A PROTEIN-BASED SENSOR FOR METALS IN ENVIRONMENTAL SAMPLES AND USES THEREOF
20240301009 ยท 2024-09-12
Inventors
- Joseph Alfred Cotruvo, JR. (University Park, PA, US)
- Emily Rowland FEATHERSTON (University Park, PA, US)
- Joseph A. MATTOCKS (University Park, PA, US)
Cpc classification
C07K2319/20
CHEMISTRY; METALLURGY
C22B60/0295
CHEMISTRY; METALLURGY
C07K2319/60
CHEMISTRY; METALLURGY
C22B3/20
CHEMISTRY; METALLURGY
International classification
Abstract
The present disclosure provides proteins that bind lanthanides and actinides. Disclosed are proteins based on lanmodulin (LanM) that comprised one or more sensitizers. Various residues in LanM may be substituted with a sensitizer, such as, for example, tryptophan. The proteins may be used to detect and quantify lanthanides and actinides. Also provided are kits and devices.
Claims
1. A protein having the sequence or comprising a segment having the sequence of SEQ ID NO:2 or sequence having at least 80% homology thereto, wherein at least one amino acid residue of the protein or segment is replaced with a sensitizer or modified such that the sensitizer is attached to the protein or the segment.
2. The protein according to claim 1, wherein the sensitizer is chosen from tryptophan, tryptophan analogs, naphthalimides, coumarins, acridones, and combinations thereof.
3. The protein according to claim 2, wherein the protein is any one of sequences SEQ ID NO:43-50 or a sequence having 80% homology thereto to any one of sequences SEQ ID NO:43-50.
4. The protein according to claim 2, wherein the protein is any one of sequences SEQ ID NO:43-50.
5. The protein according to claim 2, wherein the sensitizer is tryptophan.
6. The protein according to claim 5, wherein the protein is any one of sequences SEQ ID NO:11-19 or 34 or a sequence having 80% homology thereto to any one of sequences SEQ ID NO: 11-19 or 34.
7. The protein according to claim 6, wherein the protein is any one of sequences SEQ ID NO:11-19 or 34.
8. The protein according to claim 7, wherein the protein has the sequence SEQ ID NO:19 or SEQ ID NO:14.
9. A device comprising the protein of claim 1.
10. The device according to claim 9, wherein the device is a filter, membrane, sensor, handheld detector, plate reader, fluorimeter, biosensor, or in-line monitor.
11. A kit comprising the protein according to claim 1 or a device comprising the protein according to claim 1.
12. A method for binding one or more lanthanides and/or actinides comprising contacting a sample suspected of comprising or comprising the one or more lanthanides and/or actinides with one or more proteins according to claim 1, wherein one or more lanthanides and/or actinides binds to the protein.
13. The method according to claim 12, wherein the sample is drinking water, wastewater, ground water, ash ponds, aqueous extract from contaminated soil, drainage, leachate, or solid sample.
14. The method according to claim 12, wherein the one or more lanthanides are chosen from Tb, Eu, Dy, Sm, Nd, and ions thereof.
15. The method according to claim 14, wherein the lanthanide is Tb or an ion thereof.
16. The method according to claim 12, wherein the one or more actinides are americium, curium, or an ion thereof.
17. The method according to claim 12, wherein the sample has a pH of 9 or below.
18. The method according to claim 12, wherein the concentration of the one or more lanthanides and/or actinides is less than 100 ppm.
19. The method according to claim 12, wherein the bound one or more lanthanides and/or actinides are unbound and isolated from the protein.
20. A method for detecting and quantifying one or more lanthanides and/or actinides in a sample, comprising contacting the sample with one or more proteins according to claim 1; exposing the contacted sample with light; measuring a resulting emission of the exposed contacted sample; comparing the resulting emission to a known standard curve for a specific lanthanide; and determining the concentration of the specific lanthanide or actinide based on the comparison with the resulting emission and the known standard curve for the specific lanthanide or actinide, wherein the one or more lanthanides and/or actinides, if present, are detected and quantified based on the comparison of the resulting emission and the known standard curve.
21. The method according to claim 20, wherein the sample is drinking water, wastewater, ground water, ash ponds, aqueous extract from contaminated soil, drainage, leachate, or solid sample.
22. The method according to claim 20, wherein the one or more lanthanides are chosen from Tb, Eu, Dy, Sm, Nd, and ions thereof.
23. The method according to claim 22, wherein the lanthanide is Tb or an ion thereof.
24. The method according to claim 20, wherein the one or more actinides is americium, curium, or a combination thereof.
25. A method according to claim 20, wherein the sample has a pH of 9 or below.
26. A method according to claim 20, wherein the concentration of the one or more lanthanides and/or actinides is less than 100 ppm.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0017] For a fuller understanding of the nature and objects of the disclosure, reference should be made to the following detailed description taken in conjunction with the accompanying figures.
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
DETAILED DESCRIPTION OF THE DISCLOSURE
[0038] Although claimed subject matter will be described in terms of certain embodiments, other embodiments, including embodiments that do not provide all of the benefits and features set forth herein, are also within the scope of this disclosure. Various structural, logical, process step, and electronic changes may be made without departing from the scope of the disclosure.
[0039] All ranges provided herein include all values that fall within the ranges to the tenth decimal place, unless indicated otherwise.
[0040] Described herein is the strategic insertion of one or more sensitizers (e.g., luminescence sensitizers, e.g., tryptophan residues), into lanmodulin, which enables definition of aspects of the protein's selective REE recognition, including metal site-specific thermodynamics, kinetics, and structure. These insights also suggest how the protein might be optimized further for biotechnological applications. Furthermore, the present disclosure shows that these Trp-LanM variants enable detection and quantification of Tb levels directly in AMD, a challenging matrix inaccessible to previously characterized luminescent sensors. Together, these data suggest that this technology could be extended for detection of other luminescent f-elements and that LanM might enable harvesting of REEs from AMD.
[0041] The present disclosure provides proteins that bind lanthanides and/or actinides. Also provided are devices and kits comprising a protein of the present disclosure. Also provided are methods of using the proteins and devices.
[0042] In an aspect, the present disclosure provides proteins that bind metals (e.g., lanthanides and/or actinides). At least one residue of the protein is replaced with a sensitizer or the protein is modified such that a sensitizer is attached to the protein (e.g., attached to an amino acid). Other metal-binding proteins are disclosed in WO2020051274, which is incorporated herein by reference.
[0043] Wt LanM without the signal peptide has the following sequence: APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGTLDAKELKGRVSE ADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDNDGTIDARELASPAGSALVNLIR (SEQ ID NO:2). The signal peptide has the following sequence: MAFRLSSAVLLAALVA APAYA (SEQ ID NO:3). The full length lanmodulin (including the signal peptide is MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFD KLDPDKDGTLDAKELKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDN DGTIDARELASPAGSALVNLIR (SEQ ID NO:4).
[0044] A protein of the present disclosure may be of various lengths. For example, a protein of the present disclosure has 80 to 160 amino acid residues, including all integer amino acid values and ranges therebetween. For example, the protein has a molecular weight of 10 kDa to 14 kDa, including all 0.1 Da values and ranges therebetween (e.g., ?12 kDa). A protein of the present disclosure comprises at least one segment where one or more lanthanides and/or actinides can bind. The segment may have the same sequence of LanM, where at least one amino acid residue is replaced with a sensitizer or the protein is modified such that a sensitizer is attached to the protein (e.g., attached to an amino acid). In various examples, the segment has at least 70% homology (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% homology) with the sequence of Methylorubrum extorquens AM1 LanM, which may be referred to as LanM. In various other examples, the protein is truncated. For example, the protein is truncated at the N-terminus via deletion of the first 10, 20, 30, or 40 residues of the full translated sequence. In various examples of truncated sequences, EF hands 2 and 3 remain, as well as the hydrophobic core of the protein.
[0045] Suitable LanM proteins include the wild type M. extorquens LanM protein, or homologs from other organism having at least two EF hand motifs, with at least one EF hand motifs having at least 3 carboxylate residues, and at least 2 of the EF hand motifs being separated by a space of 10-15 residues. Reference herein will be made generally to lanmodulin, LanM or LanM protein and should be understood to include the wild type and homologs described herein. LanM can include full proteins having one or more LanM units or portions thereof comprising the one or more LanM units. LanM units include at least two EF hand motifs, with at least one EF hand motifs having at least 3 carboxylate residues, and at least 2 of the EF hand motifs being separated by a space of 10-15 residues. For ease of reference, discussion will be made with reference to lanmodulin, LanM or LanM protein and should be understood to include both the full proteins and portions of full proteins having the suitable LanM unit.
[0046] Various amino acid residues of the segment may be replaced with one or more sensitizers or the protein is modified such that one or more sensitizers is attached to the protein (e.g., attached to an amino acid). For example, any residue of the segment may be replaced with a sensitizer or any residue may be modified by attaching a sensitizer. For example, when the segment is the same length of LanM (full translated sequence of LanM), the 41.sup.st, 62.sup.nd, 65.sup.th, 69.sup.th, 87.sup.th, 90.sup.th, 94.sup.th, 114.sup.th residue, or a combination thereof of the segment is replaced with the sensitizer. In various other examples, the 4.sup.th, 7.sup.th, 11.sup.th residues, or a combination thereof of one or more of the EF hands are replaced with a sensitizer residue. The aforementioned residue numbers refer to the residues in the full translated sequence of LanM, but still refer to the same residue in when the protein does not have the signal peptide. For example, the 41.sup.st residue refers to the same threonine that is bolded in the following sequences:
TABLE-US-00001 (SEQIDNO:2) APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGTLDAKE LKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDNDGTIDARE LASPAGSALVNLIR and (SEQIDNO:4) MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALA AGSAAFDKLDPDKDGTLDAKELKGRVSEADLKKLDPDNDGTLDKKEYLA AVEAQFKAANPDNDGTIDARELASPAGSALVNLIR.
[0047] Various sensitizers may be used. For example, the sensitizer is chosen from tryptophan, tryptophan analogs (e.g., 4-aza, 5-aza, and 7-aza-tryptophans; cyano-tryptophans; boron- and nitrogen-containing BN-tryptophan, and the like), naphthalimides, coumarins, acridones (e.g., acridon-2-ylalanine residues), other fluorophores, and the like, and combinations thereof. In various examples, the sensitizer residue is tryptophan. In various examples, the segment is LanM, where at least one (e.g., one) residue (e.g., the 41.sup.st, 62.sup.nd, 65.sup.th, 69.sup.th, 87.sup.th, 90.sup.th, 94.sup.th, 114.sup.th residue) is replaced with tryptophan. In various other examples, the protein is LanM, where at least one (e.g., one) residue (e.g., the 41.sup.st, 65.sup.th, 87.sup.th, 90.sup.th, 94.sup.th, or 114.sup.th residue) is replaced with tryptophan. In various examples, when the protein is LanM, the 90.sup.th residue is tryptophan. In various other examples, a sensitizer is installed through cellular expression, in vitro protein/peptide synthesis, or via reaction with a cysteine or other nucleophilic residue on the protein or via an electrophilic position on the protein with a nucleophilic group on the sensitizer.
[0048] In various examples, a protein of the present disclosure has the following sequence:
TABLE-US-00002 (SEQIDNO:5) MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGWIDLKEALA AGSAAFDKLDPDKDGTLDAKELKGRVSEADLKKLDPDNDGTLDKKEYLA AVEAQFKAANPDNDGTIDARELASPAGSALVNLIR; (SEQIDNO:6) MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALA AGSAAFDKLDPDKDGWLDAKELKGRVSEADLKKLDPDNDGTLDKKEYLA AVEAQFKAANPDNDGTIDARELASPAGSALVNLIR; (SEQIDNO:7) MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALA AGSAAFDKLDPDKDGTLDAKELKGRVSEADLKKLDPDWDGTLDKKEYLA AVEAQFKAANPDNDGTIDARELASPAGSALVNLIR; (SEQIDNO:8) MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALA AGSAAFDKLDPDKDGTLDAKELKGRVSEADLKKLDPDNDGWLDKKEYLA AVEAQFKAANPDNDGTIDARELASPAGSALVNLIR; (SEQIDNO:9) MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALA AGSAAFDKLDPDKDGTLDAKELKGRVSEADLKKLDPDNDGTLDKWEYLA AVEAQFKAANPDNDGTIDARELASPAGSALVNLIR; (SEQIDNO:10) MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALA AGSAAFDKLDPDKDGTLDAKELKGRVSEADLKKLDPDNDGTLDKKEYLA AVEAQFKAANPDNDGWIDARELASPAGSALVNLIR; (SEQIDNO:17) MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALA AGSAAFDKLDPDWDGTLDAKELKGRVSEADLKKLDPDNDGTLDKKEYLA AVEAQFKAANPDNDGTIDARELASPAGSALVNLIR; (SEQIDNO:18) MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALA AGSAAFDKLDPDKDGTLDAWELKGRVSEADLKKLDPDNDGTLDKKEYLA AVEAQFKAANPDNDGTIDARELASPAGSALVNLIR;
or a sequence with at least 70% homology (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% homology). In various other embodiments, a protein of the present disclosure does not have the signal peptide portion of the protein. Example of such proteins include:
TABLE-US-00003 (SEQIDNO:11) APTTTTKVDIAAFDPDKDGWIDLKEALAAGSAAFDKLDPDKDGTLDAKE LKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDNDGTIDARE LASPAGSALVNLIR; (SEQIDNO:12) APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGWLDAKE LKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDNDGTIDARE LASPAGSALVNLIR; (SEQIDNO:13) APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGTLDAKE LKGRVSEADLKKLDPDWDGTLDKKEYLAAVEAQFKAANPDNDGTIDARE LASPAGSALVNLIR; (SEQIDNO:14) APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGTLDAKE LKGRVSEADLKKLDPDNDGWLDKKEYLAAVEAQFKAANPDNDGTIDARE LASPAGSALVNLIR; (SEQIDNO:15) APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGTLDAKE LKGRVSEADLKKLDPDNDGTLDKWEYLAAVEAQFKAANPDNDGTIDARE LASPAGSALVNLIR; (SEQIDNO:16) APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGTLDAKE LKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDNDGWIDARE LASPAGSALVNLIR; (SEQIDNO:19) APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDWDGTLDAKE LKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDNDGTIDARE LASPAGSALVNLIR; (SEQIDNO:34) APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGTLDAWE LKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDNDGTIDARE LASPAGSALVNLIR;
or a sequence with at least 70% homology (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% homology).
[0049] In various examples, a protein of the present disclosure has the following sequence:
TABLE-US-00004 (SEQIDNO:35) MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGXIDLKEALA AGSAAFDKLDPDKDGTLDAKELKGRVSEADLKKLDPDNDGTLDKKEYLA AVEAQFKAANPDNDGTIDARELASPAGSALVNLIR; (SEQIDNO:36) MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALA AGSAAFDKLDPDKDGXLDAKELKGRVSEADLKKLDPDNDGTLDKKEYLA AVEAQFKAANPDNDGTIDARELASPAGSALVNLIR; (SEQIDNO:37) MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALA AGSAAFDKLDPDKDGTLDAKELKGRVSEADLKKLDPDXDGTLDKKEYLA AVEAQFKAANPDNDGTIDARELASPAGSALVNLIR; (SEQIDNO:38) MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALA AGSAAFDKLDPDKDGTLDAKELKGRVSEADLKKLDPDNDGXLDKKEYLA AVEAQFKAANPDNDGTIDARELASPAGSALVNLIR; (SEQIDNO:39) MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALA AGSAAFDKLDPDKDGTLDAKELKGRVSEADLKKLDPDNDGTLDKXEYLA AVEAQFKAANPDNDGTIDARELASPAGSALVNLIR; (SEQIDNO:40) MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALA AGSAAFDKLDPDKDGTLDAKELKGRVSEADLKKLDPDNDGTLDKKEYLA AVEAQFKAANPDNDGXIDARELASPAGSALVNLIR; (SEQIDNO:41) MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALA AGSAAFDKLDPDXDGTLDAKELKGRVSEADLKKLDPDNDGTLDKKEYLA AVEAQFKAANPDNDGTIDARELASPAGSALVNLIR; (SEQIDNO:42) MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALA AGSAAFDKLDPDKDGTLDAXELKGRVSEADLKKLDPDNDGTLDKKEYLA AVEAQFKAANPDNDGTIDARELASPAGSALVNLIR;
or a sequence with at least 70% homology (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% homology), where X is a sensitizer as described herein (e.g., tryptophan analogs (e.g., 4-aza, 5-aza, and 7-aza-tryptophans; cyano-tryptophans; boron- and nitrogen-containing BN-tryptophan, and the like), naphthalimides, coumarins, acridones (e.g., acridon-2-ylalanine residues), other fluorophores, and the like). In various other embodiments, a protein of the present disclosure does not have the signal peptide portion of the protein. Example of such peptides include:
TABLE-US-00005 (SEQIDNO:43) APTTTTKVDIAAFDPDKDGXIDLKEALAAGSAAFDKLDPDKDGTLDAKE LKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDNDGTIDARE LASPAGSALVNLIR; (SEQIDNO:44) APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGXLDAKE LKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDNDGTIDARE LASPAGSALVNLIR; (SEQIDNO:45) APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGTLDAKE LKGRVSEADLKKLDPDXDGTLDKKEYLAAVEAQFKAANPDNDGTIDARE LASPAGSALVNLIR; (SEQIDNO:46) APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGTLDAKE LKGRVSEADLKKLDPDNDGXLDKKEYLAAVEAQFKAANPDNDGTIDARE LASPAGSALVNLIR; (SEQIDNO:47) APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGTLDAKE LKGRVSEADLKKLDPDNDGTLDKXEYLAAVEAQFKAANPDNDGTIDARE LASPAGSALVNLIR; (SEQIDNO:48) APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGTLDAKE LKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDNDGXIDARE LASPAGSALVNLIR; (SEQIDNO:49) APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDXDGTLDAKE LKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDNDGTIDARE LASPAGSALVNLIR; (SEQIDNO:50) APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGTLDAXE LKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDNDGTIDARE LASPAGSALVNLIR;
or a sequence with at least 70% homology (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% homology), where X is a sensitizer as described herein (e.g., tryptophan analogs (e.g., 4-aza, 5-aza, and 7-aza-tryptophans; cyano-tryptophans; boron- and nitrogen-containing BN-tryptophan, and the like), naphthalimides, coumarins, acridones (e.g., acridon-2-ylalanine residues), other fluorophores, and the like).
[0050] In various examples, the present disclosure also provides a protein containing the D35N substitution to inactivate metal ion binding to EF hand 1 without significantly altering the other metal binding sites.
[0051] In an aspect, the present disclosure provides devices. The device comprises one or more proteins of the present disclosures.
[0052] Various devices may comprise a protein of the present disclosure. Non-limiting examples of devices include filters, membranes, sensors, handheld detector, plate reader, fluorimeter, biosensors, in-line monitors, and the like.
[0053] In an aspect, the present disclosure provides kits. The kits may provide one or more proteins of the present disclosure and/or one or more devices of the present disclosure. The kit may include instructions for use of the proteins or devices.
[0054] In an aspect, the present disclosure provides various methods of using the proteins and/or devices of the present disclosure. A method of the present disclosure may be for binding one or more lanthanides and/or actinides or for detecting and/or quantifying the amount of one or more lanthanides and/or actinides.
[0055] A method of using a protein and/or device of the present disclosure may be a method for binding one or more lanthanides and/or actinides in a sample. Binding may occur by contacting the sample with one or more proteins and/or devices of the present disclosure. The method may be performed on various types of samples. Examples of samples include, but are not limited to drinking water, wastewater, ground water, ash ponds, aqueous extract from contaminated soil, drainage (e.g., mine drainage, such as, for example, acidic mine drainage) or leachate (e.g., landfill leachate). In various other examples, the sample is a solid sample. The method may be applied to samples over a variety of pH values. For example, the sample has a pH of 6 or below (e.g., 5.5 or below, 5 or below, 4.5 or below, 4 or below, 3.5 or below, or 3 or below). In various examples, the pH is greater than 6.
[0056] Various lanthanides (e.g., lanthanide ions) and/or actinides (e.g., actinide ions) may be bound by a protein and/or device. In various examples, any lanthanide except for La or Lu is detected. For example, the lanthanide is chosen from Tb, Eu, Dy, Sm, Nd, and ions thereof. In various examples, the lanthanide is Tb or an ion thereof. The bound lanthanides and/or actinides may be the same or different. The concentration of the lanthanide and/or actinides in the sample may be less than 100 ppm (e.g., less than 90, 80, 70, 60, 50, 40, 30, 20, 10, 1, 0.1, or 0.05 ppm).
[0057] In various examples, the one or more lanthanides and/or actinides bound to the one or more proteins and/or devices may be isolated from the proteins and/or devices and recovered. The lanthanides and/or actinides may be unbound by lowering the pH below ?2.5 or by adding a chelator (e.g., citrate, EDTA, EGTA, or the like). The one or more proteins and/or devices may be reused after the one or more lanthanides are unbound and separated.
[0058] A method of the present disclosure may be a method of detecting and/or quantifying the amount of one or more lanthanides and/or actinides in a sample. The method may comprise contacting the sample with one or more proteins and/or device of the present disclosure. The contacted sample may then be exposed to light and the resulting emission of the exposed contacted sample. The resulting emission results may then be compared to a known standard curve for a specific lanthanide or actinide. The concentration may then be determined by that comparison. Known standard curves may be prepared based on the desire to detect and/or determine the quantity of any specific lanthanide or actinide. Methods of preparing standard curves are known in the art.
[0059] The method of detecting and/or quantified may be performed on various samples. Non-limiting examples of samples include drinking water, wastewater, ground water, ash ponds, aqueous extract from contaminated soil, drainage (e.g., mine drainage, such as, for example, acidic mine drainage) or leachate (e.g., landfill leachate). In various other examples, the sample is a solid sample. The method may be applied to samples over a variety of pH values. For example, the sample has a pH of 6 or below (e.g., 5.5 or below, 5 or below, 4.5 or below, 4 or below, 3.5 or below, or 3 or below). In various examples, the pH is greater than 6.
[0060] Various lanthanides (e.g., lanthanide ions) and/or actinides (e.g., actinide ions) may be bound by a protein and/or device. For example, the lanthanide is chosen from Tb, Eu, Dy, Sm, Nd, and ions thereof. In various examples, the lanthanide is Tb or an ion thereof. The bound lanthanides and/or actinides may be the same or different. The concentration of the lanthanide and/or actinide in the sample may be less than 1 ppm.
[0061] In an aspect, the present disclosure provides a method to screen LanM variants using sensitized terbium luminescence, for altered metal ion selectivity (for separation applications). For example, a method uses a LanM containing a sensitizer (e.g., tryptophan at position 87, 90, or 94, or the equivalents in EF hand 2.
[0062] A LanM containing a sensitizer (e.g., tryptophan at position 87, 90, or 94, or the equivalents in EF hand 2 or EF1, EF4, or EF3), may be used as the basis for generating variants containing one or more amino acid substitutions in the protein, such as within, or near to, EF hands 2 and 3. A defined amount of terbium ions (e.g., 1 or 2 or 3 equivalents) may be added to each variant to give a luminescence signal. Then a competing ion (e.g., another lanthanide, or actinide, or other metal ion) can be added and the luminescence signal can be measured after a period of time, looking for the most (or least) efficient outcompetition of the sensitized terbium luminescence signal. Thereby, a comparison of the affinities of the protein for Tb versus any other metal ion can be made.
[0063] A method using the protein with the D35N substitution for any of the above applications.
[0064] The steps of the method described in the various embodiments and examples disclosed herein are sufficient to carry out the methods of the present disclosure. Thus, in an embodiment, the method consists essentially of a combination of the steps of the methods disclosed herein. In another embodiment, the method consists of such steps.
[0065] The following Statements provide various embodiments of the present disclosure.
[0066] Statement 1. A protein having the sequence or comprising a segment having the sequence of Methylorubrum extorquens AM1 lanmodulin (LanM) or a truncated sequence thereof or sequence having 70%, 75%, 80%, 85%, 90%, or 95% homology to the sequence of LanM or of the truncated sequence thereof, wherein at least one amino acid residue of the protein or segment is replaced with a sensitizer or modified such that the sensitizer is attached to the protein or the segment.
[0067] Statement 2. A protein according to Statement 1, wherein when the segment has the sequence of LanM, the 41.sup.st, 62.sup.nd, 65.sup.th, 69.sup.th, 87.sup.th, 90.sup.th, 94.sup.th, 114.sup.th residue, or a combination thereof of the segment is replaced with the sensitizer, or the 4.sup.th, 7.sup.th, 11.sup.th residue, or a combination thereof of an EF hand is replaced with the sensitizer.
[0068] Statement 3. A protein according to Statements 1 or 2, wherein the sensitizer is chosen from tryptophan, tryptophan analogs (e.g., 4-aza, 5-aza, and 7-aza-tryptophans; cyano-tryptophans; boron- and nitrogen-containing BN-tryptophan, and the like), naphthalimides, coumarins, acridones (e.g., acridon-2-ylalanine residues), other fluorophores, and the like, and combinations thereof.
[0069] Statement 4. A protein according to any one of the preceding Statements, wherein the sensitizer is tryptophan.
[0070] Statement 5. A protein according to any one of the preceding Statements, wherein the protein or the segment has the sequence of LanM with at least one residue replaced with the sensitizer.
[0071] Statement 6. A protein according to any one of the preceding Statements, wherein the 87.sup.th, 90.sup.th, or 94.sup.th residue of the protein or the segment is replaced with tryptophan.
[0072] Statement 7. A protein according to any one of the preceding Statements, wherein the protein or the segment has the sequence of LanM and the 90.sup.th residue of the protein or the segment is replaced with tryptophan.
[0073] Statement 8. A protein having the sequence or comprising a segment having the sequence of SEQ ID NO:2 or sequence having at least 80% homology thereto, wherein at least one amino acid residue of the protein or segment is replaced with a sensitizer or modified such that the sensitizer is attached to the protein or the segment.
[0074] Statement 9. A protein according to Statement 8, wherein the sensitizer is chosen from tryptophan, tryptophan analogs, naphthalimides, coumarins, acridones (e.g., acridon-2-ylalanine residues), and combinations thereof.
[0075] Statement 10. A protein according to Statement 8 or Statement 9, wherein the protein is any one of sequences SEQ ID NO:43-50 or a sequence having 80% homology thereto to any one of sequences SEQ ID NO:43-50.
[0076] Statement 11. A protein according to Statement 10, wherein the protein is any one of sequences SEQ ID NO:43-50.
[0077] Statement 12. A protein according to Statement 9, wherein the sensitizer is tryptophan.
[0078] Statement 13. A protein according to Statement 12, wherein the protein is any one of sequences SEQ ID NO:11-19 or 34 or a sequence having 80% homology thereto to any one of sequences SEQ ID NO: 11-19 or 34.
[0079] Statement 14. A protein according to Statement 13, wherein the protein is any one of sequences SEQ ID NO:11-19 or 34.
[0080] Statement 15. A protein according to Statement 14, wherein the protein has the sequence SEQ ID NO:19.
[0081] Statement 16. A device comprising a protein of any one of the preceding Statements.
[0082] Statement 17. A device according to Statement 16, wherein the device is a filter, membrane, sensor, handheld detector, plate reader, fluorimeter, biosensor, in-line monitor, or the like.
[0083] Statement 18. A kit comprising a protein of any one of Statements 1-15 or the device of Statements 16 or 17.
[0084] Statement 19. A method for binding one or more lanthanides and/or actinides comprising contacting a sample suspected of comprising the one or more lanthanides and/or actinides with one or more proteins according to any one of Statements 1-15 or a device according to Statements 16 or 17, wherein one or more lanthanides and/or actinides binds to the protein or device.
[0085] Statement 20. A method according to Statement 19, wherein the sample is drinking water, wastewater, ground water, ash ponds, aqueous extract from contaminated soil, drainage (e.g., mine drainage, such as, for example, acidic mine drainage) or leachate (e.g., landfill leachate), or solid sample.
[0086] Statement 21. A method according to Statements 19 or 20, wherein the one or more lanthanides are chosen from Tb, Eu, Dy, Sm, Nd, and ions thereof.
[0087] Statement 22. A method according to any one of Statements 19-21, wherein the lanthanide is Tb or an ion thereof.
[0088] Statement 23. A method according to Statements 19 or 20, wherein the one or more actinides are americium, curium, or an ion thereof.
[0089] Statement 24. A method according to any one of Statements 19-23, wherein the sample has a pH of 9 or below (e.g., 8.5 or below, 7.5 or below, 6.5 or below, 6 or below, 5.5 or below, 5 or below, 4.5 or below, 4 or below, 3.5 or below, or 3 or below).
[0090] Statement 25. A method according to any one of Statements 19-24, wherein the concentration of the one or more lanthanides and/or actinides is less than 100 ppm (e.g., less than 90, 80, 70, 60, 50, 40, 30, 20, 10, 1, 0.1. or 0.05 ppm).
[0091] Statement 26. A method according to any one of Statements 19-25, wherein the bound one or more lanthanides and/or actinides are unbound and isolated from the protein or device.
[0092] Statement 27. A method for detecting and quantifying one or more lanthanides and/or actinides in a sample, comprising contacting the sample with one or more proteins according to any one of Statements 1-15 or a device according to Statements 16 or 17; exposing the contacted sample with light; measuring a resulting emission of the exposed contacted sample; comparing the resulting emission to a known standard curve for a specific lanthanide; and determining the concentration of the specific lanthanide or actinide based on the comparison with the resulting emission and the known standard curve for the specific lanthanide or actinide, wherein the one or more lanthanides and/or actinides, if present, are detected and quantified based on the comparison of the resulting emission and the known standard curve.
[0093] Statement 28. A method according to Statement 27, wherein the sample is drinking water, wastewater, ground water, ash ponds, aqueous extract from contaminated soil, drainage (e.g., mine drainage, such as, for example, acidic mine drainage) or leachate (e.g., landfill leachate), or solid sample.
[0094] Statement 29. A method according to Statements 27 or 28, wherein the one or more lanthanides are chosen from Tb, Eu, Dy, Sm, Nd, and ions thereof.
[0095] Statement 30. A method according to any one of Statements 27-29, wherein the lanthanide is Tb or an ion thereof.
[0096] Statement 31. A method according to any one of Statements 27 or 28, wherein the one or more actinides is americium, curium, or a combination thereof.
[0097] Statement 32. A method according to any one of Statements 27-31, wherein the sample has a pH of 9 or below (e.g., 8.5 or below, 7.5 or below, 6.5 or below, 6 or below, 5.5 or below, 5 or below, 4.5 or below, 4 or below, 3.5 or below, or 3 or below).
[0098] Statement 33. A method according to any one of Statements 27-32, wherein the concentration of the one or more lanthanides and/or actinides is less than 100 ppm (e.g., less than 90, 80, 70, 60, 50, 40, 30, 20, 10, 1, 0.1, or 0.05 ppm).
[0099] Statement 34. A method to screen LanM variants comprising: contacting a defined amount of terbium ions with a LanM variant; measuring a luminescence signal; contacting the LanM contacted with terbium ions with a competing ion; and measuring the luminescence signal; and comparing the luminescence single.
[0100] Statement 35. A method according to Statement 34, wherein the competing ion is a lanthanide, actinide, or other metal ion.
[0101] The following examples are presented to illustrate the present disclosure. They are not intended to be limiting in any matter.
Example 1
[0102] This example provides a description of a protein of the present disclosure and methods of making and using same.
[0103] Lanthanide f-f transitions are Laporte forbidden and therefore direct excitation is inefficient; this limitation may be overcome by incorporating a photosensitizer adjacent to the metal ion to absorb and transfer energy to the metal excited state (luminescence resonance energy transfer, LRET). The requirement for a nearby sensitizer is advantageous in that it enables probing of individual metal-binding sites utilizing chromophores (tyrosine or tryptophan) in the protein, either native or incorporated via site-directed mutagenesis.
[0104] Sensitized terbium luminescence was used to probe the mechanism of lanthanide recognition by this protein, as well as to develop a terbium-specific biosensor that can be applied directly in environmental samples. By incorporating tryptophan residues into specific EF hands, the order of metal binding of these three sites was inferred. Despite lanmodulin's remarkable lanthanide-binding properties, its coordination of two solvent molecules per site (by luminescence lifetime) and metal dissociation kinetics (k.sub.off=0.02-0.05 s.sup.?1, by stopped-flow fluorescence) are revealed to be rather ordinary among EF hands; what sets lanmodulin apart is that metal association is nearly diffusion limited (k.sub.on?10.sup.9 M.sup.?1 s.sup.?1). Finally, it is shown that Trp-substituted lanmodulin can quantify as low as 3 ppb (18 nM) terbium directly in acid mine drainage at pH 3.2, in the presence of 100-fold excess of other rare earths and 100,000-fold excess of other metals, using a standard plate reader. These studies not only yield insight into lanmodulin's mechanism of lanthanide recognition and the structures of its metal-binding sites, but also show that the protein's unique combination of affinity and selectivity outperforms synthetic luminescence-based sensors, opening the door to rapid and inexpensive methods for selective sensing of individual lanthanides and actinides in the environment and in-line monitoring in industrial operations.
[0105] General considerations. Terbium(III) chloride hexahydrate (99.9%) and general laboratory chemicals for protein expression and purification and buffer preparation were obtained from Millipore Sigma. Deuterium oxide (99.9%) was purchased from Cambridge Isotope Laboratories. Primers were ordered from Integrated DNA Technologies (IDT). E. coli strains [5alpha, BL21(DE3)] for cloning and recombinant protein expression, respectively, as well as cloning reagents (Q5 DNA polymerase, OneTaq Quick-Load, KLD Enzyme Mix, DpnI) were purchased from New England Biolabs. Miniprep kits were from Omega Bio-tek. Protein gel electrophoresis was carried out using Invitrogen Novex WedgeWell 16% Tris-Glycine gels and a mini gel apparatus. Chelex 100 resin was purchased from BioRad. Automated protein chromatography was carried out on a GE Healthcare Biosciences Akta Pure fast protein liquid chromatography (FPLC) system. UV-visible absorption spectra were obtained on an Agilent Cary 60 UV-visible spectrophotometer using a quartz cuvette (Starna Cells). Well plates were analyzed using a BioTek Synergy H1 microplate reader. Fluorescence titrations and lifetime determinations were carried out on Cary Eclipse and PerkinElmer FL6500 spectrofluorometers, respectively, using a quartz septum cell micro fluorometer cuvette (10 mm pathlength, Starna Cells). Circular dichroism measurements were carried out in the X-ray Crystallography and Automated Biological Calorimetry Facility at Penn State using a 1-mm pathlength quartz CD cuvette (Jasco J/0556). Stopped flow UV-vis measurements were made on an Applied Photophysics SX20 spectrophotometer, equipped with a 450 long-pass filter (Corion LL-450-F-T539) and a fluorescence detector. All protein and metal solutions were made in 2 mL microcentrifuge tubes or 15 mL or 50 mL centrifuge tubes purchased from Sarstedt. All thermodynamic and kinetic data were analyzed, and curve fitting was performed, in Origin 2018.
[0106] Acid mine drainage (AMD). The AMD sample was collected from the feed of an AMD treatment facility operated by the Pennsylvania Department of Environmental Protection (Pennsylvania, USA). The source was from the lower Kittanning coal seam. The metal content of the sample was analyzed using inductively coupled plasma mass spectrometry (ICP-MS) on a Thermo Fisher Scientific ICAP RQ (ICP-MS) at the Penn State College of Earth and Mineral Sciences, Earth and Environmental Systems Institute, Laboratory for Isotopes and Metals in the Environment. The AMD sample was diluted 20? into 2% HNO.sub.3 (Aristar Ultra, BDH VWR Analytical), and a blank of 2% HNO.sub.3 was subtracted from each analyte prior to elemental content determination. The pH of the sample was 3.24.
[0107] Construction, expression, and purification of Trp-substituted LanM (Trp-LanM) variants. Mutagenesis of T41, T65, N87, T90, K94, and T114 to W was performed on pET24a-LanM using the forward and reverse primers shown in Table 1, using NEB KLD enzyme mix. Reactions were run for 4 h at room temperature and then supplemented with 2 U/?L DpnI for 30 min at 37? C. prior to transformation. Transformants were screened for insert by colony PCR (OneTaq Quick-Load) and the correct insert was confirmed by DNA sequencing by Genewiz, yielding the plasmids in Table 2. The variants were expressed and purified as described previously for the wt protein (lysis, anion exchange, size exclusion chromatography), and stored in 20 mM MOPS, 100 mM KCl, 5 mM acetate, 5% glycerol, pH 7.0 (Buffer A).
TABLE-US-00006 TABLE1 PrimersusedforcloningofTrp-LanMconstructs.? Name Sequence N87W-forward 5-GGACCCTGACTGGGACGGAACCC-3(SEQIDNO:20) N87W-reverse 5-AGCTTCTTAAGGTCTGCC-3(SEQIDNO:21) T90W-forward 5-CAATGACGGATGGCTGGACAAGAAAGAG-3(SEQID NO:22) T90W-reverse 5-TCAGGGTCCAGCTTCTTA-3(SEQIDNO:23) K94W-forward 5-CCTGGACAAGTGGGAGTACTTAGCAGC-3(SEQIDNO:24) K94W-reverse 5-GTTCCGTCATTGTCAGGG-3(SEQIDNO:25) T41W-forward 5-CAAAGATGGGTGGATCGATCTGAAAGAGGCTTTGGCGG-3 (SEQIDNO:26) T41W-reverse 5-TCCGGGTCAAACGCCGCG-3(SEQIDNO:27) T65W-forward 5-TAAAGATGGTTGGCTGGACGCCAAAGAG-3(SEQID NO:28) T65W-reverse 5-TCCGGGTCCAACTTGTCG-3(SEQIDNO:29) T114W-forward 5-CAACGATGGCTGGATTGACGCCCG-3(SEQIDNO:30) T114W-reverse 5-TCAGGGTTAGCGGCCTTA-3(SEQIDNO:31) SequencingPrimers T7P 5-TAATACGACTCACTATAGGG-3(SEQIDNO:32) T7T 5-GCTAGTTATTGCTCAGCGG-3(SEQIDNO:33) .sup.aTrp mutations are bolded
TABLE-US-00007 TABLE 2 Plasmids used in this study. Name Notes pET-24a Km.sup.R pET-24a-LanM Km.sup.R, cytosolic expression pET-24a-LanM-T41W pET-24a-LanM-T65W pET-24a-LanM-N87W pET-24a-LanM-T90W pET-24a-LanM-K94W pET-24a-LanM-T114W
[0108] Other methods of LanM purification also exist. For example, the protein could be secreted from the cell and collected from the culture, the thermal and acid stability of the protein could be exploited by treating the cells or lysate at high temperature (up to 95? C.) or low pH. Also, an ammonium sulfate fractionation may be used, e.g., precipitating most other cellular proteins with 40, 50, 60, etc. % (of saturated) ammonium sulfate, and then precipitating LanM with 100% (sat) ammonium sulfate. Other methods can also be envisioned.
[0109] Determination of optimal Trp insertion points for LRET. Initial screening for the most suitable positions for Trp placement within LanM's EF hands utilized the EF3 Trp-substituted variants, N87W, T90W, and K94W. Stoichiometric LRET titrations of 20 ?M protein in 20 mM MOPS, 100 mM KCl, 5 mM acetate, pH 7.0 (Buffer B) were carried out with a 2 mM solution of TbCl.sub.3 in the same buffer. Titrations were performed on a Cary Eclipse fluorescence spectrophotometer using a 10 mm pathlength quartz septum cell micro fluorometer cuvette (Starna Cells) with the following instrument parameters: 280 nm excitation, 400-700 nm emission scan, 5 nm excitation and emission slit widths, 120 nm/min scan rate, 1 nm data interval, 250-395 nm excitation filter, 430-1100 nm emission filter, and high PMT voltage setting. A blank solution of buffer was subtracted from each spectrum prior to analysis and spectra were corrected for volume change prior to plotting. Substituting the seventh position in EF3 (T90W) revealed the greatest magnitude of LRET signal at 545 nm (
[0110] Circular dichroism spectroscopy on wt-LanM and Trp-LanM variants. Circular dichroism (CD) spectra of wt LanM and Trp-LanM variants were collected using a Jasco J-1500 CD spectrometer, thermostatted at 25? C., using a 1-mm pathlength quartz CD cuvette. Samples were scanned from 260-190 nm, with the following instrument settings: 1.00 nm bandwidth, 0.5 nm data pitch, 50 nm/min scan rate, 4 s average time. The cuvette contained 15 ?M protein in 200 ?L Chelex-treated 30 mM MOPS, 100 mM KCl, pH 7.2 (Buffer C), into which 1 to 5 equivalents TbCl.sub.3 were titrated, and spectra were acquired. Three scans were acquired and averaged for each condition. A buffer blank spectrum was subtracted from each sample spectrum, and the spectra were corrected for volume change before plotting.
[0111] K.sub.d determinations using CD spectroscopy. Solutions of Tb.sup.III with free metal concentration buffered using ethylenediamine N,N-disuccinic acid (EDDS) were prepared as described, in Buffer C. Protein was added to the low and high Tb.sup.III-EDDS solutions separately to a final concentration of 15 ?M, and EDDS solutions were mixed at various high:low ratios. The same ratio of high:low solutions were prepared without protein to yield the blank samples. Following a 1 hour (h) incubation at room temperature, samples were scanned from 260-210 nm, with the following instrument settings: 1.00 nm bandwidth, 0.5 nm data pitch, 50 nm/min scan rate, 4 s average time, 25? C. One accumulation was acquired for each condition. The blank spectrum acquired for each high:low ratio was subtracted from the corresponding Tb.sup.III-LanM spectrum, and [?]222 nm was plotted vs. free metal concentration.
[0112] Steady-state luminescence for K.sub.d,app determination on plate reader. EDDS-buffered solutions of Tb.sup.III were prepared as described above. Protein was added to the low and high Tb.sup.III-EDDS solutions separately to a final concentration of 10 ?M, and EDDS solutions were mixed at various high:low ratios. Following a 1-h incubation at room temperature, time-resolved fluorescence emission was monitored from 400-700 nm on a BioTek Synergy H1 microplate reader in Greiner Cellstar 96-well half-area pClear plates with the following instrument settings: time-resolved delay 50 ?s, collection time 1000 ?s, fixed excitation at 295 nm, emission 400-700 nm with 1 nm steps, gain of 120, and read speed delay 200 ms. Data points were corrected for the significant contribution from emission of the Tb.sup.III-EDDS complex, determined by running matching samples in the absence of protein. Data were analyzed by averaging the fluorescence emission at 544-546 nm and plotting against [Tb.sup.III.sub.free].
[0113] Luminescence lifetimes for q determination. Protein was diluted to 10 ?M with 30 ?M TbCl.sub.3 in Buffer C. For D.sub.2O containing samples, protein solutions (3 mL) were lyophilized overnight and resuspended in an equal volume of D.sub.2O, the process was repeated, and then 10 ?M protein in H.sub.2O and 10 ?M protein in D.sub.2O were mixed in different proportions to achieve the % D.sub.2O concentrations desired (0-75%). Lifetime measurements were obtained on a PerkinElmer FL 6500 Fluorometer with the following parameters: data mode phosphorescence (short), excitation correction off, source mode pulse, flash count 1, flash power 120 kW, frequency 50 Hz, excitation wavelength 295 nm, excitation slit 5 nm, excitation filter air, emission wavelength 545 nm, emission slit 5 nm, emission filter air, PMT voltage 700 V, PMT gain auto, emission correction off, response time 0.5 s, delay time 0 ?s, gate time 20 ms. Three independent trials were performed for each condition, and the ? values determined from the fitted curves were averaged and plotted against % H.sub.2O to determine ?(D.sub.2O) from the y-intercept of the line. The values of q were calculated using the method of Horrocks (eq. 1), where A=5.0 ms.
[0114] Stopped-flow fluorometry. Stopped-flow fluorometry measurements were carried out at 25? C., maintained by a circulating water bath. One syringe contained a solution of 10 ?M Trp-LanM and 30 ?M TbCl.sub.3, prepared in Chelex-treated Buffer C. The contents of this syringe were mixed in a 1:1 ratio with solutions of EGTA (10, 5, 2.5, and 1.25 mM, in Chelex-treated Buffer C) in a second syringe. Data were acquired with the following parameters: 1 mm slit width, 2 mm pathlength, with excitation at 295 nm, collecting 2000 data points over 120 s (T41W) or 200 s (T90W), and 12.5 ?s sample period. Three shots were collected and averaged for each condition. Although a 450 nm long-pass filter was used, there was some residual Trp fluorescence in addition to the LRET signal in the emission channel. Curve fitting was performed in Origin 2018, fitted to either a single exponential (T41W) or a double exponential (T90W) decay.
[0115] Determination of limits of detection in plate reader luminescence assays. TbCl.sub.3 stock solutions (10-50 ?M) were made fresh each day in 20 mM acetate, 100 mM KCl, pH 5.0 (Buffer D). Protein samples were diluted to 1 ?M or 10 ?M in each of the following buffers: Buffer B (pH 7.0); Buffer D (pH 5.0); 20 mM acetate, 100 mM KCl, pH 4.0 (Buffer E); 20 mM ammonium formate, 100 mM KCl, pH 3.0 (Buffer F); and 20 mM ammonium formate, 100 mM KCl, pH 2.0 (Buffer G). Time-resolved luminescence emission was monitored from 400-700 nm (1 nm increments) in Greiner BioOne 96-well white flat-bottom Lumitrac plates with the following instrument settings: time-resolved delay 200 ?s, collection time 1000 ?s, fixed excitation at 280 nm, gain of 140, and read speed delay 100 ms. A blank containing buffer and Tb was subtracted from each corresponding spectrum prior to data analysis. Data were analyzed by averaging the emission at 544-546 nm from three independent replicates and plotting against Tb concentration (0.8 ppb to 35.8 ppb, or 5 to 225 nM). Limits of detection were calculated from the slope (m) of the regression line (Origin 2018) and the standard deviation (s) of the sample with the lowest Tb concentration that displayed a peak across the entire pH range (2.4 or 15.9 ppb, for T90W and T41W, respectively), according to eq. 2.
[0116] Quantification of Tb in AMD using T90W-LanM. Time-resolved luminescence emission was monitored from 400-650 nm in Greiner BioOne 96-well white flat-bottom Lumitrac plates with the same instrument settings as above. The sample volume was 200 ?L. With these settings, there was no significant emission from the AMD in the blank sample (without protein). For terbium detection, T90W-LanM was added to a concentration of 10 ?M, from a 1 mM stock in Buffer A. Addition of the protein did not significantly affect pH of the AMD. Tb concentration was determined by averaging the emission at 544-546 nm. To enable Tb quantification, a standard curve was generated by mixing the same volumes of AMD and protein as above but with 0.4-2 ?L of 2.5 ppm Tb.sup.III in Buffer D added, to yield 5-25 ppb Tb. The data with 0, 5, 10, 15, 20, and 25 ppb Tb added were fitted to a regression line, and the emission of the sample without Tb added was divided by the slope of the line, yielding the estimated Tb concentration.
Results and Discussion
[0117] Determination of optimal Trp insertion points in LanM. LanM possesses no Trp residues natively, facilitating the strategy to site-specifically probe metal binding using sensitized luminescence. On the basis of the NMR solution structure of Y.sup.III-bound LanM, three positions were selected in EF3-N87 (4.sup.th position), T90 (7.sup.th position), and K94 (11.sup.th position)for Trp substitution and preliminary assays of energy transfer efficiency. It was hypothesized that these substitutions would minimally interfere with metal ion binding yet also be sufficiently close to the Tb.sup.III ion to yield a robust LRET signal. These variants were screened by stoichiometric Tb.sup.III titrations (pH 7.2), exciting the Trp at 280 nm and monitoring in-growth of the luminescence spectrum of Tb.sup.III, in particular the most intense feature at ?545 nm (
[0118] The Trp-substituted LanM variants (Trp-LanMs) were evaluated by CD spectroscopy to determine whether the Trp residue affected the apparent dissociation constant (K.sub.d,app) and magnitude of the Tb.sup.III-induced conformational change. All variants exhibited the same overall conformational change as the wild-type LanM (?2.5-3-fold increase in the molar ellipticity at 222 nm, indicating increased helicity in the presence of Tb.sup.III ions), with the notable exception of the EF2 insertion, T65W, which displays less helicity in the apoprotein as well as a nearly completely disrupted conformational response (
[0119] K.sub.d,app values were determined for the Tb.sup.III-bound Trp variants in comparison to wt LanM (
TABLE-US-00008 TABLE 3 Apparent K.sub.d values and Hill coefficients (n) for Trp-LanMs, determined using CD spectroscopy and luminescence methods, and monitored at various EDDS-buffered free Tb.sup.III ion concentrations. Uncertainties represent mean ? SD for 3 independent experiments. Circular dichroism titrations Luminescence titrations Construct K.sub.d, app (pM) n K.sub.d, app (pM) n WT 7.3 ? 0.9 2.2 ? 0.5 NA.sup.a NA T41W (EF1) 22 ? 1 1.9 ? 0.2 42 ? 3 1.3 ? 0.1 T90W (EF3) 17 ? 3 1.3 ? 0.2 66 ? 8 0.8 ? 0.1 K94W (EF3) 6.1 ? 0.6 2.7 ? 0.5 6.2 ? 2.9 2.2 ? 0.6 T114W (EF4) 10 ? 1 2.1 ? 0.4 15 ? 1 1.5 ? 0.2 .sup.aNA: not applicable
[0120] Steady state luminescence elucidates cooperative linkages between LanM's EF hands. Having characterized the overall conformational responses of the Trp-LanM variants, we next exploited the long-lived luminescence of Tb.sup.III (
[0121] Overall, T41W and T90W showed the largest LRET response (
[0122] Consistent with the CD titrations, T90W is clearly a disruptive position for Trp placement within EF3, as revealed by a Hill coefficient, n?1, indicating a lack of cooperativity, and a high K.sub.d as compared to wt. Interestingly, the K.sub.d,app value derived from the LRET data approximately corresponds to the apparent second phase in the CD titrations, with K.sub.d,app-100 ?M. These perturbations meant it was difficult to draw conclusions about cooperativity of metal binding using this variant. Therefore, the K94W variant, which displayed fully wt behavior in CD titrations, was instead used to investigate Tb.sup.III binding to EF3. Although the LRET intensities observed with this variant were low (
[0123] Together, these data support the model for metal binding and conformational change presented in
[0124] Luminescence lifetimes to investigate coordinated waters. Another critical aspect of understanding LanM's function is the structure of the metal binding sites. The determination of the NMR structure of Y.sup.III-bound LanM was unable to determine whether protein residues saturated the metal-binding sites, or whether solvent molecules filled part of the coordination spheres. This information can be obtained from the lifetime of the Tb.sup.III excited state, which is sensitive to the presence of coordinated water molecules due to the radiationless decay of the excited state via OH vibrations. Because this decay pathway is suppressed in D.sub.2O, the empirical relationship between the difference in decay rate constants (?.sup.?1) in the presence of H.sub.2O and D.sub.2O has been shown to yield the approximate number of coordinated water molecules (q). Therefore, LanM was probed using this method, utilizing the T41W and T90W variants because of their strong luminescence and representation of both pairs of EF hands. In both cases, the decays of the luminescence signals could be fitted to single exponentials (
[0125] Probing kinetics of Tb(III) binding using stopped-flow spectrofluorometry. LanM's remarkable affinity for lanthanides may be explained by either a faster rate of metal association, slower rate of metal dissociation, or both, relative to other EF-hand proteins. The large luminescence changes associated with Tb.sup.III binding to the T41W and T90W LanM variants, despite the perturbations in apparent K.sub.d, allowed us to use stopped-flow spectrofluorometry to investigate the kinetics of site-specific Tb.sup.III dissociation from LanM. In these experiments, the Trp-LanM variants were pre-loaded with 3 equivalents Tb.sup.III and rapidly mixed with solutions of ethylene glycol-bis(p-aminoethyl ether)-N,N,N,N-tetraacetic acid (EGTA) at four different concentrations and decay of the fluorescence signal above 450 nm (primarily the Tb.sup.III luminescence) was monitored. Plotting of the decay rate constants (k.sub.obs) at each EGTA concentration and extrapolation of the line to zero EGTA enables estimation of the dissociation rate constant (k.sub.off) in the absence of chelator (
[0126] Even though LanM exhibits several orders of magnitude higher affinities for Ln.sup.III ions than most other EF-hand proteins, LanM's k.sub.off values are within the typical range for Tb.sup.III dissociation from the proteins in this family (e.g., 0.05 and 0.5 s.sup.?1 for parvalbumin and 0.01 s.sup.?1 for galactose binding protein). The similarity of these values may be accounted for by the similar numbers of coordinated solvent molecules, as determined above. From the k.sub.off values and K.sub.d,app values (Table 3), both determined based on LRET, k.sub.on was estimated to be ?8?10.sup.8 M.sup.?1 s.sup.?1 for T41W and 3-7?10.sup.8 M.sup.?1 s.sup.?1 for T90W (in the case of T90W, a single K.sub.d,app value from the LRET titrations but two different k.sub.off values prevents calculation of a single k.sub.on). These rate constants are very close to the diffusion limit, which is on the order of 10.sup.9-10.sup.10 M.sup.?1 s.sup.?1. Such rapid association kinetics may help to account for LanM's ability to selectively bind lanthanides even in complex solutions, with hundreds of millions-fold excess of competing metal ions. The optimization of LanM's k.sub.on values for lanthanide binding appears to be a key feature of the protein's metal recognition, whereas its dissociation rates are rather typical among EF-hand proteins. However, control of k.sub.off may still be important; the observation that k.sub.on is near-optimal even for Tb.sup.III, whereas LanM has even higher affinity for the early Ln.sup.III ions, suggests that k.sub.off differences may govern LanM's selectivity within the lanthanide series.
TABLE-US-00009 TABLE 4 Kinetic parameters from the fitted stopped-flow spectrofluorometry data. Experimental curves were fitted to a single exponential decay (T41W) and a double exponential decay (T90W, see FIG. 14C). [EGTA], T41W T90W mM k.sub.1 Amplitude k.sub.1 Amplitude k.sub.2 Amplitude 5.00 0.0676 ? 0.0002 2.744 ? 0.003 0.064 ? 0.005 2.6 ? 0.2 0.033 ? 0.004 1.9 ? 0.2 2.50 0.0511 ? 0.0002 2.642 ? 0.003 0.054 ? 0.007 2.2 ? 0.3 0.027 ? 0.002 2.3 ? 0.2 1.25 0.0417 ? 0.0001 2.628 ? 0.003 0.06 ? 0.01 1.1 ? 0.2 0.025 ? 0.002 2.7 ? 0.2 0.63 0.0366 ? 0.0001 2.617 ? 0.004 0.047 ? 0.006 1.6 ? 0.2 0.020 ? 0.002 2.3 ? 0.2
[0127] Trp-LanMs exhibit low limits of detection over a wide pH range. Whereas use of Trp-LanMs to characterize mechanism, structure, and kinetics of LanM was carried out at pH 7.2, potential broader application of these proteins as sensors would require responsiveness under a range of conditions, particularly in the presence of other metal contaminants and at low pH. Although LanM can selectively and quantitatively extract REEs from low-grade feedstocks containing only 30 ppm (?200 ?M) total REEs, environmental samples such as AMD typically harbor much lower concentrations, <1 ppm REEs, and Tb at only low ppb levels. Meanwhile, both these applications and monitoring of industrial processes necessitate robust performance at lower pHs than previous LaMP1 sensor could provide. With an eye toward these applications, the pH dependence and limits of detection (LODs) of Trp-LanM luminescence were determined.
[0128] The T41W and T90W variants were used for these experiments, as they exhibited the greatest sensitized luminescence intensity of the Trp-LanM constructs characterized. Standard curves were generated with Tb.sup.III concentrations ranging 0.8-36 ppb and between pH 2 and pH 7, in the presence of 1 or 10 ?M of each protein. Given the long luminescence lifetime observed (
[0129] For comparison of Trp-LanM performance with other luminescence-based Tb sensors, LODs and limits of quantification (LOQs) were calculated as described herein. LODs of the best performing sensor at low pH, T90W, are below 5 ppb over the pH 3-7 range, even at 1 ?M T90W (Table 5). Even at pH 3, the LOD values are similar to (or better than) the lowest values reported for other complexes, which are often reported at pH 7. These results suggested that T90W-LanM might be robust enough to detect Tb even in challenging environmental samples.
TABLE-US-00010 TABLE 5 Limits of detection (LODs) and limits of quantification (LOQs) for Tb, in ppb, of T41W and T90W LanM variants, at pH 3-7, using 1 or 10 ?M protein. Each number denotes the mean ? S.D. (n = 3). Construct pH 7 pH 5 pH 4 pH 3 LOD (ppb) T41W-LanM 1.52 ? 0.03 0.38 ? 0.02 10.6 ? 0.6 19 ? 3 T90W-LanM 2.4 ? 0.1 3.2 ? 0.2 1.30 ? 0.03 4.8 ? 0.3 (1 ?M) T90W-LanM ND.sup.a ND 2.4 ? 0.1 0.78 ? 0.02 (10 ?M) LOQ (ppb) T41W-LanM 5.1 ? 0.1 1.3 ? 0.1 35 ? 2 62 ? 10 T90W-LanM 7.9 ? 0.4 10.6 ? 0.5 4.3 ? 0.1 16 ? 1 (1 ?M) T90W-LanM ND ND 8.0 ? 0.3 2.6 ? 0.1 (10 ?M) .sup.aND: not determined
[0130] Application to quantification of terbium in acid mine drainage. In order to stringently challenge the affinity and selectivity of Trp-LanM and assess its potential for environmental monitoring, the performance of the most promising construct, T90W-LanM, was tested in acid mine drainage. AMD is effluent from active and abandoned mines, by which natural processes leads to release of metals, including REEs, from ores. AMD is often enriched in the rarer and more valuable heavy REEs due to the mechanism of natural acid-based extraction processes. The presence of existing infrastructure required to treat AIMD sites and mitigate their environmental impact prior to release of the AMD into natural waters has motivated investigation into feasibility of extracting REEs from these sources, in order to convert waste into revenue streams. An estimated 770 to 3400 tonnes of REEs are potentially accessible per year from AMD in Pennsylvania and West Virginia (USA) alone; for comparison, current domestic consumption of REEs is estimated at 13,000 tonnes per year. A field-deployable sensor for specific REEs such as Tb, or even a simpler laboratory procedure for analysis, could enable more rapid assessments of the value of new sites for development for REE extraction, as well as inexpensive in-line monitoring of extraction processes once implemented, compared to current ICP-MS or XFM elemental quantification methods.
[0131] Samples of AMD (pH 3.24) collected from the feed of an AMD treatment facility in Pennsylvania, USA were used. Analysis of the sample using ICP-MS showed the presence of 300 ppm total metal ions, including high levels of potential interferents: 239 ppm (9.6 mM) Mg, 25 ppm (0.45 mM) Mn, 19 ppm (0.70 mM) Al, 12 ppm (0.41 mM) Si, and 1.5 ppm (22 ?M) Zn (see Table 6 for the full analysis). The sample also contained 280 ppb total REEs and only 3.3 ppb Tb. As expected based on the LODs for T90W-LanM at pH 3 (Table 5), 1 ?M sensor did not yield a luminescence signal clearly above background. However, when 10 ?M T90W-LanMa concentration far below the total metal concentrationwas added, the Tb luminescence features at ?490 and ?545 nm were clearly visible above the background sample with no protein added (
TABLE-US-00011 TABLE 6 ICP-MS analysis of the acid mine drainage sample used for Tb detection, with elements listed in order of atomic number. V, Cr, Zr, and Th were analyzed but not detected. Element ppb Concentration (M) Li 145.9 2.10 ? 10.sup.?5 Be 11.98 1.33 ? 10.sup.?6 Na 3994 1.74 ? 10.sup.?4 Mg 233000 9.59 ? 10.sup.?3 Al 18940 7.02 ? 10.sup.?4 Si 11530 4.10 ? 10.sup.?4 K 3217 8.23 ? 10.sup.?5 Ca 3109 7.76 ? 10.sup.?5 Sc 2.85 6.33 ? 10.sup.?8 Ti 292.2 6.10 ? 10.sup.?6 Mn 24790 4.51 ? 10.sup.?4 Fe 424.2 7.60 ? 10.sup.?6 Co 481.1 8.16 ? 10.sup.?6 Ni 736.6 1.25 ? 10.sup.?5 Cu 18.23 2.87 ? 10.sup.?7 Zn 1454 2.22 ? 10.sup.?5 Sr 53.01 6.05 ? 10.sup.?7 Y 93.35 1.05 ? 10.sup.?6 Cd 1.27 1.13 ? 10.sup.?8 Ba 8.61 6.27 ? 10.sup.?8 La 14.18 1.02 ? 10.sup.?7 Ce 45.84 3.27 ? 10.sup.?7 Pr 7.10 5.04 ? 10.sup.?8 Nd 36.44 2.53 ? 10.sup.?7 Sm 12.40 8.25 ? 10.sup.?8 Eu 3.56 2.35 ? 10.sup.?8 Gd 20.71 1.32 ? 10.sup.?7 Tb 3.32 2.09 ? 10.sup.?8 Dy 18.87 1.16 ? 10.sup.?7 Ho 3.53 2.14 ? 10.sup.?8 Er 9.31 5.56 ? 10.sup.?8 Tm 1.08 6.42 ? 10.sup.?9 Yb 6.68 3.86 ? 10.sup.?8 Lu 0.88 5.01 ? 10.sup.?9 Pb 1.37 6.63 ? 10.sup.?9 U 1.48 6.22 ? 10.sup.?9
[0132] Because components of the AMD matrix (other metal ions, as well as anions) could affect quantification, a standard curve was generated in the AMD itself by adding 0-25 ppb Tb.sup.III in the presence of 10 ?M T90W-LanM (
[0133] The performance of Trp-LanM (and T90W-LanM specifically) in detecting Tb at low concentration even in complex media compares favorably with other luminescence-based sensors, both biomolecular and synthetic. Perhaps most conceptually similar to Trp-LanM is the LBT, but its affinity for Tb is only 60 nM at pH 7. Because this affinity is 3-4 orders of magnitude lower than that of LanM, LBTs would not be expected to function at pH 3. Indeed, attempts to use LBTs for Tb.sup.III binding and sensing at pH values below ?5-6 have been unsuccessful. A cell-based sensor incorporating an LBT into a bacterial two-component system responds to as little as ?0.2 ?M (30 ppb) Tb at neutral pH, but also responds significantly to other metals (e.g., Ca.sup.II at 50 ?M) at concentrations that would be present in environmental samples (e.g., our AMD sample contains 3.11 ppm, or 78 ?M, Ca). Numerous synthetic luminescence-based sensors for lanthanides, including Tb, have been characterized, with a wide range of detection limits. Some of these sensors have been characterized in natural samples, although at higher pH values than AMD and spiked with Tb. A particularly extensively explored approach in recent years utilizes metal-organic frameworks (MOFs), exhibiting better tolerance to lower pHs than LBTs and other sensors but also quenching from interactions with other ions due to low selectivity. One of the most promising examples is a zinc-adeninate MOF for detection of several lanthanides (BioMOF-100), yielding an LOD for Tb of 90 ppb in neutral water. Very recently, others have characterized even more sensitive MOFs with LODs of 6 ppb Tb in neutral water. However, when this sensor was applied in an AMD sample containing ?1 ppb Tb at pH 3.4, the sample had to be spiked with 800 ppb (5 ?M) Tb to be able to observe a signal. By contrast, simply adding T90W-LanM directly to AMD detects and quantifies 3 ppb Tb present in AMD at pH 3.24, without any spiking. This comparison shows that the high affinity and selectivity of LanM for lanthanides provides a significant advantage over conventional REE sensitizer ligands, which (while they may have high affinity), usually do not have sufficient selectivity to work well in complex solutions like AMD.
CONCLUSION
[0134] Incorporation of Trp residues site-specifically into LanM's metal-binding sites not only provides insights into the protein's metal recognition but also yields a technology capable of specific detection of terbium, even in complex samples. Established herein are several aspects of LanM function. First, these results indicate EF2 and EF3 as LanM's preferred metal-binding sites and responsible for the cooperative binding phase. EF1 is slightly lower affinity, but appears to be more destabilized at low pH values, even though metal binding is retained. This result suggests that EF1 might be the most dispensable site for applications of LanM to REE extraction and separations. In addition, it was shown that LanM-bound Tb.sup.III ions possess two coordinated solvent molecules. The presence of these coordinated solvent molecules may explain the observation that LanM's association kinetics are extremely and uncommonly fast, perhaps minimizing the energetic penalty for dehydration upon metal binding. Rapid kinetics may be useful for separations applications, whereas these results also suggest that it may be possible to mutate the protein to decrease metal dissociation rates for other applications. Furthermore, these data establish EF3, and particularly the T90 position, as a location for installation of sensitizers within the protein scaffold with acceptable perturbation of metal binding and strong responsiveness across a wide pH range. Other lanthanides may be detected besides Tb via their unique luminescence signatures, including other valuable REEs such as Eu, Dy, Sm, and Nd, but Trp is unlikely to be a suitable sensitizer for these elements. Some of these sensitizers suitable could include, but are not limited to, unnatural Trp analogs (e.g., aza-tryptophans, including 4-aza, 5-aza, and 7-aza-tryptophans; cyano-tryptophans; and the boron- and nitrogen-containing BN-tryptophan) as well as naphthalimides, coumarins, acridones (e.g., acridon-2-ylalanine residues), and other fluorophores, which might be installed using auxotrophic strains, genetic code expansion methodologies, or via reaction with a Cys or other nucleophilic residue. Finally, the related coordination chemistry of the trivalent actinides suggests that Trp-LanMs may also serve as efficient sensitizers for some of these elements, such as Cm.sup.III or perhaps even Am.sup.III.
[0135] The information herein can be used to design screens to alter metal selectivity in LanMfor example, to increase differences in affinity between one REE and another REE (e.g., Nd vs. Dy, or Nd vs. Tb, or Tb vs. Dy, or any other combination of REEs) and thereby to increase affinity differences across the entire REE series. First, the present disclosure suggests that the most productive EF hands to re-engineer metal selectivity would be EF hands 2 and 3, and not EF1. EF1 could be disabled with minimal impact on the rest of the protein via the D35N substitution. Second, the characterization of optimal positions for luminescent sensitizers can be used in assay design. K94W is the least perturbative position, giving a luminescent probe of Tb binding to EF3; while the luminescence intensity of this variant is low, it may still be sufficient for a screening assay. It may be possible to, analogously, substitute the 11.sup.th position of EF2 as well. N87W is slightly defective in Tb binding, and T90W is more so, but the LRET signal is strong and this could also be a suitable position for a screening assay. For example, one could start with the K94W variant, randomize various amino acids within EF2 and/or EF3 and/or in the vicinity of these EF hands (except for Trp94 itself), add TbCl.sub.3 to saturate the protein binding sites, and then screen for most (or least) efficient outcompetition of the Trp-LanM-sensitized Tb luminescence signal by different concentrations of Nd, or Dy, or any other REE. Such a screening setup would provide an inherent comparison of the affinities of the protein for Tb versus any other REE in an effort to maximize those affinity differences to aid in REE separations. Similar experiments could be envisioned to alter metal selectivity from the REEs altogether, such as for uranyl (U.sup.VI), or lithium (Li.sup.+), or manganese (Mn.sup.II), or iron (Fe.sup.II), or cobalt (Co.sup.II), or any other element in its ionic form. Numerous variations of the above approach can be envisioned and the above description is not intended to be limiting.
[0136] The adaptability of this system to readily available luminescence detectors motivates further exploration and application of protein-based systems for rapid and inexpensive quantification of specific f-elements in natural sources and in separation processes.
Example 2
[0137] This example provides a description of a protein of the present disclosure and methods of making and using same.
[0138] Methods. All protein expression and purification and LRET titrations were performed analogously to the previous description (Featherston et al., JACS2021).
[0139] Rationale. Initial experiments (in the provisional application) revealed that, in general, the seventh positions of LanM's EF hands were most suitable for tryptophan placement in EF hands 1, 3, and 4, but installing this mutation at this position in EF hand 2 (T65W) disrupted protein function. Stoichiometric Tb.sup.III titrations monitored by CD showed that T65W displayed less helicity in the apoprotein as compared to WT LanM, as well as a nearly completely disrupted conformational response up to 5 equivalents of Tb.sup.III. Nevertheless, these experiments did reveal the particular importance of EF2 in the metal-responsive conformational change of lanmodulin, making it desirable to be able to probe metal binding in this EF hand, as previously done. It was rationalized that Trp placement within EF2 further away from the EF2-EF3 interface would be less disruptive to metal binding and conformational change. The data in Example 1 showed that the 11.sup.th position of EF3 (K94W) did not perturb metal binding, thus a Trp was tested at the 11.sup.th position in EF2 (K69W). Because LRET efficiency was rather low in K94W, an alternative Trp substitution site in EF2, the 4.sup.th position (K62W) was also tested.
TABLE-US-00012 TABLE7 AminoacidsequencesoftheTrp-LanMvariantsusedinthese studies.Mutationsitesareindicatedinbold. Construct Sequence T41W APTTTTKVDIAAFDPDKDGWIDLKEALAAGSAAFDKLDPDKDGTL DAKELKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPD NDGTIDARELASPAGSALVNLIR(SEQIDNO:11) K62W APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDWDGTLD AKELKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDN DGTIDARELASPAGSALVNLIR(SEQIDNO:19) T65W APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGWL DAKELKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPD NDGTIDARELASPAGSALVNLIR(SEQIDNO:12) K69W APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGTLD AWELKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDN DGTIDARELASPAGSALVNLIR(SEQIDNO:34) T90W APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGTLD AKELKGRVSEADLKKLDPDNDGWLDKKEYLAAVEAQFKAANPDN DGTIDARELASPAGSALVNLIR(SEQIDNO:14) K94W APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGTLD AKELKGRVSEADLKKLDPDNDGTLDKWEYLAAVEAQFKAANPDN DGTIDARELASPAGSALVNLIR(SEQIDNO:15) T114W APTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGTLD AKELKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDN DGWIDARELASPAGSALVNLIR(SEQIDNO:16)
[0140] Results. Both K62W and K69W resulted in efficient luminescence as measured by LRET. Both constructs have K.sub.d,app and Hill coefficients relatively close to the CD-derived values for WT-LanM. The overall change in magnitude in luminescence is greater for K62W then K69W and shows greater reproducibility. The maximum luminescence of K62W is ?0 that of T90W. Therefore, K62W is the best position of those tested for Trp insertion to EF2 in terms of LRET data.
TABLE-US-00013 TABLE 8 K.sub.d, app and Hill coefficients (n) for K62W- and K69W-LanM. Construct K.sub.d, app (pM) n K62W-LanM 21 ? 2 3.0 ? 0.8 K69W-LanM 10.5 ? 0.9 2.0 ? 0.2
[0141] Although the present disclosure has been described with respect to one or more particular embodiments and/or examples, it will be understood that other embodiments and/or examples of the present disclosure may be made without departing from the scope of the present disclosure.