?2 or TGF?3, thereby conferring specific inhibition of the TGF?1 signaling in vivo while minimizing unwanted side effects from affecting TGF?2 and/or TGF?3 signaling. Likewise, the disclosure includes inhibitors, e.g., antibodies and antigen-binding fragments thereof, that selectively inhibit activation of TGF?1 presented by LTBP1 and/or LTBP3, but not TGF?1 presented by GARP or LRRC33, thereby conferring specific inhibition of LTBP1/3-associated TGF?1 signaling in vivo while minimizing unwanted side effects caused by modulation of GARP-associated TGF?1 and/or LRRC33-associated TGF?1.

    [0536] In some embodiments, the inhibitors, e.g., antibodies, or antigen binding fragment thereof, as described herein, are not toxic when administered to a subject. In some embodiments, the inhibitors, e.g., antibodies, or antigen binding fragment thereof, as described herein, exhibit reduced toxicity when administered to a subject as compared to an antibody that binds to both TGF?1 and TGF?2. In some embodiments, the inhibitors, e.g., antibodies, or antigen binding fragment thereof, as described herein, exhibit reduced toxicity when administered to a subject as compared to an inhibitor that binds to both TGF?1 and TGF?3. In some embodiments, the inhibitors, e.g., antibodies, or antigen binding fragment thereof, as described herein, exhibit reduced toxicity when administered to a subject as compared to an inhibitor that binds to TGF?1, TGF?2 and TGF?3.

    [0537] Generally for administration of any of the inhibitors, e.g., antibodies, described herein, an initial candidate dosage can be about 0.5-30 mg/kg per dose, e.g., about 0.5 mg/kg, about 1 mg/kg, about 2 mg/kg, about 5 mg/kg, about 10 mg/kg, about 15 mg/kg, about 20 mg/kg, about 30 mg/kg per dose. In some embodiments, frequency of administration may be adjusted to, for example, once a week, every two weeks, every three weeks, every four weeks, every month, every six weeks, every two months, every three months, every four months, every five months, every six months, etc. For repeated administrations over several days or longer, depending on the condition, the treatment is sustained until a desired suppression of symptoms occurs or until sufficient therapeutic levels are achieved to alleviate a TGF?-related indication, or a symptom thereof.

    [0538] According to some embodiments, at least one TGF? inhibitor, e.g., antibody or antigen-binding portion thereof, described herein, is administered as one or more initial loading dose(s) followed by one or more maintenance or treatment doses. The term loading dose refers to a first dose(s) of TGF? inhibitor, e.g., antibody or antigen-binding portion thereof, which is initially used to treat a subject who may benefit from TGF? inhibition in vivo. The loading dose may be larger in comparison to the subsequent maintenance or treatment dose(s). The loading dose can be a single dose or, alternatively, a set of doses. For example, a 160 mg loading dose may be administered as a single 160 mg dose, as two doses of 80 mg each, or four doses of 40 mg each. According to some embodiments, a loading dose is subsequently followed by administration of smaller doses of TGF? inhibitor, e.g., antibody or antigen-binding portion thereof, described herein, e.g., the treatment or maintenance dose(s).

    [0539] The term maintenance dose or treatment dose is the amount of TGF? inhibitor, e.g., antibody or antigen-binding portion thereof, described herein, taken by a subject to maintain or continue a desired therapeutic effect. A maintenance dose can be a single dose or, alternatively, a set of doses. A maintenance dose is administered during the treatment or maintenance phase of therapy. In one embodiment, a maintenance dose(s) is smaller than the induction dose(s) and may be equal to each other when administered in succession.

    [0540] The term treatment phase or maintenance phase, as used herein, refers to a period of treatment comprising administration of a TGF? inhibitor, e.g., antibody or antigen-binding portion thereof, described herein, to a subject in order to maintain a desired therapeutic effect, e.g., improved symptoms associated with a TGF?-related indication as described herein.

    [0541] According to some embodiments, the loading dose is administered via intravenous administration, and the maintenance dose is administered by subcutaneous administration. For example, in an exemplary embodiment, a loading dose approach may be applicable in the clinic if the pharmacologically active dose is fairly high and it is desirable to reach a high serum exposure in a short amount of time. Accordingly, an intravenous loading dose could be administered in a medical center, followed by subcutaneous administration of maintenance doses if the antibody half-life is sufficiently long, the antibody is potent enough, and it can be formulated for subcutaneous application.

    [0542] In some embodiments, an initial loading dose might be first administered, followed by a lower maintenance dose. For example, an initial loading dose might be administered once at a dosage of about 30 mg/kg to about 90 mg/kg intravenously or subcutaneously, followed by a maintenance dosage of about 10 mg/kg to about 30 mg/kg intravenously or subcutaneously.

    [0543] In one embodiment, the antibody, or antigen-binding fragment thereof, is administered to the subject at a dosage of between 0.1 and 30 mg/kg, between 0.5 and 30 mg/kg, between 1 and 30 mg/kg, between 5 and 30 mg/kg, between 10 and 30 mg/kg, between 15 and 30 mg/kg, between 20 and 30 mg/kg, between 25 and 30 mg/kg, between 0.1 and 25 mg/kg, between 0.5 and 25 mg/kg, between 1 and 25 mg/kg, between 5 and 25 mg/kg, between 10 and 25 mg/kg, between 15 and 25 mg/kg, between 20 and 25 mg/kg, between 0.1 and 20 mg/kg, between 0.5 and 20 mg/kg, between 1 and 20 mg/kg, between 5.0 and 20 mg/kg, between 10 and 20 mg/kg, between 15 and 20 mg/kg, between 0.1 and 15 mg/kg, between 0.5 and 15 mg/kg, between 1 and 15 mg/kg, between 5 and 15 mg/kg, between 10 and 15 mg/kg, between 5.0 and 20 mg/kg, between 10 and 20 mg/kg, between 15 and 20 mg/kg, between 0.1 and 10 mg/kg, between 0.5 and 10 mg/kg, between 1 and 10 mg/kg, between 5 and 10 mg/kg, optionally, wherein the subject is administered the antibody, or antigen-binding portion thereof, twice a week, once a week, once every 2 weeks, once every 3 weeks, once a month, or every other month.

    [0544] An exemplary dosing regimen comprises administering an initial dose of about 2 mg/kg, followed by a weekly maintenance dose of about 1 mg/kg of the antibody, or followed by a maintenance dose of about 1 mg/kg every other week. However, other dosage regimens may be useful, depending on the pattern of pharmacokinetic decay that the practitioner wishes to achieve. For example, dosing from one-four times a week is contemplated. In some embodiments, dosing ranging from about 3 ?g/mg to about 2 mg/kg (such as about 3 ?g/mg, about 10 ?g/mg, about 30 ?g/mg, about 100 ?g/mg, about 300 ?g/mg, about 1 mg/kg, and about 2 mg/kg) may be used.

    [0545] Pharmacokinetics experiments have shown that the serum concentration of an inhibitor, e.g., antibody, disclosed herein (e.g., SR-AB42) remains stable for at least 7 days after administration to a preclinical animal model (e.g., a mouse model). Without wishing to be bound by any particular theory, this stability post-administration may be advantageous since the antibody may be administered less frequently while maintaining a clinically effective serum concentration in the subject to whom the antibody is administered (e.g., a human subject). In some embodiments, dosing frequency is once every week, every 2 weeks, every 4 weeks, every 5 weeks, every 6 weeks, every 7 weeks, every 8 weeks, every 9 weeks, or every 10 weeks; or once every month, every 2 months, or every 3 months, or longer. The progress of this therapy is easily monitored by conventional techniques and assays. The dosing regimen (including the antibody used) can vary over time.

    [0546] In some embodiments, for an adult patient of normal weight, doses ranging from about 0.3 to 30.00 mg/kg (e.g., about 1, 2, 5, 10, 15, 20 or 30 mg/kg) may be administered. The particular dosage regimen, e.g., dose, timing and repetition, will depend on the particular individual and that individual's medical history, as well as the properties of the individual agents (such as the half-life of the agent, and other relevant considerations).

    [0547] Suitable dosage (e.g., efficacious amount) may be determined by the level of serum concentration (exposure) of the antibody that can be achieved in a patient, based on the pharmacokinetic profile of the particular antibody. For example, about 10-350 ?g of the antibody exposure per mL of serum/blood may represent a therapeutically effective amount of the antibody. Once minimally efficacious dosage or serum exposure is determined, dosing regimen may be adjusted to achieve sufficient amount of the antibody.

    [0548] For the purpose of the present disclosure, the appropriate dosage of an inhibitor, e.g., antibody or antigen-binding fragment thereof, that selectively binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex will depend on the specific antibody (or compositions thereof) employed, the type and severity of the indication, whether the antibody is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the inhibitor, and the discretion of the attending physician. In some embodiments, a clinician will administer an inhibitor, e.g., antibody, that selectively binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex, until a dosage is reached that achieves the desired result. Administration of an inhibitor, e.g., antibody, that selectively binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex can be continuous or intermittent, depending, for example, upon the recipient's physiological condition, whether the purpose of the administration is therapeutic or prophylactic, and other factors known to skilled practitioners. The administration of an inhibitor, e.g., antibody, that selectively binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex may be essentially continuous over a preselected period of time or may be in a series of spaced dose, e.g., either before, during, or after developing a TGF?-related indication.

    [0549] As used herein, the term treating refers to the application or administration of a composition including one or more active agents to a subject, who has a TGF?-related indication, a symptom of the indication, or a predisposition toward the indication, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the indication, the symptom of the indication, or the predisposition toward the indication.

    [0550] Alleviating a TGF?-related indication with an inhibitor, e.g., antibody, that selectively binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex includes delaying the development or progression of the indication, or reducing indication's severity. Alleviating the indication does not necessarily require curative results. As used therein, delaying the development of an indication associated with a TGF?-related indication means to defer, hinder, slow, retard, stabilize, and/or postpone progression of the indication. This delay can be of varying lengths of time, depending on the history of the indication and/or individuals being treated. A method that delays or alleviates the development of an indication, or delays the onset of the indication, is a method that reduces probability of developing one or more symptoms of the indication in a given time frame and/or reduces extent of the symptoms in a given time frame, when compared to not using the method. Such comparisons are typically based on clinical studies, using a number of subjects sufficient to give a statistically significant result.

    Selection of a TGF?1 Inhibitor

    [0551] The present disclosure includes specific inhibitors of ECM-associated TGF?1 activation, e.g., antibodies, and antigen-binding fragment thereof, that selectively bind a LTBP1/3-TGF?1 complex, and which inhibit activation of TGF?1 presented in the context of LTBP1 or LTBP3. Context-specific antibodies that selectively bind a GARP-TGF?1 complex and inhibit activation of TGF?1 presented in the context of GARP have recently been described in WO 2018/013939. Isoform-specific, context-independent TGF?1 inhibitors have also been described, which bind pro/latent TGF?1 presented by LTBP1/3, GARP, or LRRC33, and inhibit the release of mature TGF?1 from the presenting molecule complex (see, e.g., WO 2017/156500, WO 2018/129329, WO 2020/014460 and WO 2020/014473. Indeed, this approach has been more recently followed by other groups (see, for example, WO 2021/039945)). The entire contents of each of the foregoing applications are incorporated herein by reference.

    [0552] The present disclosure encompasses insights into selection of the right TGF?1 inhibitor for the right patient to treat a disease condition with certain clinical features. In one aspect, the present disclosure provides use of preferred TGF?1 inhibitors suitable for a particular patient population with fibrotic conditions. Accordingly, the disclosure includes use of an LTBP1/LTBP3-proTGF?1 inhibitor in the treatment of a fibrotic condition in a subject, wherein the subject benefits from immunosuppression. This is based on the notion that at least a subset of TGF?1 activities involves immune regulation which is mediated by GARP-associated and/or LRRC33-associated TGF?1. Thus, the disclosure includes the recognition that use of TGF?1 inhibitors that also affect the immune aspect of TGF?1 effects may be detrimental for treating patients with fibrotic conditions where immunostimulation may cause exacerbation of the disease. The disclosure therefore aims at least in part to provide means of selectively inhibiting TGF?1 effects within the ECM context (e.g., LTBP-associated) while sparing TGF?1 effects associated with non-ECM contexts (e.g., immune cells, leukocytes, etc. expressing GARP or LRRC33 on cell surface), so as to prevent unwanted immunostimulation.

    [0553] In some embodiments, patient populations who benefit from both: i) inhibition of TGF?1 signaling, and, ii) immunosuppression, include those who suffer from a severe or late stage organ fibrosis and who are to receive an allograft organ transplant. The severe or late-stage organ fibrosis may be associated with IPF, CKD, and/or NASH. Such patients may have already received other therapies for treating the fibrotic disease, yet which may have failed to sufficiently treat or manage the condition. Attending physicians may determine that remaining treatment options may include allograft transplantation. Such patients may be placed in a wait list for an available organ for transplantation. Such patients may be treated with an immunosuppressant. A selective inhibitor of LTBP1/LTBP3-presented TGF?1 activation, which does not inhibit GARP-presented TGF?1 activation, can be used to treat such patients, without raising risk of triggering immunostimulation mediated by effector T cells. Similarly, following the transplantation, such patients may continue to receive the selective inhibitor of LTBP1/LTBP3-presented TGF?1 activation to avoid risk of an organ rejection.

    [0554] In some embodiments, patient populations who benefit from both: i) inhibition of TGF?1 signaling, and, ii) immunosuppression, include those who suffer from a fibrotic disorder and who have an inflammatory or autoimmune condition.

    [0555] In some embodiments, the inflammatory or autoimmune condition is associated with the fibrosis. Non-limiting examples of inflammatory or autoimmune conditions associated with fibrosis include muscular dystrophy, such as DMD.

    [0556] In other embodiments, where patient populations who benefit from both: i) inhibition of TGF?1 signaling, and, ii) immunosuppression, include those who suffer from a fibrotic disease and who have an inflammatory or autoimmune condition that is not directly associated with the fibrosis, but rather a discrete disorder.

    [0557] Such inflammatory or autoimmune conditions, whether or not directly associated with the underlining fibrotic disease or separate condition(s), may be caused by or associated with imbalance of regulatory T cells (Treg) in human autoimmune diseases. For example, such disorders that are linked to Treg dysregulation include, but are not limited to: Juvenile idiopathic arthritis; Rheumatoid arthritis (RA); Spondyloarthritis; Psoriatic arthritis; HCV mixed cryoglobulinaemia; cryoglobulinaemia; Multiple sclerosis; Autoimmune liver disease; Systemic lupus erythematodes; Immune-mediated diabetes; Myasthenia gravis; Primary Sj?gren syndrome; Kawasaki disease; and, Inflammatory bowel disease (IBD).

    [0558] Thus, LTBP1/3-sepective inhibitors of TGF?1 signaling, such as those described herein, can be used to treat patients who suffer from a fibrotic condition and inflammatory or autoimmune condition such as one or more of the disorders listed above. The LTBP1/3-sepective inhibitors of TGF?1 signaling used accordingly can treat or alleviate TGF?1-dependent fibrosis in the ECM, while sparing immune-associated TGF?1 signaling.

    [0559] Accordingly, related methods of the disclosure include methods for selecting an appropriate TGF?1 inhibitor for treating a fibrotic disorder, based on the clinical manifestations of the fibrotic disorder in a subject. In one embodiment, the disclosure provides a method of selecting an isoform-specific TGF?1 inhibitor for treatment of a fibrotic disorder in a subject. The method comprises (a) determining whether the fibrotic disorder manifests clinical presentations including fibrosis and one or more of inflammation, immune suppression, proliferative dysregulation, and need for an allograft transplant, and (b) selecting an isoform-specific, context-dependent TGF?1 inhibitor or an isoform-specific, context-independent TGF?1 inhibitor for treatment of the fibrotic disorder based on the clinical presentations determined in step (a). In another embodiment, the disclosure provides a method of treating a subject having a fibrotic disorder, comprising selecting a treatment regimen including an isoform-specific TGF?1 inhibitor for the subject, and administering the selected treatment regimen to the subject, wherein the selection comprises (a) determining whether the fibrotic disorder manifests clinical presentations including fibrosis and one or more of the following: inflammation, immune suppression, proliferative dysregulation, and need for an allograft transplant; and (b) selecting a treatment regimen comprising an isoform-specific, context-dependent TGF?1 inhibitor or an isoform-specific, context-independent TGF?1 inhibitor, based on the clinical presentations determined in step (a).

    [0560] Subjects afflicted with fibrotic disorders can display a wide range of symptoms, in addition to fibrosis. The specific combination of clinical manifestations in a subject can guide the selection of an appropriate TGF?1-inhibitory treatment regimen. For example, a context-independent, isoform-specific TGF?1 inhibitor can be used to treat the subject if the subject's clinical manifestations indicate a need for inhibition of TGF?1, without modulating the activity of TGF?2 or TGF?3. A treatment regimen including a LTBP context-specific inhibitor can be used to treat the subject if the subject's clinical manifestations indicate that inhibition of TGF?1 in the extracellular matrix would be beneficial. A LTBP context-specific inhibitor is also advantageous if the subject's clinical manifestations indicate that stimulation of immune effector cells is undesirable. A GARP context-specific inhibitor can be used to treat the subject if the subject's clinical manifestations indicate that blocking the activation/release of TGF?1 on regulatory T cells (Treg cells) would be beneficial, e.g., to prevent Treg cells from suppressing effector T cell activity. A LRRC33 context-specific inhibitor can be used to treat the subject if the subject's clinical manifestations indicate that blocking the activation/release of TGF?1 on myeloid cells, monocytes, macrophages, dendritic cells and/or microglia would be beneficial, e.g., to reverse or reduce immune suppression in the subject.

    [0561] By way of example, a subject having a fibrotic disorder may display clinical manifestations including fibrosis, inflammation, immune suppression, and proliferative dysregulation. Fibrotic disorders which commonly present with the foregoing combination of symptoms include, e.g., myelofibrosis. In this embodiment, an isoform-specific, context-independent TGF?1 inhibitor can be selected for treating the subject.

    [0562] A subject having a fibrotic disorder may display clinical manifestations including fibrosis, inflammation (e.g., autoimmune disorders), and need for an allograft transplant. Fibrotic disorders which commonly present with the foregoing combination of symptoms include, e.g., organ fibrosis, such as kidney fibrosis (e.g., fibrosis associated with chronic kidney disease), liver fibrosis (e.g., fibrosis associated with nonalcoholic steatohepatitis (NASH)), scleroderma, and lung fibrosis (e.g., fibrosis associated with idiopathic pulmonary fibrosis (IPF)). In this embodiment, a context-specific LTBP1/3-specific inhibitor is selected for treating the subject.

    [0563] In another example, a subject having a fibrotic disorder may display clinical manifestations including fibrosis and inflammation. Fibrotic disorders which commonly present with the foregoing combination of symptoms include, e.g., scleroderma. In this embodiment, a context-specific LTBP1/3-specific inhibitor is selected for treating the subject. Additional fibrotic disorders which commonly present with the foregoing combination of symptoms include, e.g., degenerative diseases, such as muscular dystrophy, e.g., Duchenne muscular dystrophy (DMD). In this embodiment, a context-specific LTBP1/3-specific inhibitor is selected for treating the subject.

    [0564] A subject having a fibrotic disorder may display clinical manifestations including immune suppression and proliferative dysregulation. Fibrotic disorders which commonly present with the foregoing combination of symptoms include, e.g., solid tumors. In some embodiments, the solid tumor is a malignant tumor. In other embodiments, the solid tumor is a benign tumor. In an exemplary embodiment, the subject has desmoplasia (e.g., pancreatic desmoplasia). In some embodiments, patients may have a solid tumor that has been assessed as inoperable or not suitable for surgical resection. Thus, in some embodiments, patients are not candidates for surgical resection of the tumor. However, TGF?1 inhibition therapy comprising a context-selective TGF?1 inhibitor of the present disclosure may reverse such non-candidate patients to be more suited for receiving a surgery.

    [0565] In some embodiments, subjects having a solid tumor are poorly responsive to cancer therapy (e.g., the tumor is resistant to the cancer therapy), such as chemotherapy, radiation therapy, CAR-T therapy and checkpoint inhibitor therapy. TGF?1 inhibition therapy comprising a context-selective TGF?1 inhibitor of the present disclosure may at least in part reverse the resistance to render the patient more responsive to the cancer therapy. In some embodiments, a combination therapy comprising both the context-selective TGF?1 inhibition therapy and the cancer therapy may synergistically treat the cancer. In some embodiments, the context-selective TGF?1 inhibition therapy administered in conjunction with the cancer therapy may reduce the required dosage of the cancer therapy to produce equivalent or improved clinical effects.

    [0566] In another exemplary embodiment, the subject has fibroids. In the foregoing embodiments, in which the fibrotic disorder displays clinical manifestations including immune suppression and proliferative dysregulation, a context-specific LTBP1/3-specific inhibitor and/or a context-specific GARP-specific inhibitor are selected for treating the subject.

    [0567] In another aspect, the disclosure provides a method of treating a subject having a fibrotic disorder with an isoform-specific, LTBP1/3-specific TGF?1 inhibitor, by selecting a subject having a fibrotic disorder manifesting clinical presentations including fibrosis and the need for an allograft transplant, and administering an effective amount of an isoform-specific, LTBP1/3-specific TGF?1 inhibitor to the subject. In one embodiment, the method comprises determining whether the fibrotic disorder manifests clinical presentations including fibrosis and the need for an allograft transplant. The LTBP1/3-specific TGF?1 inhibitor is administered to the subject if the subject exhibits symptoms including fibrosis and the need for an allograft transplant.

    [0568] In another aspect, the disclosure provides a method of treating a subject having a fibrotic disorder with an isoform-specific, context-independent TGF?1 inhibitor, by selecting a subject having a fibrotic disorder manifesting clinical presentations including fibrosis, immune suppression, and/or proliferative dysregulation, and administering an effective amount of an isoform-specific, context-independent TGF?1 inhibitor to the subject. In one embodiment, the method comprises determining whether the fibrotic disorder manifests clinical presentations including fibrosis, immune suppression, and/or proliferative dysregulation. The isoform-specific, context-independent TGF?1 inhibitor is administered to the subject if the subject inhibits symptoms including fibrosis, immune suppression, and/or proliferative dysregulation.

    [0569] Clinical manifestations including inflammation, immune suppression, proliferative dysregulation, and/or the need for an allograft transplant can be determined in a subject having a fibrotic disorder using methods and practices known in the art. Such methods include, for example, physical examination and standard diagnostic tests. In one embodiment, inflammation can be assessed by determining if a subject displays an elevated level of inflammatory biomarkers in plasma, blood, or serum. Such inflammatory biomarkers include, for example, C-reactive protein, interleukin 1 (IL-1), interleukin 6 (IL-6), tumor necrosis factor ? (TNF-?), or combinations thereof. Blood tests including erythrocyte sedimentation rate (ESR) and plasma viscosity (PV) can also indicate the presence of inflammation in a subject with a fibrotic disorder. In another embodiment, immune suppression can be assessed by determining the number and composition of a subject's blood cells, e.g., T cells, B cells, NK cells, monocytes, macrophages, etc. Immune suppression can also be assessed by determining if the subject is taking or has a history of taking immunosuppressant medications, or determining if the subject has a condition associated with immune suppression (e.g., hematological malignancies, HIV/AIDS, etc.). In another embodiment, proliferative dysregulation can be assessed using standard tests including blood tests, biopsy, and/or imaging procedures such as CT scan, ultrasound, and MRI. Other standard tests for diagnosing cancer (e.g., biomarker tests, etc.) can also be used to assess proliferative dysregulation. The need for an allograft transplant can be determined by a clinician using standard procedures. In one embodiment, the loss or partial loss of organ function, or an increased likelihood of loss of organ function, indicates the need for a transplant.

    [0570] As mentioned, the present disclosure provides selective targeting of the ECM-associated TGF?1 complexes enabled by the use of antibodies that are capable of specifically binding LTBP-presented TGF?1 precursors. While some antibodies of the present disclosure are capable of binding and inhibiting both LTBP1- and LTBP3-associated proTGF?1 complexes, others show even greater selectivity in that they only bind either LTBP1-proTGF?1 or LTBP3-proTGF?1.

    [0571] The disclosure therefore encompasses the recognition that certain patient populations may benefit from TGF?1 inhibition therapy comprising a context-selective inhibitor that is specific to LTBP1-proTGF?1.

    [0572] LTBP1 and LTBP3 are both components of the ECM, where they can display or present a latent TGF?1 precursor complex. Some observations from expression studies raise the possibility that deletion, ablation or functional inhibition of LTBP3 may cause certain toxicities. LTBP3?/? mice (as well as some human mutations) have short stature, as well as bone and dental anomalies. These phenotypes are likely associated with disruptions in development, however, but it is possible that LTBP3 plays a role in homeostasis of these tissues in adults (expression in adult bone is reported). Based on these observations, in certain clinical situations (where the disease manifests in a tissue known to express LTBP3 and associated with toxicities) or in certain patient populations, such as pediatric patients who are still in active development, it may be advisable to avoid potential toxicities of LTBP3-related inhibition. Loss of LTBP1 function does appear to be sufficient to protect against at least some forms of fibrosis, as LTBP1?/? KO mice are protected against liver fibrosis (induced by bile duct ligation). Taken together, these data raise the possibility that LTBP1-specific TGF?1 inhibition could have a superior safety profile as compared to LTBP1/3-TGF?1 inhibitors in certain situations.

    Combination Therapies

    [0573] The disclosure further encompasses pharmaceutical compositions and related methods used as combination therapies for treating subjects who may benefit from TGF?1 inhibition in vivo. In any of these embodiments, such subjects may receive combination therapies that include a first composition comprising at least one TGF?1 inhibitor, e.g., antibody or antigen-binding portion thereof, described herein, in conjunction with a second composition comprising at least one additional therapeutic intended to treat the same or overlapping disease or clinical condition. The first and second compositions may both act on the same cellular target, or discrete cellular targets. In some embodiments, the first and second compositions may treat or alleviate the same or overlapping set of symptoms or aspects of a disease or clinical condition. In some embodiments, the first and second compositions may treat or alleviate a separate set of symptoms or aspects of a disease or clinical condition. To give but one example, the first composition may treat a disease or condition associated with TGF?1 signaling, while the second composition may treat inflammation or fibrosis associated with the same disease, etc. Such combination therapies may be administered in conjunction with each other. The phrase in conjunction with, in the context of combination therapies, means that therapeutic effects of a first therapy overlaps temporarily and/or spatially with therapeutic effects of a second therapy in the subject receiving the combination therapy. Thus, the combination therapies may be formulated as a single formulation for concurrent administration, or as separate formulations, for sequential administration of the therapies.

    [0574] In preferred embodiments, combination therapies produce synergistic effects in the treatment of a disease. The term synergistic refers to effects that are greater than additive effects (e.g., greater efficacy) of each monotherapy in aggregate.

    [0575] In some embodiments, combination therapies comprising a pharmaceutical composition described herein produce efficacy that is overall equivalent to that produced by another therapy (such as monotherapy of a second agent) but are associated with fewer unwanted adverse effect or less severe toxicity associated with the second agent, as compared to the monotherapy of the second agent. In some embodiments, such combination therapies allow lower dosage of the second agent but maintain overall efficacy. Such combination therapies may be particularly suitable for patient populations where a long-term treatment is warranted and/or involving pediatric patients.

    [0576] Accordingly, the disclosure provides pharmaceutical compositions and methods for use in combination therapies for the reduction of TGF?1 protein activation and the treatment or prevention of diseases or conditions associated with TGF?1 signaling, as described herein. Accordingly, the methods or the pharmaceutical compositions further comprise a second therapy. In some embodiments, the second therapy may be useful in treating or preventing diseases or conditions associated with TGF?1 signaling. The second therapy may diminish or treat at least one symptom(s) associated with the targeted disease. The first and second therapies may exert their biological effects by similar or unrelated mechanisms of action; or either one or both of the first and second therapies may exert their biological effects by a multiplicity of mechanisms of action.

    [0577] It should be understood that the pharmaceutical compositions described herein may have the first and second therapies in the same pharmaceutically acceptable carrier or in a different pharmaceutically acceptable carrier for each described embodiment. It further should be understood that the first and second therapies may be administered simultaneously or sequentially within described embodiments.

    [0578] In one embodiment, the inhibitors, e.g., antibodies, described herein that selectively binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex can be administered with another agent that inhibits TGF?1 activity. For example, the second agent can be another context-specific TGF?1 inhibitor. In one embodiment, the combination therapy comprises (i) an inhibitor, e.g., antibody or antigen binding portion thereof, that selectively binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex, and (ii) an inhibitor, e.g., antibody or antigen binding portion thereof, that selectively binds a GARP-TGF?1 complex. In another embodiment, the combination therapy comprises (i) an inhibitor, e.g., antibody or antigen binding portion thereof, that selectively binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex, and (ii) an inhibitor, e.g., antibody or antigen binding portion thereof, that selectively binds a LRRC33-TGF?1 complex. Context-specific antibodies that selectively bind LRRC33-TGF?1 are described, for example, in U.S. 62/503,785, and context-specific antibodies that selectively bind GARP-TGF?1 are described, above. The entire contents of the foregoing applications are incorporated by reference herein. In one embodiment, the combination therapy comprises (i) an inhibitor, e.g., antibody or antigen binding portion thereof, that selectively binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex, and (ii) an context-independent inhibitor, e.g., antibody or antigen binding portion thereof, that selectively binds pro/latent TGF?1 in a complex with a presenting molecule (e.g., LTBP, GARP, and/or LRRC33). Context-independent inhibitors of TGF?1 are described, for example, in PCT/US2017/21972, the entire contents of which are incorporated herein by reference.

    [0579] The one or more anti-TGF?1 inhibitors, e.g., antibodies, or antigen binding fragment thereof, of the disclosure may be used in combination with one or more additional therapeutic agents. Examples of the additional therapeutic agents which can be used with an anti-TGF? antibody of the disclosure include, but are not limited to, a myostatin inhibitor, a VEGF agonist, an IGF1 agonist, an FXR agonist, a CCR2 inhibitor, a CCR5 inhibitor, a dual CCR2/CCR5 inhibitor, a lysyl oxidase-like-2 inhibitor, an ASK1 inhibitor, an Acetyl-CoA Carboxylase (ACC) inhibitor, a ?8 kinase inhibitor, Pirfenidone, Nintedanib, a GDF11 inhibitor, and the like.

    [0580] In some embodiments, the additional agent is a checkpoint inhibitor. In some embodiments, the additional agent is selected from the group consisting of a PD-1 antagonist, a PDL1 antagonist, a PD-L1 or PDL2 fusion protein, a CTLA4 antagonist, a GITR agonist, an anti-ICOS antibody, an anti-ICOSL antibody, an anti-B7H3 antibody, an anti-B7H4 antibody, an anti-TIM3 antibody, an anti-LAG3 antibody, an anti-OX40 antibody, an anti-CD27 antibody, an anti-CD70 antibody, an anti-CD47 antibody, an anti-41 BB antibody, an anti-PD-1 antibody, an oncolytic virus, and a PARP inhibitor. In some embodiments, the additional therapy is radiation. In some embodiments, the additional agent is a chemotherapeutic agent. In some embodiments, the chemotherapeutic agent is Taxol. In some embodiments, the additional agent is an anti-inflammatory agent. In some embodiments, the additional agent inhibits the process of monocyte/macrophage recruitment and/or tissue infiltration. In some embodiments, the additional agent is an inhibitor of hepatic stellate cell activation. In some embodiments, the additional agent is a chemokine receptor antagonist, e.g., CCR2 antagonists and CCR5 antagonists. In some embodiments, such chemokine receptor antagonist is a dual specific antagonist, such as a CCR2/CCR5 antagonist. In some embodiments, the additional agent to be administered as combination therapy is or comprises a member of the TGF? superfamily of growth factors or regulators thereof. In some embodiments, such agent is selected from modulators (e.g., inhibitors and activators) of GDF8/myostatin and GDF11. In some embodiments, such agent is an inhibitor of GDF8/myostatin signaling. In some embodiments, such agent is a monoclonal antibody that binds a pro/latent myostatin complex and blocks activation of myostatin. In some embodiments, the monoclonal antibody that binds a pro/latent myostatin complex and blocks activation of myostatin does not bind free, mature myostatin.

    [0581] For known genetic disorders, a combination therapy or adjunct therapy may include a gene therapy or RNA-based therapy aimed to normalize the gene expression of the affected gene. For example, an LTBP-selective inhibitor of TGF?1 activation provided herein (such as Ab42) may be used in the treatment of a muscular dystrophy such as DMD in a patient, wherein the patient is further treated with a gene therapy or RNA-based therapy aimed to increase the level of functional protein affected by the genetic disease (e.g., dystrophin). Similarly, an LTBP-selective inhibitor of TGF?1 activation provided herein (such as Ab42) may be used in the treatment of Alport syndrome in a patient, wherein the patient is further treated with a gene therapy or RNA-based therapy aimed to increase the level of functional protein affected by the genetic disease (e.g., collagen)

    [0582] Such combination therapies may advantageously utilize lower dosages of the administered therapeutic agents, thus avoiding possible toxicities or complications associated with the various monotherapies.

    Diagnostic and/or Prognostic Biomarkers

    [0583] A number of biomarkers have been described, alternations of which are indicative of or correlate with a or the progression of a disease. In some embodiments, the biomarkers are cellular markers. In some embodiments, such disease-associated biomarkers are useful for the diagnosis and/or monitoring of the disease progression as well as effectiveness of therapy (e.g., patients' responsiveness to the therapy). These biomarkers include a number of fibrotic markers, as well as cellular markers.

    [0584] In some embodiments, useful biomarkers include fibrotic markers. These include, without limitation: TGF?1, PAI-1 (also known as Serpine1), MCP-1 (also known as CCL2), Coil a1, Col3a1, FN1, CTGF, ?-SMA, ACTA2, Timp1, Mmp8, and Mmp9. In some embodiments, useful biomarkers are serum markers (e.g., proteins or fragments found and detected in serum samples).

    [0585] In some embodiments, an effective amount of the inhibitor may normalize, as compared to control, the levels of multiple inflammatory or fibrotic serum biomarkers as assessed following the start of the therapy, at, for example, 12-36 weeks. In some embodiments, inflammatory or fibrotic biomarkers may be used to assess severity of NAFLD (by measure levels of hepatic steatosis), select patients for treatment, and/or monitor disease progression or treatment response. For example, blood biomarkers and panels may include, but are not limited to: [0586] i) the Fatty liver index (BMI, waist circumference, serum triglycerides, and gamma-glutamyltransferase (GGT); [0587] ii) the Hepatic steatosis index (serum aspartate aminotransferase (AST):alanine aminotransferase (ALT) ratio, BMI, gender, and presence of diabetes mellitus); [0588] iii) the NAFLD liver fat score (serum ALT, HDL cholesterol, triglicerides, haemoglobin A.sub.1c and leukocyte count); [0589] iv) the SteatoTest (BioPredictive) (serum levels of total bilirubin, GGT, ?2-macroglobin, haptoglobin, ALT, apolipoprotein AI, total cholesterol, triglycerides, glucose (adjusted for age and gender) and BMI); and [0590] v) the NAFLD ridge score (serum levels of ALT, HDL cholesterol, triglycerides, haemoglobin A.sub.1c, leukocyte count, and comorbidity data (and the presence of hypertension)).

    [0591] In some embodiments, imaging biomarkers can be used to assess levels of hepatic steatosis. For example, imaging biomarkers may include but are not limited to: ultrasonography, controlled attenuation parameter (CAP), MRI-estimated proton density fat fraction (MRI-PDFF), and magnetic resonance spectroscopy (MRS).

    [0592] Liver biopsies are the current standard for diagnosis NASH, however, variability among pathologists limits the effectiveness of such diagnostic method. Accordingly, use of the Fatty Liver Inhibition of Progression (FLIP) algorithm (comprising histological steatosis, activity and fibrosis scores) may be used to improve the consistency of NASH diagnosis by biopsy. Moreover, many noninvasive biomarkers may also be useful for diagnosing and monitoring disease. Accordingly, in some embodiments, inflammatory or fibrotic biomarkers may be used to assess severity of NASH, select patients for treatment, and/or monitor disease progression or treatment response. Blood biomarkers may include: [0593] i) apoptosis markers, such as CK18 fragments, total cytokeratin and sFAS; [0594] ii) inflammatory markers, such as CRP, TNF, IL-8, and CXCL10; [0595] iii) lipid oxidation products, such as 11-HETE, 9-HODE, 13-HODE, 12-oxo-ODE, LA-13-HODE (oxNASHscore), and 11,12-diHETrE; [0596] iv) lysosomal enzymes, such as cathepsin D; and [0597] v) combination panels, such as NASHTest (BioPredictive) and NASH Diagnostics Panel (comprising, presence of diabetes mellitus, sex, BMI, and serum levels of triglyceride, CK18 fragments, and total CK18).

    [0598] In some embodiments, biomarkers and related panels may be useful in diagnosis levels of fibrosis and/or cirrhosis, select patients for treatment, and/or monitor disease progression or treatment response. For example, noninvasive tests of liver fibrosis and cirrhosis include, but are not limited to: AST:ALT ratio, AST:platelet ratio index, fibrosis-4 index (age, AST, ALT, and platelet count), NAFLD fibrosis score (age, BMI, impaired fasting glucose and/or diabetes, AST ALT, platelet count, and albumin), BARD score (AST, ALT, BMI, and diabetes).

    [0599] Specific fibrosis markers and panels may also be useful, and include, but are not limited to: hyaluronic acid; PIIPNP; Pro-C3; TIMP1; Laminin; enhanced liver fibrosis (ELF) panel (PIINP, hyaluronic acid, TIMP1); FibroTest (GGT, total bilirubin, ?2m, apolipoprotein AI, and haptoglobin); and FibroMeter NAFLD (body weight, prothrombin index, ALT, AST, ferritin, and fasting glucose). Imaging biomarkers for liver fibrosis may include, but are not limited to: FibroScan (TE), point shear wave elastography (pSWE) (aka acoustic radiation force impulse (ARFI)), 2D-3D SWE, magnetic resonance elastography (MRE), and multiparameteric MRI.

    [0600] In some embodiments, serum levels of liver enzymes such as alkaline phosphatase (ALP), alanine aminotransferase (ALT), aspartate tramsaminase (AST), or G-glutamyl transferase (GGT) may be measured as indicators of fibrosis in the liver.

    [0601] In some embodiments, genetic and genomic biomarkers may be useful in assessing NAFLD risk and severity, which include the assessment of various SNPs, cell-free ncRNAs, and miRNAs. A comprehensive review of known genetic and genomic biomarkers, as well as the above-discussed blood biomarkers, panels, imaging biomarkers, and tests are summarized in VWS Wong et al., Nat Rev Gastroenterol Hepatol. 2018 August; 15(8):461-478; the contents of which are incorporated herein by reference in its entirety.

    Assays for Detecting a LTBP1-TGF?1 Complex and/or a LTBP3-TGF?1 Complex

    [0602] In some embodiments, methods and compositions provided herein relate to a method for detecting a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex in a sample obtained from a subject. As used herein, a subject refers to an individual organism, for example, an individual mammal. In some embodiments, the subject is a human. In some embodiments, the subject is a non-human mammal. In some embodiments, the subject is a non-human primate. In some embodiments, the subject is a rodent. In some embodiments, the subject is a sheep, a goat, a cattle, poultry, a cat, or a dog. In some embodiments, the subject is a vertebrate, an amphibian, a reptile, a fish, an insect, a fly, or a nematode. In some embodiments, the subject is a research animal. In some embodiments, the subject is genetically engineered, e.g., a genetically engineered non-human subject. The subject may be of either sex and at any stage of development. In some embodiments, the subject is a patient or a healthy volunteer.

    [0603] In some embodiments, a method for detecting a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex in a sample obtained from a subject involves (a) contacting the sample with an antibody that selectively binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex under conditions suitable for binding of the antibody to the antigen, if the antigen is present in the sample, thereby forming binding complexes; and (b) determining the level of the antibody bound to the antigen (e.g., determining the level of the binding complexes).

    [0604] In one embodiment, a screening assay that utilizes biotinylated latent TGF?1 complexes immobilized onto a surface is utilized, which allows for the activation of latent TGF? by integrins, e.g., by providing a tether. Other, non-integrin activators could also be tested in that system. A readout can be measured through reporter cells or other TGF?3-dependent cellular responses.

    Diagnostics and Monitoring

    [0605] According to some embodiments, therapeutic methods that include TGF?1 inhibition therapy may comprise diagnosis of a TGF?1 indication and/or selection of patients likely to respond to such therapy. Additionally, patients who receive the TGF?1 inhibitor may be monitored for therapeutic effects of the treatment, which typically involves measuring one or more suitable parameters which are indicative of the condition and which can be measured (e.g., assayed) before and after the treatment and evaluating treatment-related changes in the parameters. For example, such parameters may include levels of biomarkers present in biological samples collected from the patients. Biomarkers may be RNA-based, protein-based, cell-based and/or tissue-based. For example, genes that are overexpressed in certain disease conditions may serve as the biomarkers to diagnose and/or monitor the disease or response to the therapy. Cell-surface proteins of disease-associated cell populations may serve as biomarkers. Such methods may include the direct measurements of disease parameters indicative of the extent of the particular disease, such as extent of fibrosis. Any suitable sampling methods may be employed, such as serum/blood samples, biopsies, and imaging. The biopsy may include tissue biopsies and liquid biopsies.

    Circulating/Circulatory Latent-TGF?

    [0606] According to the present disclosure, circulating latent TGF? may serve as a target engagement biomarker. Where an activation inhibitor is selected as a therapeutic candidate, for example, such biomarker may be employed to evaluate or confirm in vivo target engagement by monitoring the levels of circulating latent TGF? before and after administration. In various embodiments, the present disclosure provides methods of treating a TGF?-related disorder, comprising monitoring the level of circulating latent TGF? (e.g., TGF?1) in a sample obtained from a patient (e.g., in the blood, e.g., plasma and/or serum, of a patient) receiving a TGF? inhibitor. The level of circulating latent TGF? may be monitored alone or in conjunction with one or more of the biomarkers disclosed herein (e.g., MDSCs). In certain embodiments, the TGF? inhibitor may be administered alone or in conjunction with an additional therapy. In some embodiments, the treatment may be administered to a subject afflicted with a fibrotic disorder (e.g., organ fibrosis). In some embodiments, the TGF? inhibitor is a TGF?1-selective antibody or antigen-binding fragment thereof described herein. In some embodiments, the TGF? inhibitor is an isoform-non-selective TGF? inhibitor (such as low molecular weight ALK5 antagonists, neutralizing antibodies that bind two or more of TGF?1/2/3, e.g., GC1008 and variants, antibodies that bind TGF?1/3, and ligand traps, e.g., TGF?1/3 inhibitors). In some embodiments, the TGF? inhibitor is an integrin inhibitor (e.g., an antibody that binds to ?V?3, ?V?5, ?V?6, ?V?8, ?5?1, ?IIb?3, or ?8?1 integrins, and inhibits downstream activation of TGF?. e.g., selective inhibition of TGF?1 and/or TGF?3).

    [0607] In various embodiments, circulating latent TGF? (e.g., latent TGF?1) may be measured in a sample obtained from a subject (e.g., whole blood or a blood component). In various embodiments, the circulating latent TGF? levels (e.g., latent TGF?1) may be measured within 1, 2, 3, 4, 5, 6, 7, 8, 10, 12, 14, 16, 18, 21, 25, 28, 30, 35, 40, 45, 48, 50, or 56 days following administration of the TGF? inhibitor to a subject, e.g., up to 7 days after administration of a therapeutic dose of a TGF? inhibitor. In some embodiments, the circulating latent TGF? levels (e.g., latent TGF?1) may be measured by any method known in the art (e.g., ELISA).

    [0608] In various embodiments, a method of treating a fibrotic disorder or other TGF-? elated disorder comprises administering a TGF? inhibitor (e.g., an anti-TGF?1 antibody, e.g., an isoform-selective activation inhibitor of TGF?1 such as Ab42, or derivatives thereof,) to a patient in need thereof and confirming the level of target engagement by the inhibitor. In some embodiments, determining the level of target engagement comprises determining the levels of circulating latent TGF? (e.g., TGF?1) in a sample obtained from a patient (e.g., in the blood or a blood component of a patient) receiving the TGF? inhibitor. In some embodiments, an increase in circulating latent TGF? (e.g., TGF?1) after administration of the TGF inhibitor indicates target engagement. In some embodiments, an increase in circulating latent TGF? (e.g., TGF?1) of at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9-fold, at least 10-fold, or more, after administration of the TGF inhibitor indicates target engagement. In various embodiments, the present disclosure also provides methods of using circulating latent TGF? levels (e.g., TGF?1 levels) as a predictive biomarker, i.e., to predict therapeutic response, as well as for informing further treatment decisions (e.g., by continuing treatment if an increase is observed).

    [0609] In one aspect of the current disclosure, levels of circulating latent TGF? are determined to inform treatment and predict therapeutic efficacy in subjects administered a TGF? inhibitor such as a TGF?1-selective inhibitor described herein (e.g., Ab42, or derivatives thereof). In certain embodiments, a TGF? inhibitor (e.g., an isoform-selective activation inhibitor of TGF?1 such as Ab42, or derivatives thereof) is administered alone or concurrently (e.g., simultaneously), separately, or sequentially with an additional therapy, such that the amount of TGF?1 inhibition administered is sufficient to increase the levels of circulating latent-TGF? (e.g., latent TGF?1) as compared to baseline circulating latent-TGF? levels. Circulating latent-TGF? levels may be measured prior to or after each treatment such that an increase in circulating latent-TGF? levels (e.g., latent TGF?1) following the treatment indicates therapeutic efficacy. For instance, circulating latent-TGF? levels (e.g., latent TGF?1) may be measured prior to and after the administration of a TGF? inhibitor and an increase in circulating latent-TGF? levels (e.g., latent TGF?1) following the treatment predicts therapeutic efficacy. In some embodiments, treatment is continued if an increase is detected. In certain embodiments, circulating latent-TGF? levels may be measured prior to and following administration of a first dose of a TGF? inhibitor such as a TGF?1 inhibitor described herein (e.g., an isoform-selective activation inhibitor of TGF?1 such as Ab42, or derivatives thereof), and an increase in circulating latent-TGF? levels (e.g., latent TGF?1) following the administration predicts therapeutic efficacy and further warrants administration of a second or more dose(s) of the TGF? inhibitor. In some embodiments, circulating latent-TGF? levels (e.g., latent TGF?1) may be measured prior to and after a combination treatment of TGF? inhibitor such as a TGF?1-selective inhibitor (e.g., an isoform-selective activation inhibitor of TGF?1 such as Ab42, or derivatives thereof, and an additional therapy, administered concurrently (e.g., simultaneously), separately, or sequentially, and a change in circulating latent-TGF? levels following the treatment predicts therapeutic efficacy. In some embodiments, treatment is continued if an increase is detected. In some embodiments, the increase in circulating latent-TGF? levels following a combination treatment may warrant continuation of treatment.

    [0610] In various embodiments, the current disclosure encompasses a method of treating a TGF?-related disorder, e.g., a fibrotic disorder, comprising administering a therapeutically effective amount of a TGF? inhibitor (e.g., an isoform-selective activation inhibitor of TGF?1 such as Ab42, or derivatives thereof), to a subject having a TGF?-related disorder, wherein the therapeutically effective amount is an amount sufficient to increase the level of circulating latent TGF? (e.g., latent TGF?1). In certain embodiments, the TGF? inhibitor is a TGF? activation inhibitor. In certain embodiments, the TGF? inhibitor is a TGF?1 inhibitor. In some embodiments, the TGF? inhibitor is an isoform-selective activation inhibitor of TGF?1 such as Ab42, or derivatives thereof. In certain embodiments, the circulating latent TGF? is latent TGF?1. In some embodiments, the therapeutically effective amount of the TGF? inhibitor (e.g., an isoform-selective activation inhibitor of TGF?1 such as Ab42, or derivatives thereof) is between 0.1-30 mg/kg per dose. In some embodiments, the TGF? inhibitor is dosed weekly, every 2 weeks, every 3 weeks, every 4 weeks, monthly, every 6 weeks, every 8 weeks, bi-monthly, every 10 weeks, every 12 weeks, every 3 months, every 4 months, every 6 months, every 8 months, every 10 months, or once a year.

    [0611] In various embodiments, circulating latent TGF? (e.g., latent TGF?1) may be measured in a sample obtained from a subject (e.g., whole blood or a blood component). In some embodiments, circulating latent TGF?1 may be measured using an enzyme-linked immunosorbent assay (ELISA) that measures total free TGF?1 after acid treatment. Analysis of latent TGF-?1 by TGF-?1 ELISA first requires dissociation of TGF-?1 from the latent complex, e.g. by acidification of samples. The ELISA then measures total TGF-?1, equivalent to dissociated latent TGF-?1, in addition to any free TGF-?1 present prior to acidification, which is known to be only a small fraction of circulating TGF?1. In certain embodiments, the level of circulating latent TGF? (e.g., latent TGF?1) following administration of a TGF? inhibitor is increased by at least two-fold (e.g., at least 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold and 10-fold) as compared to circulating latent TGF? levels prior to the administration.

    [0612] In certain embodiments, circulating total TGF? levels (e.g., latent and mature TGF?1) may be used to monitor target engagement and pharmacological activity of a TGF? inhibitor in a subject receiving a TGF? inhibitor therapy (e.g., an isoform-selective activation inhibitor of TGF?1 such as Ab42, or derivatives thereof). In certain embodiments, circulating total TGF? levels (e.g., latent and mature TGF?1 levels) may be measured prior to and after administration of a first dose of TGF? inhibitor such that an increase in circulating TGF? levels of at least two-fold (e.g. at least 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more) in following the administration indicates target engagement (e.g., binding of the TGF? inhibitor to human large latent proTGF?1 complex). In certain embodiments, circulating latent TGF? levels (e.g., latent TGF?1) may be measured prior to and after administration of a first dose of TGF? inhibitor such that an increase in circulating latent TGF? levels (e.g., latent TGF?1) following the administration indicates therapeutic efficacy. In certain embodiments, treatment is continued if an increase in circulating latent-TGF? levels (e.g., latent TGF?1) following administration of a TGF? inhibitor is detected. In some embodiments, total TGF?1 in a blood sample (e.g., serum) comprises both latent and mature forms, the former of which representing vast majority of circulatory TGF?1. Acid treatment of the sample releases mature growth factor from the latent complex. Well-known assays such as ELISA can then be used to measure the amount of free TGF?1. Alternatively, reagents such as antibodies that specifically bind the latent form of TGF?1 may be employed to specifically measure circulatory latent TGF?1. In some embodiments, circulating latent-TGF? levels (e.g., latent TGF?1) may be measured prior to and after administration of a first dose of a TGF? inhibitor, and an increase in circulating latent-TGF? levels (e.g., latent TGF?1) after the administration indicates target engagement and/or treatment response, and/or further warrants administration of a second or more dose(s) of the TGF? inhibitor. In another embodiment, circulating latent-TGF? levels may be measured prior to and after administration of a first dose of a TGF? inhibitor such as a TGF?31-selective inhibitor, and an increase in circulating latent-TGF? levels after the administration indicates target engagement and/or treatment response, and/or further warrants continuation of treatment. In various embodiments, a TGF? inhibitor such as a TGF?1-selective inhibitor, an isoform-non-selective inhibitor (e.g., low molecular weight ALK5 antagonists), neutralizing antibodies that bind two or more of TGF?1/2/3 (e.g., GC1008 and variants), antibodies that bind TGF?1/3, and/or an integrin inhibitor (e.g., an antibody that binds to ?V?3, ?V?5, ?V?6, ?V?8, ?5?1, ?IIb?3, or ?8?1 integrins, and inhibits downstream activation of TGF?. e.g., selective inhibition of TGF?1 and/or TGF?3).

    [0613] In some embodiments, the processing of blood to serum activates platelets and leads to release of large pools of latent TGF?1, which confounds the measurements. Therefore, according to some embodiments, it is preferable to measure circulating levels of TGF?1 in plasma instead of in serum. Accordingly, in preferred embodiments, circulating TGF? (e.g., circulating latent-TGF? levels (e.g., latent TGF?1)) is measured in plasma samples collected from the subject.

    Cell-Based Assays for Measuring TGF? Activation

    [0614] Activation of TGF? (and inhibition thereof by a TGF? test inhibitor, such as an antibody) may be measured by any suitable method known in the art. For example, integrin-mediated activation of TGF? can be utilized in a cell-based assay, such as the CAGA12 luciferase assay, described in more detail herein.

    [0615] The development of novel context-dependent cell-based assays of TGF?1 activation is described in U.S. Provisional Patent Application No. 62/538,476 and the corresponding International Application Pub. No. WO 2019/023661, each of which are incorporated by reference in their entirety herein. Previous assay formats could not differentiate between the activation of proTGF?1 presented by endogenous presenting molecules and the activation of proTGF?1 presented by exogenous LTBPs. By directly transfecting integrin-expressing cells, the novel assays disclosed in International Application Pub. No. WO 2019/023661, and used herein, establish a window between endogenous presenter-proTGF?1 activity and exogenous LTBP-proTGF?1 activity.

    [0616] As opposed to GARP- or LRRC33-proTGF?1 complexes, which are presented on the surface of cells, LTBP-proTGF?1 complexes are embedded in the extracellular matrix. Thus, the assay plate coating is an important component of the assay when assessing activation of proTGF?1 in complex with LTBP (e.g., LTBP1/3). In this regard, it has been shown, fibronectin and fibrillin are two ECM components that appear to be critical for LTBP association with the matrix and activation of latent TGF? (Robertson et al., Matrix Biol. 2015 September; 47:44-53). For example, LTBP3 ECM-incorporation appears to be dependent on fibrillin expression in both in vitro and in vivo models (Zilberberg et al., J Cell Physiol. 2012; 227(12):3828-3836).

    [0617] On the other hand, LTBP1 has been shown to interact with fibrillin microfibrils and fibronectin via its C- and N-termini, respectively (Dallas et al., J Biol Chem. 2005; 280(19):18871-18880; Fontana et al., FASEB J. 2005; 19(13):1798-1808; and Kantola et al., Exp Cell Res. 2008; 314(13):2488-2500). Moreover, in the absence of fibrillin, LTBP1 still co-localizes with fibronectin fibers (Robertson et al., Matrix Biol. 2015 September; 47:44-53). LTBP1 has also been shown to interact with ADAMTSL2 and 3 (Sengle et al., PloS Genet. 2012; 8(1):e1002425), IGFBP3 (Gui and Murphy, Mol Cell Biochem. 2003; 250(1-2):189-195), fibulin-4 (Massam-Wu et al., J Cell Sci. 2010 Sep. 1; 123(Pt 17):3006-18), and heparin (Chen et al., J Biol Chem. 2007; 282(36):26418-26430).

    [0618] Beyond traditional ECM components/proteins, tissue transglutaminase (TG2) may also play a critical role in TGF? localization in the ECM. TG2 is known to catalyze inter- and intramolecular isopeptide bonds which cross-link ECM fibrils, effectively stiffening the ECM and protecting the ECM from proteolytic degradation (Benn et al., Current Opinion in Biomedical Engineering., 2019, https://doi.org/10.1016/j.cobme.2019.06.003). Moreover, TG2 can cross-link LTBP1 to the ECM, thus promoting a matrix reservoir of TGF? (Nunes et al., J Cell Biol. 1997; 136(5):1151-1163).

    [0619] Accordingly, the N-terminus of LTBPs may be covalently bound to the ECM via an isopeptide bond, the formation of which may be catalyzed by transglutaminases. The structural integrity of the ECM is believed to be important in mediating LTBP-associated TGF?1 activity. For example, stiffness of the matrix can significantly affect TGF?1 activation. In addition, incorporating fibronectin and/or fibrillin in the scaffold may significantly increase the LTBP-mediated TGF?1 activation. Similarly, presence of fibronectin and/or fibrillin in LTBP assays (e.g., cell-based potency assays) may increase an assay window.

    [0620] Accordingly, a cell-based assay for measuring TGF?1 activation may comprise the following components: i) a source of TGF? (recombinant, endogenous or transfected); ii) a source of activator such as integrin (recombinant, endogenous, or transfected); and iii) a reporter system that responds to TGF? activation, such as cells expressing TGF? receptors capable of responding to TGF? and translating the signal into a readable output (e.g., luciferase activity in CAGA12 cells or other reporter cell lines). In some embodiments, the reporter cell line comprises a reporter gene (e.g., a luciferase gene) under the control of a TGF?3-responsive promoter (e.g., a PAI-1 promoter). In some embodiments, certain promoter elements that confer sensitivity may be incorporated into the reporter system. In some embodiments, such promoter element is the CAGA12 element. Reporter cell lines that may be used in the assay have been described, for example, in Abe et al., (1994) Anal Biochem. 216(2): 276-84, incorporated herein by reference.

    [0621] In some embodiments, the assay comprises a single-cell system, in which each of the aforementioned assay components are is provided from the same source (e.g., the same cell). In some embodiments, such cell-based assay comprises a single-cell reporter assay, in which the three assay components are expressed by a single clone, preferably as a stably transfected cell line. In some embodiments, the cell line is an LN229 cell line, which is a human glioblastoma cell line. In some embodiments, the cell line is stably transfected with proTGFb1, ?v?8 integrin, TGF? receptors, and CAGA12 promoter operatively linked to a reporter gene, preferably the luciferase gene. In preferred embodiments, proTGF?1 expression is driven by an inducible promoter, wherein optionally the inducible promoter is regulated by tetracycline. In preferred embodiments, the inducible promoter is doxycycline-inducible.

    [0622] In some embodiments, the assay comprises a two-cell system, in which two of the aforementioned assay components are provided from the same source, and a third assay component is provided from a different source. In some embodiments, all three assay components are provided from different sources. For example, in some embodiments, the integrin and the latent TGF? complex (proTGF? and a presenting molecule) are provided for the assay from the same source (e.g., the same transfected cell line). In some embodiments, the integrin and the TGF are provided for the assay from separate sources (e.g., two different cell lines, a combination of purified integrin and a transfected cell). When cells are used as the source of one or more of the assay components, such components of the assay may be endogenous to the cell, stably expressed in the cell, transiently transfected, or any combination thereof. In some embodiments, the assay is performed in a tissue culture plate or dish. In some embodiments, the tissue culture plate or dish is coated with a component of the extracellular matrix (ECM). In some embodiments, the tissue culture plate or dish is coated with fibronectin and/or fibrillin. In some embodiments, the cell-based assay further comprises a fourth component comprising a source of TG2. In some embodiments, the TG2 component is provided from the same, or different, source as any one of the above-mentioned components.

    [0623] A skilled artisan could readily adapt such assays to various suitable configurations. For instance, a variety of sources of TGF? may be considered. In some embodiments, the source of TGF? is a cell that expresses and deposits TGF? (e.g., a primary cell, a propagated cell, an immortalized cell or cell line, etc.). In some embodiments, the source of TGF? is purified and/or recombinant TGF? immobilized in the assay system using suitable means. In some embodiments, TGF? immobilized in the assay system is presented within an extracellular matrix (ECM) composition on the assay plate, with or without de-cellularization, which mimics fibroblast-originated TGF?. In some embodiments, TGF? is presented on the cell surface of a cell used in the assay. Additionally, a presenting molecule of choice may be included in the assay system to provide suitable latent-TGF? complex. One of ordinary skill in the art can readily determine which presenting molecule(s) may be present or expressed in certain cells or cell types. Using such assay systems, relative changes in TGF? activation in the presence or absence of a test agent (such as an antibody) may be readily measured to evaluate the effects of the test agent on TGF? activation in vitro.

    [0624] Such cell-based assays may be modified or tailored in a number of ways depending on the TGF? isoform being studied, the type of latent complex (e.g., presenting molecule), and the like. In some embodiments, a cell known to express integrin capable of activating TGF? may be used as the source of integrin in the assay. Such cells include SW480/?6 cells (e.g., clone 1E7). In some embodiments, integrin-expressing cells may be co-transfected with a plasmid encoding a presenting molecule of interest (such as GARP, LRRC33, LTBP (e.g., LTBP1 or LTBP3), etc.) and a plasmid encoding a pro-form of the TGF? isoform of interest (such as proTGF?1). After transfection, the cells are incubated for sufficient time to allow for the expression of the transfected genes (e.g., about 24 hours), cells are washed, and incubated with serial dilutions of a test agent (e.g., an antibody). Then, a reporter cell line (e.g., CAGA12 cells) is added to the assay system, followed by appropriate incubation time to allow TGF? signaling. After an incubation period (e.g., about 18-20 hours) following the addition of the test agent, signal/read-out (e.g., luciferase activity) is detected using suitable means (e.g., for luciferase-expressing reporter cell lines, the Bright-Glo reagent (Promega) can be used). In some embodiments, Luciferase fluorescence may be detected using a BioTek (Synergy H1) plate reader, with autogain settings.

    Kits for Use in Alleviating Diseases/Disorders Associated with LTBP1/3-TGF3

    [0625] The present disclosure also provides kits for use in alleviating diseases/disorders associated with a TGF?-related indication. Such kits can include one or more containers comprising an inhibitor, e.g., antibody, or antigen binding portion thereof, that selectively binds to a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex, e.g., any of those described herein.

    [0626] In some embodiments, the kit can comprise instructions for use in accordance with any of the methods described herein. The included instructions can comprise a description of administration of the inhibitor, e.g., antibody, or antigen binding portion thereof, that selectively binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex to treat, delay the onset, or alleviate a target disease as those described herein. The kit may further comprise a description of selecting an individual suitable for treatment based on identifying whether that individual has the target disease. In still other embodiments, the instructions comprise a description of administering an antibody, or antigen binding portion thereof, to an individual at risk of the target disease.

    [0627] The instructions relating to the use of inhibitors, e.g., antibodies, or antigen binding fragment thereof, that selectively bind a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex generally include information as to dosage, dosing schedule, and route of administration for the intended treatment. The containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses. Instructions supplied in the kits of the disclosure are typically written instructions on a label or package insert (e.g., a paper sheet included in the kit), but machine-readable instructions (e.g., instructions carried on a magnetic or optical storage disk) are also acceptable. The label or package insert can indicate that the composition is used for treating, delaying the onset and/or alleviating a disease or disorder associated with a TGF?-related indication. Instructions may be provided for practicing any of the methods described herein.

    [0628] The kits of this disclosure can be provided in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like. Also contemplated are packages for use in combination with a specific device, such as an inhaler, nasal administration device (e.g., an atomizer) or an infusion device such as a minipump. A kit may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). The container may also have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). At least one active agent in the composition is an inhibitor, e.g., antibody, or antigen binding portion thereof, that selectively binds a LTBP1-TGF?1 complex and/or a LTBP3-TGF?1 complex, as described herein.

    [0629] Kits may optionally provide additional components such as buffers and interpretive information. Normally, the kit comprises a container and a label or package insert(s) on or associated with the container. In some embodiments, the disclosure provides articles of manufacture comprising contents of the kits described above.

    [0630] Ab42-YTE characterization. In summary, (1) Ab42-YTE transient expression resulted in similar titer compared to the parental antibody. (2) Both Ab42 and Ab42-YTE antibodies tolerated 3? freeze thaw without aggregation. (3) The Ab42-YTE antibody shows enhanced binding to human FcRn by Octet? measurements. See FIG. 18. (4) The melting temperature of Ab42-YTE is decreased compared with Ab42. See FIG. 19.

    [0631] The present disclosure is further illustrated by the following examples, which are not intended to be limiting in any way. The entire contents of all references, patents and published patent applications cited throughout this application, as well as the Figures, are hereby incorporated herein by reference.

    Example 1: Effects of LTBP-TGF?1 Antibodies on Adenine-Induced Kidney Injury and Fibrosis in a Rat Model

    [0632] The objective of this study was to evaluate the effects of therapeutically administered Ab42 on adenine-induced kidney injury and fibrosis in Sprague-Dawley rats. Ab42 is described in WO 2020/160291 A2, incorporated by reference in its entirety herein. This antibody binds and inhibits LTBP1-presented proTGF? or LTBP3-presented proTGF? at high affinities (at least nanomolar range) but does not bind and inhibit immune cell-associated TGF?, e.g., GARP- or LRRC33-presented proTGF?1, or the binding is below meaningful levels, e.g., at least fifty times affinities for the LTBP complexes over GARP or LRRC33 complex.

    [0633] As shown in FIG. 2, Ab42 human Fab binding to human TGF?1 complexes was highly specific for (1) LTBP1-proTGF?, (2) LTBP3-proTGF?, and had picomolar monovalent affinities as measured by BIACORE?. Ab42 has ?100 fold binding selectivity for human LTBP complexes of TGF?1 compared to GARP or LRRC33 complexes. The binding profile of Ab42 has been shown to be similar for human and cyno antigens, and the data have been consistent when comparing fab (monovalent) to mab (divalent).

    [0634] This antibody can selectively inhibit activation of TGF? in a context-dependent manner, such that they selectively bind, thereby inhibiting the TGF? signaling axis associated with the extracellular matrix, including selective inhibitors of matrix-associated, e.g., LTBP1-associated or LTBP3-associated or both, TGF? activation. The inhibitors do not inhibit activation of TGF?1 associated with immune cell function, mediated by GARP or LRRC33. The improved antibodies encompassed by this disclosure have affinities towards human LTBP1-proTGF?1 or human LTBP3-proTGF?1 in at least a nanomolar range, i.e., 1?10.sup.?9M to 10?10.sup.?9M. Such antibodies also have affinities towards murine LTBP1-proTGF?1 or murine LTBP3-proTGF?1 in at least a nanomolar range, i.e., 1?10.sup.?9M to 10?10.sup.?9M.

    [0635] Animals were enrolled to groups in a balanced design such that an approximately equal number of animals were enrolled per group.

    [0636] Three endpoints initially measured the efficacy of Ab42: (1) kidney function (reduction of plasma blood urea nitrogen, creatinine, etc.); (2) hydroxyproline levels; and (3) picosirius red (PSR) staining. In all measurements, the inventors observed efficacy with all the inhibitory antibodies. Note that (2) hydroxyproline levels and (3) picosirius red staining both measure collagens, the accumulation of which is a hallmark of fibrosis. The former (2) hydroxyproline levels is more reflective of new collagen synthesis. The latter (3) picosirius red staining detects some collagens present in the tissue. The inventors saw clearer effects in (2) hydroxyproline levels and (3) less clear, but still significant, effects in picosirius red staining, which is detecting both the existing and accumulated collagen.

    [0637] (1) Kidney function. Ab42 reduced plasma blood urea nitrogen and creatinine in the efficacy analysis. In Sprague Dawley rats, an adenine diet induced increased levels of plasma blood urea nitrogen (BUN) and creatinine over analysis duration (FIG. 21). Thus, kidney fibrosis was induced by adenine diet. The inventors observed a significant reduction in levels of plasma blood urea nitrogen and creatinine with Ab42 treatment starting on day 35. The two positive controls small molecule inhibitors of TGF? type I (ALK5) receptor (ALK5i) and a context-independent reference antibody showed decrease in blood urea nitrogen and creatinine starting at day 28. No significant reduction was observed with Ab1 D11 and Ab46.

    [0638] Ab1 D11 was used as a pan-TGF? positive control antibody. Ab1 D11 is TGF beta-1,2,3 Monoclonal Antibody (1 D11), mouse Anti-TGF-?1, 2, 3 Monoclonal Antibody (THERMOFISHER? Product #MA5-23795).

    [0639] A context-independent reference antibody, also described in WO 2020/160291 A2, incorporated he reference in its entirety herein, was used as a positive control.

    TABLE-US-00013 Ab42 monovalent (Fab) affinities Human antigen complex Ab42 K.sub.D (nM) LTBP1-proTGF?1 0.38 LTBP3-proTGF?1 0.57 GARP-proTGF?1 144.61 LRRC33-proTGF?1 134.25

    [0640] Methods: Animals: Male, Sprague Dawley (SD) rats, weighing 275-300 g at arrival. The model afforded functional as well as fibrotic readouts. The dosing strategy used a loading dose and a maintenance dose. The method was to administer 0.25% adenine for two weeks, then collect Group 1 after two weeks. Then, the rats were randomized using body weight. Rats were enrolled to groups in a balanced design such that an approximately equal number of animals were enrolled per group. Serum creatinine and blood urea nitrogen (BUN) were assayed using standard clinical chemistry methods. Next, the rats received a loading dose of 0.25% adenine+treatment for six weeks. Following, the maintenance dose was twice weekly (BIW) by intraperitoneal administration. Testing for the serum exposure from Ab42 was weekly at trough levels. The rats were tested for creatinine and blood urea nitrogen (BUN) using standard clinical chemistry assays and measured from plasma, which was collected weekly from the rats. Fixed blood was taken weekly at the same time as serum or plasma collection. The last Ab dose was given on day 54, two days before necropsy. [0641] Frequency: Twice/week. [0642] Time points (days): 14 (pre-dose), 21, 28, 35, 42, 49, and 56.

    Dosing Schedule

    [0643] Loading Dose: Day 14.

    Maintenance Dose: Days 18, 21, 25, 28, 32, 35, 39, 42, 46, 49, and 54.

    Sample Collection

    [0644] Groups 1 & 3-10: Days 21, 28, 35, 42, and 49 (immediately prior to next dose).

    [0645] Groups 1 & 3-10: Day 56 (two days post-final dose).

    [0646] Other tests performed included picosirius red staining, Col1 immunohistochemistry [using anti-Collagen I antibody [COL-1], Abcam, Cambridge, CB2 0AX, UK (catalogue #ab6308)], and pSmad2 immunohistochemistry (kidney-cortex).

    [0647] Material for Ab42 pharmacokinetics/pharmacodynamics analysis. Immediately after the rats were sacrificed, tissue was taken from the rats and snap-frozen tissue for hydroxyproline testing, TGF? testing, and testing for other markers. The table below summarizes the design of the Rat adenine efficacy analysis study described herein.

    TABLE-US-00014 Study Design Rat adenine efficacy analysis design Loading Maintenance No. of Group dose dose Dose animals no. Diet Test material (mg/kg) (mg/kg) regimen (males) 1 0.25% No treatment N/A N/A 10 adenine 2 0.25% Antibody buffer N/A 2x/IP 10 adenine weekly 3 Chow No treatment N/A N/A 10 4 0.25% HuNeg-rIgG1 90 30 2x/IP 15 5 adenine Ab1D11 N/A 5 weekly 15 6 context- N/A 15 15 independent reference antibody 7 Ab42 90 30 15 8 Ab42 30 10 15 11 Vehicle N/A BID days 15 12 GS-490470 N/A 1.0 1-56 15

    [0648] (2) Hydroxyproline reduction was observed with TGF?1 specific inhibitors. Immediately after the rats were sacrificed, tissue for hydroxyproline testing was taken from the rats and snap-frozen. Hydroxyproline levels were determined in pulverized kidney tissue.

    [0649] Hydroxyproline levels are indicative of the fibrotic phenotype. The efficacy analysis used 30 mg/kg/week. In WO 2020/160291 A2, incorporated by reference in its entirety herein, the inventors had tested 30 mg/kg/week and saw reduced hydroxyproline levels and p-Smad2/3 in choline-deficient high fat diet (CDHFD) mice and Alport syndrome mice.

    [0650] In subsequent analyses, the inventors tested an adenine-induced kidney fibrosis model and saw efficacy as well. Here, much lower doses of Ab42 were tested (as low as 3 mg/kg) and effects were still observed.

    [0651] Rats on the adenine diet over seven weeks showed an increase in kidney hydroxyproline content. A significant reduction of hydroxyproline in all TGF?1 selective antibody treated groups and in ALK5i groups. These results are shown in FIG. 10.

    [0652] (3) Picrosirius red. Picrosirius red staining was also carried out; however the results were not conclusive and further testing will be carried out.

    [0653] The inventors generated a picosirius red quantitation analysis from an idiopathic pulmonary fibrosis-precision cut lung slice (IPF-PCLS) analysis. An example of picosirius red-based in vitro binding assay is provided in EXAMPLE 9 of WO 2020/160291 A2, incorporated by reference in its entirety herein. Fab fragments of Ab42 and other antibodies which are activation inhibitors of TGF?1 were used in this EXAMPLE. As illustrated in the EXAMPLE, these antibodies have sub-nanomolar K.sub.D and OFF rates that are ?5?10.sup.4/seconds). A picosirius red/serum exposure correlation for Ab42. See FIG. 6.

    TABLE-US-00015 Significance by unpaired T-test compared to HuNeg picosirius red staining p-value context-independent reference 0.0202 antibody 15 mg/kg Ab42 10 mg/kg 0.0354 Ab42 30 mg/kg 0.0068

    [0654] The inventors also compared Alk5i administration to vehicle. The statistical significance was maintained.

    TABLE-US-00016 Group N/group Animal # Compound and Dose 6 n = 15 (217-231) context-independent reference antibody 15 mg/kg 7 n = 15 (232-246) Ab42 30-10 mg/kg 8 n = 15 (247-261) Ab42 90-30 mg/kg

    Results

    [0655] An adenine diet over 8 weeks induced kidney damage and fibrosis in rats (data not shown). During the course of the study, average body weight and food consumption in the treatment groups did not significantly change. As shown in FIG. 10, an anti-fibrotic response was achieved by selectively targeting LTBP-TGF?1 complexes with Ab42, administered at a loading dose of 30 mg/kg and maintenance dose of 10 mg/kg and at loading dose of 90 mg/kg and maintenance dose of 30 mg/kg. FIG. 10 (top) is a graph that shows quantitation of picosirius red (PSR) staining of collagen fibers (by percent (%)) in fibrotic kidneys. FIG. 10 (bottom) is a graph that shows quantitation of hydroxyproline (HYP) content as a measurement of collagen levels (by percent (%)) in fibrotic kidneys. An adenine diet induced increase in kidney PSR staining and in HYP content. As shown in FIG. 10, there was a significant reduction of fibrosis with Ab42, a LTBP/TGF?1-specific antibody, and efficacy was observed at both dose levels, An antifibrotic response was observed with TGF?1 context-independent inhibitors and ALK5i. Treatment with second pan-TGF? positive control 1 D11-rIgG1 was not antifibrotic.

    [0656] An immunohistochemical (IHC) analysis was carried out to determine the amount of phosphorylated Smad2 (active Smad2) in fibrotic kidney samples after treatment with Ab42 (FIG. 22). pSmad2-positive nuclei were assayed at 48 hours after antibody treatment. There was a partial suppression of pSmad2 by Ab42 in efficacy study, which was similar to the partial reduction of pSmad2 observed in the adenine PK/PD study (shown below). Treatment with the second pan-TGF? positive control 1 D11-rIgG1 was not antifibrotic. These results indicated that alternative PD marker(s) for Ab42 would be useful.

    PK Simulation Provided Rationale for Loading Dose Approach in Rat Adenine Efficacy Study

    [0657] Dose accumulation in previous adenine studies required three weeks of treatment. Several rounds of dosing were required to achieve dose stacking in previous adenine repeat-dose efficacy studies using Ab42. Based on PK simulation (not shown), it was found that the loading dose approach would help achieve the serum exposure that was needed to engage the target within first week of dosing. Thus, a loading dose strategy was used to achieve consistent serum exposure over treatment duration. Based on this strategy, the average serum exposure for Ab42 is shown in FIG. 23A. The PSR/serum exposure correlation for Ab42 is shown in FIG. 23B. These results demonstrated that Ab42 serum exposures of ?200 ug/mL can achieve significant reduction in PSR in fibrotic kidneys.

    [0658] Taken together, the results from these studies demonstrated that targeting LTBP-TGF?1 complexes with Ab42 elicited an anti-fibrotic response. An anti-fibrotic response was achieved with Ab42 in rat adenine (kidney) model. The picrosirius red staining, hydroxyproline, and decline in kidney function (plasma blood urea nitrogen and creatinine) significantly improved. These in vivo pharmacological results constitute proof-of-biology that targeting LTBP-TGF?1 complexes elicits an anti-fibrotic response.

    [0659] Using these results as guidance, administering Ab42 can result in evidence of anti-fibrotic response in idiopathic pulmonary fibrosis (IPF) precision cut lung slices (for the lung acquisition phase), as described in Example 10.

    Example 2: Rat Adenine Pharmacokinetics/Pharmacodynamics (PK/PD) Analysis

    [0660] The objective of this study was to evaluate the effects of therapeutically administered context-specific TGF?1 antibodies on adenine-induced kidney injury and fibrosis in Sprague-Dawley rats. The results described herein demonstrated that the rat adenine kidney model provided biological evidence that targeting LTBP-TGF?1 complexes is anti-fibrotic.

    [0661] Male Sprague-Dawley rats (275-300 g in weight on arrival) were put on an adenine diet for 8 weeks. Each test group of animals consisted of 3 groups of 8 rats (total of 24 rats). After 8 weeks, the animals were randomized based on body weight, serum BUN, and serum creatinine. Animals were given a single dose of antibody on Day 1, at a dosage as in indicated in the Study Design, below. Endpoints were phosphoSmad2 immunohistochemistry (pSmad2-IHC) hydroxyproline assay (HYP) and antibody exposure. During the course of the study, average body weight and food consumption in the treatment groups did not significantly change (not shown). Further, it was confirmed that all animals had a similar course of disease progression by assessment of hydroxyproline levels (not shown). The study design is shown in the Table below.

    TABLE-US-00017 Study Design Diet: Control Diet: 0.9% Ca, 0.6% P/Envigo/TD.170417. 0.25% Adenine diet: Envigo/TD.180493. Doses/Route/ Control diet: p.o./Ad lib day 0 through endpoint. 0.25% Frequency: Adenine diet: p.o./Ad lib day 0 through endpoint. p.o. = oral route of administration. Dose Control diet: Ad lib access. 0.25% Adenine diet: Ad lib Volume: access. Compound Control diet: 20 kg (pellet form). 0.25% Adenine diet: Requirement: 210 kg (pellet form).
    Time course: The rat tissue (kidney-cortex) collection was a serum/blood collection @6, 24, 48, and 96 hours.

    [0662] The small molecule inhibitors of TGF? type I (ALK5) receptor (ALK5i) were dosed two hours pre-necropsy.

    TABLE-US-00018 Study Design Tissue Therapeutic Dose level Dosing Collection No. Group Diet agent (mg/kg) frequency (hours) animals 1 Chow N/A N/A N/A 96 8 2 0.25% HuNeg-hIgG4 60 Day 1 24, 48, 96 3 ? 8 (24) 3 Adenine Ab42-hIgG4 60 Day 1 24, 48, 96 3 ? 8 (24) 4 Ab42-hIgG4 30 Day 1 24, 48, 96 3 ? 8 (24) 5 Ab42-hIgG4 10 Day 1 24, 48, 96 3 ? 8 (24) 6 Ab42-rlgG1 30 Day 1 24, 48, 96 3 ? 8 (24) 10 GS-490470 10 Once 2-hour pre- 8 necropsy

    Results

    [0663] As shown in FIG. 24, exposure with Ab42 was dose-proportional and maintained across all time points. FIGS. 25A and 25B show the results of immunohistochemical (IHC) analysis to determine the amount of phosphorylated Smad2 (active Smad2) in fibrotic kidney samples after treatment with Ab42. FIGS. 25A and 25B show that LTBP-selective inhibition was not sufficient to suppress pSMAD using the methods tested here. One hypothesis is that only a few cells, or a subset of cells, are responsible for driving fibrosis and/or there is a temporal factor involved in driving fibrosis, that is not captured in a one-time-point data.

    [0664] This is in contrast to when a context independent TGF?1 inhibitor was employed, there was a significant reduction of pSmad2-positive nuclei. Thus, Ab42 differentiates from context-independent TGF?1 inhibition in vivo, even at high serum exposure. It can be concluded from these results that context-independent TGF?1 inhibition is required to substantially suppress Smad2 phosphorylation. Similar efficacy observed compared to context independent TGF?1 and ALK5i suggesting that fibrotic response is driven by LTBP presented TGF?1.

    Minimal Effective Serum Exposure

    [0665] The results herein indicated that minimal effective serum exposure was significantly lower than in previous rodent fibrosis models. In Alport kidneys, the minimal effective serum exposure of Ab42 was approximately 13 ?g/mL. In the rat adenine kidney model, the minimal effective serum exposure of Ab42 was approximately 200 ?g/mL. In the rat CDHFD liver model, the minimal effective serum exposure of Ab42 was approximately 340 ?g/mL.

    Example 3: Rat Kidney Gene Expression Analysis from Adenine Efficacy Study

    [0666] Experimental groups correspond to those in Example 1, and all tissue samples were obtained from the same. All cortical tissue from the right kidney was harvested and immediately flash-frozen in liquid nitrogen, and stored at ?80? C. Approximately 200 mg of powdered tissue was analyzed.

    Materials:

    [0667] MAGMAX? mirVana? Total RNA Isolation Kit: ThermoFisher? (Cat #A27828) [0668] High Capacity cDNA Reverse Transcription Kit: Applied Biosystems by Thermo Fisher Scientific? (Cat #4368813) [0669] TaqMan Fast Advanced Master Mix: Applied Biosystems by Thermo Fisher Scientific? (Cat #4444557) [0670] QuantStudio 6 Flex from Applied Biosystems by Life Technologies?

    [0671] The gene panel used was as follows:

    TABLE-US-00019 Thermo Cat# Thermo Cat# ACTB Rn00667869_m1 IL-6 Rn01410330_m1 HPRT Rn01527840_m1 LOXL2 Rn01466080_m1 CCL2/MCP1 Rn00580555_m1 LRRC32/GARP Rn01510975_m1 COL1a1 Rn01463848_m1 LTBP1 Rn00572098_m1 COL3a1 Rn01437681_m1 LTBP3 Rn01501879_m1 CTGF Rn01537279_g1 MMP2 Rn01538170_m1 CD68 Rn01495634_g1 MMP9 Rn00579162_m1 TIMP1 Rn01430873_g1 NRROS/LRRC33 Rn01439286_m1 LCN2 Rn00590612_m1 SERPINE1/PAI-1 Rn01481341_m1 HAVCR1/ Rn00597703_m1 TGF?1 Rn00572010_m1 KIM1 TNFa Rn01525859_g1 TGF?2 Rn00676060_m1 FN1 Rn00569575_m1 TGF?3 Rn00565937_m1 IL-1b Rn00580432_m1 THBS1 Rn01513693_m1

    [0672] RNA Isolation: RNA isolation was prepared according to manufacturer's (ThermoFisher?) protocol as follows: [0673] tissue samples were lysed [0674] size of tissue (in mg) to be homogenized was determined amount of Lysis Binding Mix needed to homogenize the tissue was determined [0675] Lysis Binding Mix was prepared [0676] tissue added to the prepared Lysis Binding Mix. [0677] tissue sample homogenized using standard homogenization procedures. [0678] Bind the RNA to the RNA Binding Beads [0679] Vortexed the lysates and transferred 100 ?L to a separate well in a MAGMAX? Express-96 Deep Well Plate. [0680] (Optional) Added 10 ?L of chloroform to each well. [0681] Covered the plate and shake. [0682] Added 100 ?L of isopropanol to each sample, covered the plate, and shake. [0683] Added 20 ?L of the prepared Binding Beads Mix to each sample and shake. [0684] Proceeded immediately to Wash, rebind, and elute the RNA. [0685] Set up the processing plates [0686] Washed, rebinded, and eluted the RNA [0687] Ensured that the instrument was set up for processing with the deep well magnetic head and selected the program on the instrument. [0688] Started the run and loaded the prepared processing plates in their positions when prompted by the instrument. [0689] Loaded the sample plate (containing lysate, isopropanol, and Binding Beads Mix) at position 1 when prompted by the instrument. [0690] When prompted by the instrument (30-35 minutes after the initial start): [0691] Removed the DNase Plate from the instrument. [0692] Added 50 ?L of Rebinding Buffer and 100 ?L of isopropanol to each sample well. Added Rebinding Buffer and isopropanol immediately after the prompt, to prevent excessive drying of any beads that are still captured on the Tip Comb. [0693] Loaded the DNase Plate back onto the instrument, and pressed Start. [0694] At the end of the run (approximately 45 minutes after the initial start), removed the Elution Plate from the instrument and sealed immediately with a new MICROAMP? Clear Adhesive Film.
    cDNA Synthesis: [0695] Pipetted 14 ul RNA samples into designated wells of 96 well semi-skirted PCR plate. [0696] Prepared+RT Reaction Mix according to manufacturer instructions and number of samples. [0697] Pipetted 14 ul prepared+RT Reaction into each sample well; total volume of 28 ul. [0698] Plate was sealed and centrifuged at 2,000?g for 2 min. [0699] Plate was placed into thermocycler and reaction conditions were set as follows:

    TABLE-US-00020 25? C. 37? C. 85? C. 4? C. 5 min 120 min incubation min ? [0700] Plate was stored at ?20 C
    qPCR: [0701] Prepare designated genes according to TagMan? Fast Advanced Master Mix manufacturer instructions. [0702] 9 ul of master mix/probe was added per well, in duplicates, into MICROAMP? Optical 96-w reaction plate. [0703] 1 ul cDNA sample was added to designated wells. Plate was sealed and centrifuged at 2,000?g for 1 min. [0704] Plate was run on QuantStudio 6 Flex; reaction conditions as follows:

    TABLE-US-00021 Hold Cycles (40 cycles) 20 sec @ 95? C. 1 sec @ 95? C. 20 sec @ 60? C.

    Results

    [0705] TGF?3-related genes analyzed included TGF?1, TGF?2, TGF?3, LTBP1, LTBP3, LRRC32 (GARP), LRRC33, Serpine1 (PAI-1), and Thbs1 (thrombospondin). Fibrotic genes analyzed included Coil a1, Fn1, Mmp2, Mmp9, Col3a1, Loxl2, Ctgf, Timp1, and Kim1. Inflammatory genes analyzed included CD68, MCP-1 (CCL2), IL-6, TNF?, IL-1?, and NGAL. Gene expression was tested at 10, 30 and 60 mg/kg at 24, 48 and 96 hours after Ab42 treatment.

    [0706] It was found that there was a significant reduction of TGF? related and pro-fibrotic genes with Ab42 treatment. As shown in FIG. 26 and FIG. 27, treatment with Ab42 reduced TGF? related genes Serpine 1 and Thrombospondin 1 (Thbs1), respectively. There was a strong induction of profibrotic gene expression (e.g., col1a1, Fn1, Loxl2, ctgf, MMP2 and MMP9, shown in FIG. 27) in the adenine model, and a reduction of pro-fibrotic genes was seen with treatment with LTBP-TGF?1 specific inhibitor Ab42 at the tested doses.

    [0707] Upregulation of pro-inflammatory genes was measured in damaged kidneys (FIG. 28). As shown in FIG. 28, treatment with Ab42 reduced II-1b, II-6, and Tnf? (not shown) gene expression. CD68 is a macrophage marker accumulation of which indicates inflammation. Work by Meng et al. (Cell Death and Disease (2016) 7 e2495, incorporated by reference in its entirety herein) suggested that accumulation of CD68+macrophages in fibrotic kidney may be associated with macrophage-to-miofibroblast transition which leads to increased collagen deposit. Results demonstrated that there was no effect on Cd68 mRNA levels by Ab42, indicating that selective targeting and inhibition of LTBP-associated TGF?31 did not cause macrophage accumulation at the site of fibrosis.

    [0708] A reduction of TGF? ligands and presenting molecules was observed with Ab42 treatment (FIG. 29). As shown in FIG. 29, there was a significant reduction of TNF? and TGF? ligands with Ab42 treatment. Interestingly, TNF? gene expression was increased upon treatment with pan-TGF? inhibitor (1 D11) but did not significantly increase upon treatment with an isoform-selective TGF?1 inhibitor alone, demonstrating that Ab42 does not exacerbate inflammatory gene expression to the same degree as pan-TGF? inhibitors. A significant reduction of Ltbp1 and Col3a1 genes (FIG. 30) Ltbp3 and Garp genes was also found after multiple treatments with Ab42.

    [0709] Unexpectedly, neither of the pro-fibrotic genes Havcr/KIM1 or Lcn2/NGAL were reduced by treatment with Ab42 at any of the doses (FIG. 31).

    Example 4: Rat Kidney Gene Expression Analysis from Adenine PK/PD Study

    [0710] Experimental groups correspond to those in Example 2, and all tissue samples were obtained from the same. All cortical tissue from the right kidney was harvested and immediately flash-frozen in liquid nitrogen, and stored at ?80? C. Approximately 200 mg of powdered tissue was analyzed.

    [0711] Methods are carried out as described in Example 3, above.

    Results

    [0712] FIG. 32 shows consistent suppression of Fn1 gene with Ab42. Treatment with Ab42 at 30 mg/kg showed suppression of Fn1 at all timepoints. There was no reduction by Ab42 at 30 mg/kg but significant reduction with 60 mg/kg Ab42. There was no effect observed with ALK5i.

    [0713] FIG. 33 shows reduction of Col3a1 with the treatment of Ab42 at 48 and 96 hrs. Treatment with Ab42 at 30 mg/kg showed suppression of Col3a1 at 48 hrs and 96 hrs. Only at 96 hrs does Ab42 at 60 mg/kg reduce Col3a1 gene expression. No reduction was observed with any timepoints for Coil a1 with Ab42 (not shown). There was no effect observed with ALK5i.

    [0714] A reduction in pro-inflammatory genes was observed with II-6 and II-1b (FIGS. 34 and 35, respectively). This suggested that targeting the LTBP-TGF?1 complexes in the ECM may affect surrounding inflammatory cells.

    [0715] FIG. 36 shows that there was a reduction of GARP gene After Single Dose of Ab42. Treatment with Ab42-IgG1 at 30 mg/kg showed suppression of Garp at all timepoints. Similar to previous that 60 mg/kg of Ab42-IgG4 reduced Garp at 96 hrs. GARP is expressed not only on activated Tregs but also endothelial cells. Potentially Ab42 could be inhibiting Garp gene expression in endothelial cells.

    [0716] FIG. 37 shows that there was a reduction of Ltbp3 gene with treatment of Ab42. Treatment with Ab42 at 30 mg/kg showed suppression of Ltbp3 at all timepoints. There was no induction of Ltbp1 gene when compared to normal chow (not shown).

    [0717] Surprisingly, LTBP-selective inhibition did not significantly affect Thbs (FIG. 38), Col1a1 (FIG. 39), CD68 (FIG. 40) Col3A1, NGAL, lox12 (FIG. 41), MMP2 (FIG. 42), MMP9 (FIG. 43), Serpine1, Timp1, and TGF?1, 2 and 3 and LTBP1 expression with the exception of the highest dose tested, 60 mg/kg, at 96 hours.

    [0718] Unexpectedly, a pro-fibrotic gene, KIM1, was not affected by LTBP-selective inhibition at all doses and time-points tested (FIG. 44), in contrast to what was observed with a context-independent inhibitor, where KIM1 gene expression was almost reduced to baseline.

    [0719] Context-independent inhibition was also shown to increase expression of LRRC33 (FIG. 45), whereas pan-inhibition did not. Additionally, it was demonstrated that LTBP-selective inhibition did not demonstrate significant changes in LRRC33 expression, in contrast with a reference antibody that inhibited TGF?1 in a context-independent manner.

    [0720] Finally, it was demonstrated that LTBP-selective inhibition did not exacerbate inflammatory markers such as TNF? (FIG. 46), as compared to a pan-TGF? inhibitor, which did increase TNF? expression.

    Example 5: Determination of Safety Profile in Sub-Chronic Mouse Toxicology Analysis

    [0721] A previous twelve-week mouse toxicology analysis with a context-independent reference antibody showed treatment-related, non-adverse findings with TGF?1 inhibition. This analysis was used to provisionally determine a maximally tolerated dose.

    [0722] The inventors are currently performing a thirteen-week, repeat-dose, non-GLP, sub-chronic mouse toxicology analysis as a risk assessment for hyperplastic pathology.

    [0723] Drugs broadly targeting TGF? (pan-TGF? inhibitors) demonstrated dose-limiting toxicities in preclinical analyses, including heart, ovaries, and epithelial toxicities.

    [0724] Goal: A further study was performed to determine if selectively targeting the LTBP-TGF?1 complex leads to an improved safety profile, e.g., in the peritoneum (stomach, pancreas and kidneys), heart, and ovaries. [0725] Design: Species: CD-1 mice (8-10-week-old; 30-40 g) [0726] CD-1 mice selected as tox species based on substantial historical data [0727] Class effect-related findings have been documented in CD-1 mice [0728] Group Size. n=16/sex [0729] Route: IP [0730] Dosing Frequency: 3 times/week [0731] TK Time points: [0732] Day 1:1, 4, 24, 72, 96 and 168 hours. [0733] Day 29: predose, 4 and 24 hours. [0734] Day 85: predose, 1, 4, 24, 96 and 168 hours. [0735] Endpoints: Clinical observations, body weight, food consumption, ophthalmic observations.

    [0736] Organ weights and gross pathology.

    [0737] Clinical and microscopic pathology (hearts serial sectioning to capture all 4 valves as described by O'Brien et al. (2011)), incorporated by reference in its entirety herein. Study design is shown in the Table below:

    TABLE-US-00022 Study Design Dose mg/kg Number of Number of T.A (3X Animals in Tox Animals in TK Group (hIgG4) weekly) Males Females Males Females 1 Vehicle 0 16 16 3 3 2 Ab42 10 16 16 24 24 3 Ab42 30 16 16 24 24 4 Ab42 100 16 16 24 24

    Example 6: Ab42 Dose Exposure Data

    [0738] Variability in exposure in between animals. See FIG. 4 for results of 10 mg/kg.

    [0739] In the case of average animal exposure, dose response is not observed with time, with exposure of 171 ?g/mL at twenty-one days and exposure of 193 ?g/mL at fifty-six days.

    [0740] Variability in exposure in between animals. See FIG. 5 for results of 30 mg/kg.

    [0741] In case of average animal exposure, an increase dose response was observed over time, with a lower exposure at twenty-one days (?355 ?g/mL) and a higher exposure at fifty-six days (?500 ?g/mL).

    Example 7: Pharmacokinetics Simulation Provides Rationale for Loading Dose Approach in Rat Adenine Efficacy Analysis. Serum Exposures that are Efficacious in the Rat Adenine Model can be Clinically Feasible

    [0742] In a previous pharmacokinetics simulation analysis, Ab42 required serum exposures of ?340 ?g/mL to reduce pSmad2 in CDHFD (liver) single dose analysis. See WO 2020/160291 A2, incorporated by reference in its entirety herein. These results suggested that a once every 2 weeks (Q2W) intravenous (IV) dosing regimen was required to achieve ?400 ?g/mL serum exposure.

    [0743] Several rounds of dosing were required to achieve dose stacking in previous adenine repeat-dose efficacy analysis.

    [0744] Possibly due to target-mediated drug disposition (TMDD), the phenomenon in which a drug binds with high affinity to its pharmacological target site (such as a receptor) to such an extent that this affects its pharmacokinetic characteristics.

    [0745] A recent adenine efficacy study demonstrated that pharmacologically active exposure may be lower. Serum exposures of ?200 ?g/mL led to anti-fibrotic efficacy, as measured by picrosirius red staining and hydroxyproline assays.

    [0746] A well-behaved antibody (t.sub.1/2=twenty-eight days) can be dosed subcutaneous QW to reach 164 ?g/mL steady state serum exposure. An extended half-life may enable a loading dose approach combined with subcutaneous maintenance dosing. Based on pharmacokinetics simulation, loading dose approach achieves the serum exposures needed to engage the target within first week of dosing.

    Example 8: Antibody Discovery and In Vitro Pharmacology. H/DX-MS Data Elucidating the Epitope of Ab42

    [0747] H/DX-MS provides insights into the binding region of lead antibodies for context-dependent TGF?binding.

    [0748] The H/DX-MS workflow can be followed using the mass spectroscopy technology performed at the University of Massachusetts, Amherst. Using these methods, human LTBP1-ProTGF?1 showed good peptide coverage.

    [0749] A deuterium uptake heat map was produced to show the flexibility profile of human LTBP1-ProTGF?1 across the region of coverage. An Ab42 Fab shows strong H/DX protection within the ?1 helix of the LAP of proTGF?1. The binding region of Ab42 in the ?1 helix within the LAP of pro-TGF?1 shows sequence diversity. See WO 2020/160291 A2, incorporated by reference in its entirety herein.

    [0750] The Ab42 binding profile. Ab42 binds the pro-TGF?1 C4S region only, with no observed binding to proTGF?2, proTGF?3, or TGF?1 growth factor only. Ab42 exhibits greater than 100-fold specificity for LTBP presented pro-TGF?1 over GARP and LRRC33 complexes. Ab42 binds with similar low nM K.sub.D to both pro-TGF?1 and LTBP(1/2)-pro-TGF?1. These binding data suggested that the epitope of the antibody is likely within the pro-TGF?1, consistent with H/DX-MS data for Ab42.

    Example 9: Inhibition of TGF? Signaling by LTBP-TGF?1 Antibodies in a Genetic Model of Alport Syndrome

    [0751] Alport Syndrome (Mouse) Kidney Fibrosis Pharmacokinetics/Pharmacodynamics Analysis

    [0752] The murine Col4a3?/? model is an established genetic model of autosomal recessive Alport syndrome. Alport mice lack a functional collagen 4A3 gene (Col4A3?/?) and therefore cannot form normal type IV collagen trimers, which require a3, a4, and a5 chains. Col4a3?/? mice develop fibrosis in the kidney consistent with renal fibrosis in human patients, including interstitial fibrosis and tubular atrophy, and Col4a3?/? mice develop end-stage renal disease (ESRD) between 10 and 30 weeks of age, depending on the genetic background of the mouse. The structural and functional manifestation of renal pathology in Col4a3?/? mice, combined with the progression to ESRD make Col4a3?/? mice an ideal model to understand kidney fibrosis. Previous reports point to the importance of the TGF? signaling pathway in this process, and treatment with either ?v?6 integrin, a known activator of TGF?, or with a TGF? ligand trap has been reported to prevent renal fibrosis and inflammation in Alport mice (Hahm et al., (2007) The American Journal of Pathology, 170(1): 110-125).

    [0753] Ab42 was tested for its ability to inhibit or mitigate renal fibrosis in Alport mice as follows.

    [0754] F1 offspring from Col4a3+/?males on a 129/Sv genetic background crossed to Col4a3+/?females on a C57/B16 genetic were employed for the study. These mice typically exhibit proteinuria by 4-5 weeks old and typically progress to ESRD by 14-15 weeks old, providing a good therapeutic window for testing efficacy of treatment.

    [0755] It is well documented that TGF? receptor activation leads to a downstream signaling cascade of intracellular events, including phosphorylation of SMAD2/3. Therefore, the ability of Ab42 antibody treatment to inhibit TGF? signaling may be assessed in kidney lysate samples by measuring relative phosphorylation levels of SMAD2/3 by immunohistochemistry (IHC) according to the manufacturer's instructions.

    [0756] Targeting latent TGF?s via its latency-associated peptide (LAP) or prodomain creates multiple handles for selectivity.

    [0757] Eleven-week-old mice were treated with a single dose of antibody. Mouse tissue was collected after forty-eight hours. Treatment with Ab42 significantly reduce pSmad2 in Alport syndrome mouse kidneys (not shown).

    Example 10: Testing of LTBP-TGF?1 Antibodies in Human Idiopathic Pulmonary Fibrosis (IPF) Precision-Cut Lung Slices

    [0758] Precision Cut Lung Slices (PCLuS) from explanted human IPF lung tissue are physiologically and structurally representative of the tissue architecture and cellular composition of the diseased lung. Testing potential therapeutic targets and interrogating mechanisms underpinning disease pathophysiology in human PCLuS allows the assessment of their effectiveness and relevance to the clinical situation, overcoming many of the limitations of widely employed in vivo rodent models and in vitro 2D cell culture methodologies.

    [0759] To date, the main problems with using human lung PCLuS has been the loss of metabolic and structural viability of the tissue within a relatively short timeframe (reported to be as little as 8 hrs in some studies) and the use of poorly characterised PCLuS from normal tissue collected from patients undergoing tumor resection. The IPF model is an ex-vivo model, where PCLuS are prepared from human donor IPF lungs, and maintain viability and functionality for at least 7 days ex-vivo. These IPF-PCLuS maintain their inflammatory and fibrotic phenotype in ex-vivo culture and these responses can be attenuated by Pirfenidone and Nintedanib, first-generation approved IPF therapies. This approach is expected to have better translatability to human disease because the extracellular matrix architecture is maintained during ex vivo culture of tissue slices. In this model, the progression of fibrosis in culture is driven by TGF? signaling.

    [0760] The following studies were carried out to determine if selectively targeting LTBP-TGF?1 complexes elicits an anti-fibrotic response in human IPF tissue slices.

    PCLuS Preparation and Culture

    [0761] PCLuS were prepared from biopsy confirmed, explanted IPF human lung tissue collected at the time of lung transplantation. All PCLS were sectioned from one area of the lung, then pooled into a single petri-dish and then loaded into culture plates (n=2). PCLS were rested for 48 hours to allow the post-slicing stress period to elapse before experimentation. Treatment started with test articles as shown in the table below, after 48 hrs of resting period. Media was collected every 24 hrs to measure soluble proteins over time and replenished with new media plus test articles.

    [0762] All PCLuS were harvested at 168 hours.

    Study Groups

    [0763] Ten (10) different groups with n=6 human PCLuS were investigated as shown below. PCLuS were prepared from n=2 biopsy confirmed, explanted human IPF lung.

    TABLE-US-00023 Study Design Group T.A. Doses Duration No. 1 N.A. N.A. 48 hours 6 2 N.A. N.A. 48-168 hours 3 Vehicle N.A. 4 Pirfenidone 2.5 mM 5 Nintedanib 2.5 ?M 6 ALK5i 10 ?M 7 ?v?6 inhib. (SMI) 1 ?M 8 HuNeg 100 ?g/mL 9 Ab42 3, 30, 100 ?g/mL 10 Ab1D11 30 ?g/mL

    Harvest and Analysis

    [0764] PCLuS harvest: Cell culture supernatant (n=6 per group) was collected daily and snap frozen for quantification of the soluble outputs listed below. At harvest, n=2 PCLuS were snap frozen for RNA isolation and qPCR analysis, n=2 PCLuSwere Formalin fixed, paraffin embedded (FFPE) for IHC and n=2 PCLuS were used for a resazurin assay to measure cell viability.

    [0765] Viability: Cell viability was assayed using either resazurin assay at endpoint or measuring lactate dehydrogenase levels in supernatant at each timepoint. T0 tissue was collected before start of treatment. It was found that over 168 hours there was overall similar viability (FIG. 47) and low LDH (FIG. 48X) levels across groups, which suggested that tissue was healthy throughout the study. Levels of LDH in the cell culture supernatants (48 hrs, 72 hrs, 96 hrs, 120 hrs, 144 hrs & 168 hrs) were quantified using an LDH assay kit (Sigma). Metabolic activity of PCLuS were quantified by resazurin assay.

    [0766] Soluble outputs analysis: Levels of collagen 1a1, Fibronectin, TIMP1, MMP7 and Hyaluronic Acid (HA) in the cell culture supernatants were quantified using R&D Duoset? ELISA kits. Levels of total TGF-?1/TGF-?2/TGF-?3 in the cell culture supernatants were quantified using a U-plex TGF-? Combo multiplex ELISA (Meso Scale Discovery?).

    [0767] Formalin fixed, paraffin embedded blocks: an additional n=3 FFPE blocks containing macroscopically normal tissue from an adjacent area of the IPF lung were provided.

    [0768] RNA Analysis: Total RNA extraction from PCLuS was performed on all samples (n=2 pooled PCLuS per group, per donor) including TO PCLuS).

    [0769] The endpoints were as follows: [0770] Measurement of soluble proteins: Collagen 1, fibronectin, TIMP1, MMP7, hyaluronic acid, and TGF? ligands

    [0771] Assays on fixed lung tissue: PSR and pSmad2.

    Results

    [0772] Gene analysis was performed on samples from two separate donors. While further experiments will be performed using a larger sample size, from these results, it can be concluded that Ab42 showed stronger reduction in profibrotic soluble factors in donor 1 than in donor 2. ALK5i, Pirfenidone, and Nintedanib showed more consistency with reducing soluble factors. One prediction that can be made from these results is that Ab42 may have potential anti-fibrotic effect in the IPF lung.

    Example 11: Human Clinical Trial to Test the Efficacy of a Combination Treatment for Idiopathic Pulmonary Fibrosis, Comprising the Administration of Pirfenidone, Nintedanib, and Ab42

    [0773] The results provided in the specification above are a good foundation for persons having ordinary skill in the medical art to conduct a series of human clinical trials to confirm the safety and efficacy of a combination therapy comprising the administration of pirfenidone, nintedanib, and Ab42 to treat idiopathic pulmonary fibrosis in humans.

    Example 12: Alport Dose Response PK/PD Test for Ab42-Reanalysis

    [0774] Dose at eleven-week-old mice. Takedown after forty-eight hours.

    [0775] Collection: Kidney: for immunohistochemistry/pSmad ELISA assays.

    [0776] Serum collection at twenty-four hours to determine antibody exposure at 1 mg/kg.

    TABLE-US-00024 Study Design Group Genotype Ab (hIgG4) Dose (mg/kg) Frequency No. 1 Het HuNeg 30 1 6 2 KO HuNeg 30 1 10 3 KO context- 10 1 10 independent reference antibody 8 KO Ab42 30 1 10 9 KO Ab42 10 1 10 10 KO Ab42 3 1 10

    [0777] Re-stain of study removes batch artifact. The inventors re-stain and re-analysis shows uniform batch consistency. Significant pSmad2 suppression was seen in Ab42 treatments by t-test and ANOVA. For Ab42, serum exposures of ?13 ?g/mL is sufficient to reduce pSmad2. This result suggests that the Alport dose response model might be driven by LTBP-TGF?1 complexes.

    [0778] The inventors observed a reduction of GARP and inflammatory genes after a single dose of Ab42, including CCL2, IL-1 b, and IL-6. Ab42 at 30 mg/kg showed reduction at all timepoints. Ab42 at 60 mg/kg showed reduction at ninety-six hours. The inventors performed a re-analysis of the raw qPCR data and saw the same results.

    Example 13: Gene Expression Re-Analysis from Adenine PK/PD Test

    [0779] A small subset of the earlier results above were taken for assay and RNA integrity check. The localization, intensity matched prior immunohistochemistry results.

    TABLE-US-00025 Study Design Dose Dosing Tissue level fre- Collec- No. Group Diet TA (mg/kg) quency tion (hr) animals 1 Chow N/A N/A N/A 96 8 2 0.25% HuNeg 60 Day 1 24, 48, 96 3 ? 8 (24) 3 Adenine Ab42 60 Day 1 24, 48, 96 3 ? 8 (24) 4 Ab42 30 Day 1 24, 48, 96 3 ? 8 (24) 5 Ab42 10 Day 1 24, 48, 96 3 ? 8 (24) 6 Ab42 30 Day 1 24, 48, 96 3 ? 8 (24) 10 GS- 10 Once 2 hr pre- 8 490470 necropsy

    [0780] qPCR analysis showed a reduction of GARP after a single dose of Ab42.

    [0781] GARP in situ hybridization results did not show observable reduction in fibrotic regions.

    [0782] In situ hybridization results are being measured independently as well as relative to pSmad2 localization.

    [0783] Expression levels are being compared against qPCR data to confirm earlier observations.

    [0784] Notably, Ab42 did not cause exacerbation of TNF? gene expression, which is an inflammatory marker. Contrast this to ALK5 inhibitor, which is a potent panTGF? blocker, which exacerbated expression of that gene as compared to the controls in diseased animals.

    Example 14: A 13-Week Toxicity and Toxicokinetic Study of Ab42 Human IgG4 by Intraperitoneal Administration in Mice

    [0785] The objectives of this study were to determine the potential toxicity of Ab42 Human IgG4, when given via intraperitoneal injection 3 times weekly for up to 13 weeks (up to 39 total doses) to mice.

    [0786] Crl:CD1 (ICR; Charles River) mice were administered 0 (vehicle control), 10, 30 or 100 mg/kg/dose Ab42Human IgG4 by intraperitoneal injection 3 times per week for up to 13 weeks (up to 39 doses).

    [0787] Three main study animals administered 30 mg/kg/dose were found dead on Day 27 or 48. The probable cause of death for Animal 3009 was iatrogenic hemorrhage into the abdominal cavity (i.e., hemoabdomen) from an intraperitoneal injection. A cause of death could not be determined for Animals 3007 and 3010.

    [0788] No test article-related differences in organ weight parameters were noted. Increased thymus weights (absolute and relative to body and brain weights) in animals administered 10 mg/kg/dose were of uncertain relationship to the test article because of the intragroup variation and lack of a dose relationship or microscopic correlate.

    [0789] No test article-related macroscopic findings were noted.

    [0790] Test article-related microscopic findings were limited to an increased incidence and/or severity of minimal to marked mixed cell inflammation in the Harderian gland in females administered 30 mg/kg/dose and males administered 100 mg/kg/dose. Harderian gland inflammation was often associated with minimal degeneration/necrosis and the male with marked mixed cell inflammation had more pronounced (moderate) degeneration/necrosis with loss of glandular tissue. Moderate or marked mixed cell inflammation in the Harderian glands was considered adverse in mice; however, humans do not have a Harderian gland. An increased incidence and/or severity of leukocytic infiltrates attributed to intraperitoneal injections in test article-treated animals was suggestive of an increased inflammatory response to the antibody test article compared with the vehicle.

    Example 15: Determination of the Pharmacokinetics of Ab42 hlgG4 and Ab42 hlgG4-YTE Mutant Following a Single Dose Intravenous Administration to Monkeys

    [0791] A study was carried out to determine the pharmacokinetics of Ab42 hlgG4 and Ab42 hlgG4-YTE mutant following a single dose intravenous administration to cynomolgus monkeys.

    [0792] A YTE mutation in the antibody Fc region has previously resulted in increased antibody serum half-lives, ?2-5 fold longer half-life in humans, based on the results of two different antibodies published by others.

    [0793] Ab42 with the YTE mutation (Ab42-YTE) has been generated. The expression titers have been found to be similar to Ab42, with a similar potency of Ab42-YTE to Ab42, which was confirmed by CAGA assay.

    [0794] Study Design: the study design is shown in the table below. There were 6 groups of animals (Cynomolgus monkey (females): Age 2-5 years (?2.5 to 5 kg), 3 animals per group. Test agent (T.A) was given intravenously (IV) as a bolus injection.

    TABLE-US-00026 Study Design Group T.A. (hIgG4) Dose (mg/kg; IV) Number of Animals 1 Ab42 0.3 3 2 Ab42 1 3 3 Ab42 3 3 4 Ab42 10 3 5 Ab42-YTE 0.3 3 6 Ab42-YTE 10 3

    [0795] Sample collection was carried out at the time points shown in the Table below.

    TABLE-US-00027 Days ADA 0 Interim 0.04 (1 hour) Analysis 1 0.17 (4 hour) 0.33 (8 hour) 1 3 ? 5 7 ? 10 14 ? 21 Interim ? 28 Analysis 2 ? 35 ? 42 ? 49* Final ? 56* Analysis ? *Groups 5 and 6 only

    [0796] FIG. 49 shows group averaged PK data up to day 72. As seen in FIG. 49, there was a slight difference in apparent half-life between the WT and YTE test article. Comparing WT and YTE at the 0.3 and 10 mg/kg doses, there was a clear extension of half-life. FIG. 50 shows PK data for individual animals. Again, comparing WT and YTE at the 0.3 and 10 mg/kg doses, there was overall a clear extension of half-life.

    [0797] According to some embodiments, thr YTE mutation does not affect antigen binding affinity.

    REFERENCES

    [0798] A person having ordinary skill in the biomedical art can use these patents, patent applications, and scientific references as guidance to predictable results when making and using the invention.

    PATENT LITERATURE

    [0799] WO 2020/160291 A2 discloses the antibodies characterized by at least all of their six CDR sequences.

    [0800] WO 2019/023661 A1 (Scholar Rock Inc.), published Jan. 31, 2019, discloses inhibitory antibodies binding to human LTBP1-proTGF?1 complex or human LTBP3-proTGF?1 complex that do not bind human GARP-proTGF?1 complex and their use for fibrosis treatment. The '661 patent publication discloses inhibitory antibodies binding to human LTBP1-proTGF?1 complex or human LTBP3-proTGF?1 complex which do not bind human GARP-proTGF?1 complex. The '661 patent publication also discloses methods for antibody generation and selection, antibodies designated identical to antibodies having the identical designation of the present application.

    [0801] WO 2018/129329 A1 (Scholar Rock Inc.), published Jul. 12, 2018, discloses isoform-specific inhibitor antibodies targeting proTGF?1 complexes and use thereof for treatment of fibrosis or proliferative diseases. The antibodies designated Ab-1, Ab-2 and Ab-3 are shown to bind to LTBP1-proTGF?, LTBP3-proTGF?, GARP-proTGF? and LRRC33-proTGF? with different affinities, i.e., preferential binding to one complex over the others. See, e.g., Examples and Table 10. The '329 patent publication discloses isoform-specific inhibitor antibodies targeting both ECM-associated TGF?1 binding (LTBP1-proTGF?1 or LTBP3-proTGF?1) and immune cell-associated TGF?1 (GARP-TGF?1, LR RC33-TGF?1). The '329 patent publication further discloses the use thereof for treatment of fibrosis and proliferative diseases.

    [0802] WO 2017/156500 A1 (Scholar Rock Inc.), published Sep. 14, 2017, relates to isoform specific inhibition of TGF?1, refers to antibodies that bind to one up to all complexes of GARP-TGF?1, LRRC33-TGF?1, LTBP1-TGF?1, and LTBP3-TGF?1, thereby targeting pro/latent complex, and discloses their use for treatment purposes. The '500 patent publication shows that inhibitory antibodies Ab1 and a context-independent reference antibody do not bind to mature TGF?1, TGF?2, or TGF?3, but bind to LTBP1-proTGF?1, LTBP3-proTGF?3, GARP-proTGF?1, and LRRC33-proTGRbeta1. The antibodies have therapeutic utility alone or in combination with anti-PD-1. To overcome toxicities associated with TGF? inhibition, isoform-specific inhibition of TGF?1 are to be generated and used in therapy. See, e.g., page 3, first paragraph. The antibodies directed to TGF? are also present in a particular context. See, e.g., page 4-page 5, bridging paragraph and page 5, last paragraph-page 8, 2nd paragraph). The '500 patent publication further teaches how to obtain such antibodies. See, e.g., page 73 and Examples. The specific disclosed antibodies Ab1 and a context-independent reference antibody are shown not to bind mature TGF?1, TGF?2, TGF?3 and bind to GARP-proTGF?1, L TBP1-proTGF?1, L TBP3-proTGF?3 and LRRC33-proTGF?1.

    [0803] WO 2016/161410 discloses neutralizing antibodies that bind both TGF?1 and TGF?2 (i.e., TGF?1/2 inhibitors).

    [0804] WO 2014/182676 A2 (Scholar Rock Inc.), published Nov. 13, 2014, discloses an antibody, which can be humanized (see, e.g., paragraph [167]), directed to LTBP1-proTGF? complex (see, e.g., Table 17, paragraphs [558]-[559] and Example 18) and used for treatment of fibrosis (see, e.g., claim 40). The '676 patent publication discloses the screening of antibodies directed to proTGF? complexed with LTBP1, which do not bind to free TGF?1 and have inhibitory activity (ability to decrease TGF? signaling) as well as use thereof for treatment of, e.g. fibrosis. The '676 patent publication discloses the screening of antibodies directed to proTGF? complexed with LTBP1 which do not bind to free TGF?1 and have inhibitory activity (ability to decrease TGF? signaling) as well as use thereof for treatment of, e.g., fibrosis.

    [0805] WO 2011/102483 A1 (Riken), published Aug. 25, 2011, discloses antibodies binding to LAP (=proTGF?). The BP-873 antibody binds to peptides present in proTGF?1 but not to fragments of proTGF?2 and does not bind mature TGF?1. It is not clear from the '483 patent publication whether the antibody binds to proTGF? complex, i.e., whether formation of complex prevent its binding.

    [0806] WO 2006/116002 provides neutralizing antibodies that bind both TGF?1 and TGF?3 (i.e., TGF?1/3 inhibitors),

    Non-Patent Literature

    [0807] Aluwihare et al. (2009) J. Cell Sci., 122(Pt 2), 227-32. Mice that lack both ?6 and b8 integrins recapitulate all essential phenotypes of TGF?1 and TGF?3 knockout mice, including multiorgan inflammation and cleft palate, confirming the essential role of these two integrins for TGF?1 activation in development and homeostasis. [0808] Anderton et al. (2011) Toxicology Pathology, 39: 916-24, reported that small molecule inhibitors of TGF? type I (ALK5) receptor induced heart valve lesions characterized by hemorrhage, inflammation, degeneration and proliferation of valvular interstitial cells in a preclinical animal model. The toxicity was observed in all heart valves at all doses tested. [0809] Bird et al. (1988) Science, 242, 423-426 discloses single-chain Fv (scFv) molecules. [0810] Brennan et al. (2018) mAbs, 10:1, 1-17. The prevailing view of the field continues to be that it is advantageous to inhibit multiple isoforms of TGF? to achieve therapeutic effects, and that to accomplish toxicity management by careful dosing regimen. [0811] Derynck & Zhang (2003) Nature, 425(6958), 577-84. SMAD-independent TGF? signaling pathways were described, e.g., in cancer or in the aortic lesions of Marfan mice. [0812] Dong et al., Nat Struct Mol Biol, 2014. 21(12), 1091-6. ?V integrins bind the RGD sequence present in TGF?1 and TGF?1 LAPs with high affinity. [0813] Ezzie et al. (2011) Am. J. Respir. Cell Mol. Biol., 44(4), 556-61. Mechanisms of TGF?1 activation were implicated, including thrombospondin-1 and activation by proteases such as matrix metalloproteinases (MMPs), cathepsin D or kallikrein. Most of these studies were performed in vitro using purified proteins. There is less evidence for the role of these molecules from in vivo studies. Knockout of thrombospondin-1 recapitulates some aspects of the TGF?1.sup.?/? phenotype in some tissues but is not protective in bleomycin-induced lung fibrosis, known to be TGF?3-dependent. [0814] Frazier et al. (2007) Toxicology Pathology, 35: 284-295 reported that administration of the small molecule inhibitor of TGF? type I (ALK5) receptor GW788388 induced physeal dysplasia in rats. [0815] Holm et al. (2011) Science, 332(6027), 358-61). SMAD-independent TGF? signaling pathways were described, e.g., in cancer or in the aortic lesions of Marfan mice. [0816] Horan et al. (2008) Am J Respir Crit Care Med, 177(1), 56-65. The ?v?6 blockade with an antibody or loss of integrin ?6 expression suppresses bleomycin-induced lung fibrosis and radiation-induced fibrosis. [0817] Huston et al. (1988) Proc. Nat'l. Acad. Sci., USA 85, 5879-5883 discloses single-chain Fv (scFv) molecules. [0818] Janssens et al. (2006) J. Med. Genet., 43(1), 1-11. Camurati-Engelman disease results in bone dysplasia due to an autosomal dominant mutation in the TGF?1 gene, leading to constitutive activation of TGF?1 signaling. [0819] John et al. (2020) Translational pharmacology of an inhaled small molecule ?v?6 integrin inhibitor for idiopathic pulmonary fibrosis. Nature Communications, 11, 11, Article number 4659. [0820] Lacouture et al. (2015) Cancer Immunol. Immunother., 64, 437-46. Fresolimumab (GC1008), a pan TGF? antibody capable of neutralizing all human isoforms of TGF?, was reported to induce an epithelial hyperplasia of the gingiva, bladder, and of the nasal turbinate epithelium after multiple administrations in studies with cynomolgus macaques. The most notable adverse reaction to fresolimumab includes the induction of cutaneous keratoacanthomas and/or squamous cell carcinomas in human cancer patients [0821] Lonning et al. (2011) Current Pharmaceutical Biotechnology, 12, 2176-89. Fresolimumab (GC1008), a pan TGF? antibody capable of neutralizing all human isoforms of TGF?, was reported to induce an epithelial hyperplasia of the gingiva, bladder, and of the nasal turbinate epithelium after multiple administrations in studies with cynomolgus macaques. The most notable adverse reaction to fresolimumab includes the induction of cutaneous keratoacanthomas and/or squamous cell carcinomas in human cancer patients [0822] Massague et al. (2005) Genes Dev., 19(23), 2783-810. Ligand-induced oligomerization of TGF?RI/II triggers the phosphorylation of SMAD transcription factors, resulting in the transcription of target genes, such as Coil a1, Col3a1, ACTA2, and SERPINE1. [0823] Munger et al. (1999) Cell, 96(3), 319-28. Several studies have shed light on the mechanisms of TGF?1 activation. Three integrins, ?v?6, ?v?8, and ?v?1 were demonstrated to be key activators of latent TGF?1. The ?v?6 blockade with an antibody or loss of integrin ?6 expression suppresses bleomycin-induced lung fibrosis and radiation-induced fibrosis. [0824] Rabat et al. (1987; 1991) Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md.) describes a system that not only provides an unambiguous residue numbering system applicable to any variable region of an antibody, but also provides precise residue boundaries defining the three CDRs on each of the heavy and light chains. [0825] Reed et al. (2015) Sci. Transl. Med., 7(288), 288ra79. Several studies have shed light on the mechanisms of TGF?1 activation. Three integrins, ?v?6, ?v?8, and avp1 were demonstrated to be key activators of latent TGF?1. The importance of integrin-dependent TGF?1 activation in disease has also been well validated. A small molecular inhibitor of avp1 protects against bleomycin-induced lung fibrosis and carbon tetrachloride-induced liver fibrosis. [0826] Richert-Spuhler & Lund (2015) Prog. Mol. Biol. Transl. Sci., 136, 217-243. A review showing potential side effects stemming from perturbation of normal Treg function in maintaining immune homeostasis [0827] Robertson et al. (2015) Matrix Biol., 47, 44-53. Fibroblasts secrete latent TGF?1 tethered to latent TGF?3-binding proteins (LTBPs), which then associate with proteins in the extracellular matrix (ECM), i.e., fibronectin, fibrillin-1, to link latent TGF? to the ECM. [0828] Rudikoff et al. (1982) Single amino acid substitution altering antigen-binding specificity. Proceedings of The National Academy of Sciences, 79(6), 1979-1983 (Mar. 1, 1982). D5 teaches that all of the CDR sequences are important for antibodies binding to its target antigen. [0829] Sela-Culang et al. (2013) The structural basis of antibody-antigen recognition. Frontiers in Immunology, 4: Article 302, p. 1-13, teaches that the widely assumed role of CDRs as the only determinants of antibody binding may be an oversimplification, as some position in the CDR sequences were shown to never participate in antibody binding, and some non-CDR residues often contribute critically to antibody-antigen interaction. Sela-Culang also teaches that framework region residues may play an important role in antigen binding, as evidenced by the observation that grafting only the CDRs during antibody humanization usually results in a significant drop or complete loss of binding. The binding affinity can be retained by back-mutating some of the framework region residues to the original sequence, emphasizing their role in antigen binding (p. 7, 1st column, 3rd paragraph). Sela-Culang further teaches that some framework region residues contact antigen and are therefore part of the antigen-binding site, while other framework region residues are far from the CD Rs in sequence but are near it in the 3-D structure (p. 7, paragraph spanning columns 1 and 2). There are also framework region residues that affect antigen binding but are not in contact with antigen, but affect antigen binding indirectly, and these residues are believed to provide a structural support for the CDRs, enabling them to adopt the correct conformation and orientation, or by directing and maintaining the relative orientation of the heavy chain variable region vs the light chain variable region, and thus the orientation of the CD Rs relative to each other (p. 7, 2nd column, 2nd-3rd paragraphs). [0830] Shi et al. (2011) Nature, 474(7351), 343-9. Structural insights into the activation mechanism of TGF?1 have enabled more specific approaches to TGF? inhibition. The structure of latent TGF?1 illuminates how integrins enable release of active TGF?1 from the latent complex: the covalent link of latent TGF?1 to its presenting molecule anchors latent TGF?1, either to the ECM through LTBPs, or to the cytoskeleton through GARP or LRRC33. Integrin binding to the RGD sequence results in a force-dependent change in the structure of LAP, allowing active TGF?1 to be released and bind nearby receptors. [0831] Shoukry et al. (2017) J. Immunol., 198 (1 Supplement), 197.12. Evidence suggests that an alteration in the Th17/Treg ratio leads to an imbalance in pro-fibrotic Th17 cytokines, which correlate with severity of fibrosis, such as liver fibrosis. [0832] Stauber et al. (2014) J. Clin. Practice 4:3, reported that a chronic, over 3-month administration of the inhibitor of TGF? receptor I kinase, LY2157299, which was investigated for certain cancer treatments, caused multiple organ toxicities involving the cardiovascular, gastrointestinal, immune, bone/cartilage, reproductive, and renal systems, in rats and dogs. [0833] Stevenson et al., 2013, Oncolmmunology, 2:8, e26218. Fresolimumab (GC1008), a pan TGF? antibody capable of neutralizing all human isoforms of TGF?, was reported to induce an epithelial hyperplasia of the gingiva, bladder, and of the nasal turbinate epithelium after multiple administrations in studies with cynomolgus macaques. The most notable adverse reaction to fresolimumab includes the induction of cutaneous keratoacanthomas and/or squamous cell carcinomas in human cancer patients. Additional evidence from a clinical trial suggests that in some cases this antibody may accelerate tumor progression. [0834] Travis & Sheppard (2014) Annu. Rev. Immunol., 32, 51-82. Several studies have shed light on the mechanisms of TGF?1 activation. Three integrins, ?v?6, ?v?8, and ?v?1 were demonstrated to be key activators of latent TGF?1. [0835] Van Laer et al. (2014) Adv. Exp. Med. Biol., 802: p. 95-105. Patients with Loeys/Dietz syndrome carry autosomal dominant mutations in components of the TGF? signaling pathway, which cause aortic aneurism, hypertelorism, and bifid uvula. [0836] Wang et al. (2012) Mol. Biol. Cell., 23(6), 1129-39 and T.A. Springer, Int. BMP Conference (2016). On the surface of activated regulatory T cells latent TGF?1 is covalently linked to the transmembrane protein GARP (glycoprotein-A repetitions predominant protein (GARP), and a protein closely related to GARP, LRRC33 (leucine-rich repeat-containing protein 33), serves as a presenting molecule for TGF?1 on the surface of monocytes, macrophages and microglia. Key for integrin-dependent activation of latent TGF?1 is the covalent tether to presenting molecules. Disruption of the disulfide bonds between GARP and TGF?1 LAP by mutagenesis does not impair complex formation, but completely abolishes TGF?1 activation by ?v?6. [0837] Ward et al. (1989) Nature, 341, 544-546 discloses dAb fragments. [0838] Worthington, Klementowicz, & Travis (2011) Trends Biochem. Sci., 36(1), 47-54. Knockout of candidate proteases did not result in a TGF?1 phenotype. This could be explained by redundancies or by these mechanisms being critical in specific diseases rather than development and homeostasis. [0839] Yang et al. (2007) J. Cell Biol., 176(6), 787-93. Transgenic mice with a mutation in the TGF?1 RGD site that prevents integrin binding, but not secretion, phenocopy the TGF?1?/? mouse.

    TEXTBOOKS AND TECHNICAL REFERENCES

    [0840] Current Protocols in Immunology (CPI), Coligan et al., eds. (John Wiley and Sons, Inc., 2003). [0841] Current Protocols in Molecular Biology (CPMB), Ausubel, ed. (John Wiley and Sons, 2014). [0842] Current Protocols in Protein Science (CPPS), Coligan et al., ed, (John Wiley and Sons, Inc., 2005). [0843] Immunology, Werner Luttmann (ed.) (Elsevier 2006). [0844] Janeway's Immunobiology, Kenneth Murphy, Allan Mowat, Casey Weaver (eds.) (Taylor & Francis Limited, 2014). [0845] Laboratory Methods in Enzymology: DNA, Jon Lorsch (ed.) (Elsevier, 2013). [0846] Lewin's Genes XI (Jones & Bartlett Publishers, 2014). [0847] Molecular Biology and Biotechnology: A Comprehensive Desk Reference, Robert A. Meyers (ed.) (VCH Publishers, Inc., 1995). [0848] Molecular Cloning: A Laboratory Manual, 4th ed., Michael Richard Green and Joseph Sambrook, (Cold Spring Harbor, N.Y., Cold Spring Harbor Laboratory Press, 2012). [0849] The Encyclopedia of Molecular Cell Biology and Molecular Medicine, Robert S. Porter et al. (eds.) (Blackwell Science Ltd., 1999-2012). [0850] The Merck Manual of Diagnosis and Therapy, 19.sup.th edition (Merck Sharp & Dohme Corp., 2018). [0851] Pharmaceutical Sciences 23.sup.rd edition (Elsevier, 2020).

    List of Certain Embodiments

    [0852] 1. A method of treating a fibrotic condition, comprising the steps of: [0853] (a) selecting a TGF? inhibitor for the treatment of fibrosis, [0854] (1) wherein the TGF? inhibitor (A) specifically binds a LTBP1-proTGF? complex; (B) does not bind a human GARP-proTGF? complex; (C) does not bind a human LRRC33-proTGF? complex; and (D) does not bind mature TGF?1, mature TGF?2 or mature TGF?3; and [0855] (2) wherein the TGF? inhibitor is selected using an assay to measure the amount of a marker, wherein the amount of the marker is indicative of the treatment of fibrosis, with the proviso that the marker is not pSmad2; and [0856] (b) providing the selected TGF? inhibitor for administration to a subject in need of treatment for the fibrotic condition, wherein the fibrotic condition is treatable by administration of an isoform-specific, context-selective TGF?1 inhibitors that selectively target matrix-associated TGF?1 activation but not immune cell-associated TGF?1 activation. [0857] 2. The method of embodiment 1, wherein the selected antibody comprises (1) CDR-H1 comprising the amino acid sequence FTFRSYVMH (SEQ ID NO: 1); (2) CDR-H2 comprising the amino acid sequence VISHEGSLKYYADSVKG (SEQ ID NO: 2); (3) CDR-H3 comprising the amino acid sequence ARPRIAARRGGFGY (SEQ ID NO: 3); (4) CDR-L1 comprising the amino acid sequence TRSSGNIDNNYVQ (SEQ ID NO: 4); (5) CDR-L2 comprising the amino acid sequence EDNQRPS (SEQ ID NO: 5); and (6) CDR-L3 comprising the amino acid sequence QSYDYDTQGVV (SEQ ID NO: 6). [0858] 3. The method of embodiment 1, wherein the selected antibody comprises an antibody or antigen-binding fragment thereof competes or cross-competes with an antibody having a heavy chain variable region sequence as set forth in SEQ ID NO: 7 and light chain variable region sequence as set forth in SEQ ID NO: 8. [0859] 4. The method of embodiment 1, wherein the selected antibody comprises either the LTBP-specific antibody Ab42 or the LTBP-specific antibody Ab42-YTE. [0860] 5. The method of embodiment 1, wherein the fibrotic condition is pulmonary fibrosis (PF). [0861] 6. The method of embodiment 1, wherein the fibrotic condition is idiopathic pulmonary fibrosis (IPF). [0862] 7. The method of embodiment 1, wherein the fibrotic condition is kidney fibrosis. [0863] 8. The method of embodiment 7, wherein the kidney fibrosis is associated with CKD. [0864] 9. The method of embodiment 7, wherein the kidney fibrosis is associated with Alport syndrome, wherein further optionally the subject is treated with a gene therapy or an RNA-based therapy. [0865] 10. The method of embodiment 1, wherein the fibrotic condition is muscle fibrosis. [0866] 11. The method of embodiment 10, wherein the muscle fibrosis is associated with a muscular dystrophy, wherein optionally the muscular dystrophy is DMD, wherein further optionally the subject is treated with a gene therapy or RNA-based therapy. [0867] 12. The method of embodiment 8, wherein the muscle fibrosis is associated with muscular atrophy, wherein optionally the muscular atrophy is SMA. [0868] 13. The method of embodiment 1, wherein the fibrotic condition is a fibrosis of the connective tissue, wherein optionally the fibrosis is scleroderma. [0869] 14. The method of embodiment 1, further wherein the selected TGF? inhibitor is for administration to a subject at a time overlapping the time that the subject is being treated with pirfenidone and/or nintedanib. [0870] 15. The method of embodiment 1, further wherein the selected TGF? inhibitor is for administration to a subject after a time that the subject is being treated with pirfenidone and nintedanib. [0871] 16. An antibody for use in treating a fibrotic condition, wherein the antibody is selected among the TGF? inhibitors that (A) specifically bind a LTBP1-proTGF? complex; (B) does not bind a human GARP-proTGF? complex; (C) does not bind a human LRRC33-proTGF? complex; and (D) does not bind mature TGF?1, mature TGF?2 or mature TGF?3; wherein the TGF? inhibitor is selected using an assay to measure the amount of a marker, wherein the amount of the marker is indicative of the treatment of fibrosis, with the proviso that the marker is not pSmad2. [0872] 17. An LTBP-selective inhibitor of TGF?1 activation for use in the treatment of a fibrotic condition is a subject, wherein the LTBP-selective inhibitor of TGF?1 activation is an antibody or antigen-binding fragment thereof that binds an epitope in the ?-1-helix region of proTGF?1, wherein optionally the epitope comprises one or more amino acid residues of VKRKRIEA (SEQ ID NO: 9), wherein further optionally the antibody is not Ab42. [0873] 18. The LTBP-selective inhibitor of TGF?1 activation for use according to embodiment 17, wherein the fibrotic condition is NASH, NAFLD, liver fibrosis, chronic kidney disease (CKD), kidney fibrosis, lung disease, lung fibrosis, COPD, IPF, scleroderma, or a muscular dystrophy. [0874] 19. The LTBP-selective inhibitor of TGF?1 activation for use according to embodiment 17 or 18, wherein the treatment comprises subcutaneous administration of a composition comprising the LTBP-selective inhibitor of TGF?1 activation. [0875] 20. A combination therapy for use in treating a fibrotic condition, wherein the therapy comprises the combination of pirfenidone, nintedanib, and an antibody of embodiment 16. [0876] 21. The combination therapy of embodiment 20, wherein the fibrotic condition is idiopathic pulmonary fibrosis. [0877] 22. The combination therapy of embodiment 20, wherein the antibody of claim 16 is for administration to a subject at a time overlapping the time that the subject is being treated with pirfenidone and nintedanib. [0878] 23. The combination therapy of embodiment 20, wherein the antibody of claim 16 is for administration to a subject after a time that the subject is being treated with pirfenidone and nintedanib. [0879] 24. A composition comprising an antibody or an antigen-binding fragment thereof that binds a human LTBP1-proTGF?1 complex and/or human LTBP3-proTGF?1 complex, wherein the antibody or the fragment binds an epitope comprising one or more amino acid residues of DMELVKRKRIEAIR (SEQ ID NO: 46) within the prodomain of the complex, wherein optionally the epitope further comprises at least one additional amino acid residue within the growth factor domain of the complex, and wherein the antibody does not have the same six CDR sequences as Ab42, and wherein optionally the antibody or the fragment has a monovalent IC50 value of 1 nM or less as measured by a cell-based potency assay as described in WO 2020/160291. [0880] 25. The composition of embodiment 24, wherein the antibody or the fragment contacts one or more of the following residues within the prodomain: Asp27 (D); Leu30 (L); Arg33 (R); Ile36 (I); Glu37 (E). [0881] 26. The composition of embodiment 24 or 25, wherein the epitope binds the Finger-1 domain within the growth factor, wherein optionally the epitope comprises one or more amino acid residues of YIDFRKDLGWK (SEQ ID NO: 93) within the Finger-1 domain, wherein further optionally the antibody or the fragment contacts one or more of the following residues: Tyr289 (Y); Lys294 (K); Asp295 (D). [0882] 27. The composition of any one of embodiments 24-26, wherein the antibody or the fragment binds to a recombinant human LTBP1-proTGF?1 complex and/or LTBP3-proTGF?1 complex with at least 50-fold greater affinity/affinities (50-fold lower KD values) than to a recombinant human GARP-proTGF?1 complex and/or LRRC33-proTGF?1 complex. [0883] 28. A method for manufacturing a pharmaceutical composition comprising the antibody or the fragment according to any one of embodiments 24-27, wherein the method comprises producing a recombinant antibody or a protein construct comprising the antigen-binding fragment of the antibody in a large-scale cell culture comprising a culture volume of 500 L or larger, purifying the recombinant antibody or the protein construct from the cell culture, and formulating into a pharmaceutical composition comprising at least one excipient. [0884] 29. An LTBP-selective inhibitor of TGF?1 activation for use in the treatment of chronic kidney disease (CKD) in a subject, wherein the treatment comprises administration of an LTBP-selective inhibitor which is an antibody that does not bind GARP-proTGF?1, in an amount effective to treat CKD, wherein optionally the subject is further treated with a myostatin-selective inhibitor. [0885] 30. A myostatin-selective inhibitor for use in the treatment of CKD in a subject, wherein the treatment comprises administration of a myostatin-selective inhibitor to the subject in an amount effective to treat CKD, wherein optionally the subject is further treated with an LTBP-selective inhibitor of TGF?1 activation. [0886] 31. An LTBP-selective inhibitor and a myostatin-selective inhibitor for use in the treatment of CKD in a subject, wherein the treatment comprises administration of an LTBP-selective inhibitor and a myostatin-selective inhibitor to the subject in amounts effective to treat CKD. [0887] 32. The LTBP-selective inhibitor and/or the myostatin-selective inhibitor for use according to any one of embodiments 29-31, wherein the CKD is associated with iron deficiency, wherein optionally the subject is treated with an iron-enhancing therapy.