Choline acetyltransferase as a therapy for hypertension
12109255 ยท 2024-10-08
Assignee
Inventors
- Kevin J. Tracey (Old Greenwich, CT)
- Sangeeta S. Chavan (Syosset, NY)
- Andrew Stiegler (Deer Park, NY, US)
- Jian Hua Li (New York, NY, US)
Cpc classification
International classification
A61K47/60
HUMAN NECESSITIES
Abstract
Compositions and methods are provided comprising choline acetyltransferase (ChAT) and PEGylated ChAT for treating hypertension.
Claims
1. A method of reducing systemic hypertension in a subject in need thereof comprising administering to the subject a choline acetyltransferase (ChAT) protein or a ChAT protein conjugated to polyethylene glycol (PEG) in an amount and manner effective to reduce systemic hypertension in a subject, wherein the subject is an adult human 18 years or older who prior to administration of ChAT protein or PEGylated ChAT protein had a resting systolic blood pressure at or above 130 mmHg and/or a diastolic blood pressure at or above 80 mmHg, and wherein administration of ChAT protein or PEGylated ChAT protein is effective to reduce systolic blood pressure by 10-40 mmHg.
2. The method of claim 1, wherein ChAT protein is conjugated to polyethylene glycol (PEG).
3. The method of claim 2, wherein ChAT protein is conjugated to 2-24 PEG chains.
4. The method of claim 2, wherein ChAT protein is conjugated to 12 PEG chains.
5. The method of claim 2, wherein each PEG chain has a molecular weight of 200-2,000 daltons.
6. The method of claim 1, wherein the subject is an adult human 18 years or older who prior to administration of ChAT protein or PEGylated ChAT protein had a resting systolic blood pressure at or above 140 mmHg and/or a diastolic blood pressure at or above 90 mmHg.
7. The method of claim 1, wherein the subject has primary hypertension.
8. The method of claim 1, wherein the subject has secondary hypertension.
9. The method of claim 8, wherein the subject has narrowing of the arteries and/or chronic kidney disease.
10. The method of claim 1, wherein ChAT protein or PEGylated ChAT protein is administered by intravenous or intraperitoneal injection or via a pump.
11. The method of claim 1, wherein ChAT protein or PEGylated ChAT protein is administered by injections or infusions spaced over an interval of one or more days.
12. The method of claim 1, wherein ChAT protein or PEGylated ChAT protein is chronically administered via a pump.
13. The method of claim 1, wherein administration of ChAT protein or PEGylated ChAT protein is effective to reduce systolic blood pressure by at least 10 mmHg.
14. The method of claim 1, wherein administration of ChAT protein or PEGylated ChAT protein is effective to reduce systolic blood pressure by at least 20 mmHg.
15. The method of claim 1, wherein administration of ChAT protein or PEGylated ChAT protein is effective to reduce systolic blood pressure by at least 30 mmHg.
16. The method of claim 1, wherein ChAT protein or PEGylated ChAT protein is human recombinant ChAT protein.
17. The method of claim 1, wherein ChAT protein or PEGylated ChAT protein is ChAT protein isoform R.
18. The method of claim 1, wherein the subject does not have any one or more of an age-related cognitive disorder, Alzheimer's disease, a neurodegenerative disease, amyotrophic lateral sclerosis, senile dementia, multi-infarct dementia, familial dysautonomia, Huntington's disease, mental retardation, memory loss, myasthenia gravis, a gastrointestinal tract disorder, a spinal cord disorder, a brainstem disorders, a hypothalamic disorder, a limbic system disorder and dementia.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
DETAILED DESCRIPTION OF THE INVENTION
(9) The present invention provides a method of reducing systemic hypertension in a subject in need thereof comprising administering to the subject choline acetyltransferase (ChAT) or ChAT conjugated to polyethylene glycol (PEG) in an amount and manner effective to reduce hypertension in a subject.
(10) Preferably, the ChAT is human ChAT. The ChAT can be a recombinant ChAT. In one embodiment, the ChAT is ChAT isoform R.
(11) The ChAT can be conjugated to polyethylene glycol (PEG). For example, ChAT can be conjugated to 2-24 PEG chains. In one embodiment, ChAT is conjugated to 12 PEG chains. Each PEG chain can have a molecular weight of, for example, 200-2,000 daltons. In one embodiment, PEG-ChAT has a molecular weight about 20,000 daltons greater than ChAT. Conjugation of PEG to ChAT can be effective to increase the solubility and/or half-life of ChAT.
(12) The subject can be any mammal and is preferably a human. In one embodiment, the subject is an adult human 18 years or older who prior to administration of ChAT or PEGylated ChAT had a resting systolic blood pressure at or above 130 mmHg and/or a diastolic blood pressure at or above 80 mmHg. In one embodiment, the subject is an adult human 18 years or older who prior to administration of ChAT or PEGylated ChAT had a resting systolic blood pressure at or above 140 mmHg and/or a diastolic blood pressure at or above 90 mmHg. In one embodiment, the subject has primary hypertension. In one embodiment, the subject has secondary hypertension. In one embodiment, the subject has narrowing of the arteries and/or chronic kidney disease.
(13) In one embodiment, the subject does not have any one or more of an age-related cognitive disorder, Alzheimer's disease, a neurodegenerative disease, amyotrophic lateral sclerosis, senile dementia, multi-infarct dementia, familial disautonomia, Huntington's disease, mental retardation, memory loss, myasthenia gravis, a gastrointestinal tract disorder, a spinal cord disorder, a brainstem disorders, a hypothalamic disorder, a limbic system disorder and dementia.
(14) ChAT or PEGylated ChAT can be administered by any route known to those skilled in the art. In different embodiments, ChAT or PEGylated ChAT is administered by intravenous or intraperitoneal injection or infusion via a device such as an osmotic pump. In one embodiment, ChAT or PEGylated ChAT is administered by injections or infusions spaced over an interval of one or more days.
(15) Preferably, administration of ChAT or PEGylated ChAT is effective to reduce systolic blood pressure by at least 10 mmHg, more preferably by at least 20 mmHg, and most preferably by at least 30 mmHg. In one embodiment, administration of ChAT or PEGylated ChAT is effective to reduce systolic blood pressure by 10-40 mmHg.
(16) Also provided is a pharmacological composition comprising choline acetyltransferase (ChAT) conjugated to polyethylene glycol (PEG) and a pharmaceutically acceptable carrier. For example, ChAT can be conjugated to 2-24 PEG chains. In one embodiment, ChAT is conjugated to 12 PEG chains. Each PEG chain can have a molecular weight of, for example, 200-2,000 daltons. In one embodiment, PEG-ChAT has a molecular weight about 20,000 daltons greater than ChAT. The PEGylated ChAT can be formulated in dosage form for administration to a subject for treatment of hypertension.
(17) Examples of acceptable pharmaceutical carriers include, but are not limited to, additive solution-3 (AS-3), saline, phosphate buffered saline, Ringer's solution, lactated Ringer's solution, Locke-Ringer's solution, Krebs Ringer's solution, Hartmann's balanced saline solution, and heparinized sodium citrate acid dextrose solution.
(18) In an embodiment, human choline acetyltransferase has the following amino acid sequence (GenBank: AAA14245.1; SEQ ID NO:1):
(19) TABLE-US-00001 1mglrtakkrg1ggggkwkreegggtrgrrevrpacflqsggrgdpgdvggpagnpgcsph 61praatrppplpahtpahtpewcgaasaeaaeprragphlcipapgltktpilekvprkma 121aktpsseesglpklpvpplqqtlatylqcmrhlvseeqfrksqaivqqfgapgglgetlq 181qkllerqektanwvseywlndmylnnrlalpvnsspavifarqhfpgtddqlrfaaslis 241gvlsykalldshsiptdcakpelsgqplcmkqyyglfssyrlpghtqdtlvaqnssimpe 301pehvivaconqffvldvvinfrrlsegdlftqlrkivkmasnederlppiglltsdgrse 361waeartvlvkdstnrdsldmierciclvcldgpggvelsdthralqllhgggysknganr 421wydkslqfvvgrdatcgvvcehspfdgivlvqctehllkhmtqssrkliradsvselpap 481rrlrwkcspeiqghlassaeklqrivknldfivykfdnygktfikkqkcspdafiqvalq 541lafyrlhrrlvptyesasirrfqegrvdnirsatpealafvravtdhkaavpasekllll 601kdairaqtaytvmaitgmaidnhllalrelaramckelpemfmdetylmsnrfvlstsqv 661ptttemfccygpvvpngygacynpqpetilfcissfhscketssskfakaveeslidmrd 721lcsllppteskplatkekatrpsqghqp.
(20) In an embodiment, human choline acetyltransferase isoform R has the following amino acid sequence (GenBank: AAK08955.1; SEQ ID NO:2):
(21) TABLE-US-00002 1maaktpsseesglpklpvpplqqtlatylqcmrhlvseeqfrksqaivqqfgapgglget 61lqqkllerqektanwvseywIndmylnnrlalpvnsspavifarqhfpgtddqlrfaasl 121isgvlsykalldshsiptdcakgqlsgqplcmkqyyglfssyrlpghtqdtlvaqnssim 181pepehvivaccnqffvldvvinfrrlsegdlftqlrkivkmasnederlppiglltsdgr 241sewaeartvlvkdstnrdsldmierciclvcldapggvelsdthralqllhgggysknga 301nrwydkslqfvvgrdgtcgvvcehspfdgivlvqctehllkhmtqssrkliradsvselp 361aprilrwkcspeiqghlassaeklqrivknldfivykfdnygktfikkqkcspdafiqva 421lqlafyrlhrrlvptyesasirrfqegrvdnirsatpealafvravtdhkaavpasekll 481llkdairaqtaytvmaitgmaidnhllalrelaramckelpemfmdetylmsnrfvlsts 541qvptttemfccygpvvpngygacynpqpetilfcissfhscketssskfakaveeslidm 601rdlcsllppteskplatkekatrpsqghqp.
(22) And/or as used herein, for example, with option A and/or option B, encompasses the separate embodiments of (i) option A, (ii) option B, and (iii) option A plus option B.
(23) Where a numerical range is provided herein, it is understood that all numerical subsets of that range, and all the individual integers contained therein, are provided as part of the invention.
(24) All combinations of the various elements described herein, including all subsets, are within the scope of the invention unless otherwise indicated herein or otherwise clearly contradicted by context.
(25) This invention will be better understood from the Experimental Details, which follow. However, one skilled in the art will readily appreciate that the specific methods and results discussed are merely illustrative of the invention as described more fully in the claims that follow thereafter.
EXPERIMENTAL DETAILS
(26) Methods and Materials
(27) Animals. Male C57BL/6 mice were obtained from Jackson Laboratories (Bar Harbor, ME) at 12 weeks of age. All mice were maintained in temperature-controlled rooms on a 12 h light-dark cycle with access to food and water ad libitum. Mice were singly housed after implanting blood pressure telemeters. All experimental protocols were approved by the Institutional Animal Care and Use Committee (IACUC) at the Feinstein Institutes for Medical Research (FIMR), Northwell Health, which follows the NIH guidelines for ethical treatment of animals.
(28) Blood pressure measurements. Mice were induced under 2.5% isoflurane and implanted with HD-X10 blood pressure telemeters (DSI, New Brighton MN). A catheter was placed in the left carotid artery and advanced to the aortic arch. The telemeter body was placed in a subcutaneous pocket on the animal's flank, and blood pressure measurements were taken after an intervening period of 7 days.
(29) Angiotensin II administration. Angiotensin II human (ThermoFisher) was purchased. Osmotic pumps (Alzet model 1004, Cupertino CA, 95014) were loaded with angiotensin II in solution in varying concentrations to produce the desired flow rate (700-1500 ng/kg/min) and incubated in sterile saline at 37? C. for 48 hours before implantation. Mice were induced under 2.5% isoflurane anesthesia and a 1 cm mid-scapular incision was made. The pump was inserted and closed with a wound clip or sutures.
(30) Production of recombinant ChAT protein. Recombinant human ChAT corresponding to residue 119-748 of respective protein (EC2.3.1.6) with a N-histidine tag was expressed in E. coli BL21 (Gold) DE3 cells. When bacteria were cultured to an A600 of 0.9, IPTG (isopropyl-1-thio-beta-D-galactopyranoside) was added to a final concentration of 3 mM to induce recombinant ChAT production. Bacteria were harvested and re-suspended in cold binding buffer and sonicated at 4? C. Cells debris was removed by centrifugation and the supernatant was applied onto a high affinity Ni-charged column pre-equilibrated with binding buffer. Following sequential washings the recombinant histidine-taged ChAT protein was eluted with 0.5 M imidazole, 10% glycerol, 20%1?DPBS. The recombinant ChAT was further purified by dialysis at 4? C. and extensive Triton X-114 extraction to remove contaminating endotoxins.
(31) To increase the solubility and half-life of recombinant ChAT, unbranched amine-reactive MS(PEG)12 reagent (#22685, Thermo Scientific) was used to achieve the ChAT PEGylation. The reaction was performed in a buffer containing 10% glycerol, 20% DPBS 1?, 0.5 mM TCEP at a molar ratio of ChAT protein to MS(PEG)12 of 1 to 200-fold molar excess for 20 h at 4? C. Following PEGylation, the PEGylated protein was then dialyzed in buffer and further extracted with Triton X-114 to remove contaminating endotoxins.
(32) ChAT activity assay. Activity of recombinant and PEGylated recombinant ChAT were analyzed using a colorimetric assay. ChAT and its substrates choline and acetyl-coenzyme A are incubated at 37? C. for 15 minutes. After incubation, a cocktail containing choline oxidase, 4-aminoantipyrine, phenol, and HRP is added. A red color develops in proportion to the choline remaining in the reaction mixture. By subtracting the remaining choline in wells containing ChAT from the choline remaining in a well without any enzyme, the reaction rate can be calculated.
(33) Data Analysis. Data were analyzed using Graphpad Prism 7.0, Microsoft Excel, DSI Ponemah 6.4, and the R package tidyverse. Statistical significance was calculated using one-way ANOVA with Tukey's correction for multiple comparisons (e.g.,
(34) Results
(35) Administration of ChAT protein decreases blood pressure. An E. coli expression system was used to produce recombinant ChAT protein. Isoform R of ChAT was selected. The purified protein has a molecular weight of approximately 72 kDa. A colorimetric assay was used to determine the enzymatic activity of the recombinant protein. This ChAT protein has greater than 2-fold higher specific activity than commercially available ChAT (MyBioSource MBS653740) (
(36) Chronic administration of ChAT using an osmotic pump decreases peak, average and hourly systolic blood pressure in hypertensive animals. Animals were implanted with angiotensin-II osmotic pumps to induce hypertension after collecting 3 days of baseline BP data. After implanting angiotensin-II osmotic pumps, the animals recovered for 10 days before collecting hypertensive BP data. Twenty-five days after hypertensive BP data collection, the angiotensin-II pumps were replaced with new angiotensin-II pumps. During the angiotensin-II pump replacement surgery, animals also received an additional osmotic pump containing either saline (0.9%) or ChAT solution (3.4 mg/mL, 220 ng/kg/min), n=5 both groups. After 5 days of recovery, BP data were recorded for 3 days.
(37) Peak systolic blood pressure (SBP) data were recorded for 3 days in the baseline, hypertensive and treated recording period. The average data are shown in
(38) Chronic administration of ChAT using an osmotic pump decreases average SBP in hypertensive animals (
(39) PEGylated ChAT leads to greater reductions in blood pressure than rChAT. To increase the duration of the effect of recombinant ChAT administration, ChAT was PEGylated to create PEGylated recombinant ChAT (PEG-ChAT). PEGylation increases hydrodynamic radius and immunogenicity, leading to more durable biologic molecules with longer lasting biological effects. The molecular weight of PEG-ChAT was approximately 95 kDa, a ?20 kD increase compared to rChAT. PEG-ChAT has comparable specific activity to rChAT, which is significantly higher than commercially available rChAT (
(40) Repeated doses of PEGylated ChAT lead to long-lasting effects. Since a single dose of PEG-ChAT produced larger decreases in blood pressure than rChAT, the duration of this effect was increased by injecting PEG-ChAT once per day for multiple consecutive days utilizing the same hypertension model. Normotensive and hypertensive SBP were measured for all animals before injections. SBP was averaged during the period when room lights are off (SBP.sub.12H-Dark), as that is the active cycle for nocturnal mice. Multiple injections of PEG-ChAT significantly decreased SBP SBP.sub.12H-Dark for a week post-injection (
REFERENCES
(41) Centers for Disease Control and Prevention (CDC) High Blood Pressure Fact Sheet, world wide web cdc.gov/dhdsp/data_statistics/fact_sheets/fs_bloodpressure.htm, Jul. 16, 2016. Fu A L, Huang S J, Sun M J. Complementary remedy of aged-related learning and memory deficits via exogenous choline acetyltransferase. Biochem Biophys Res Commun. 2005 Oct. 14; 336(1):268-73. PCT International Patent Application Publication No. WO 2005/071071 A1, published Aug. 4, 2005, PTD-Human Choline Acetyltransferase Fusion Protein and its Application, Institute of Pharmacology and Toxicology, Academy of Military Medical Sciences P.L.A. China. U.S. Pat. No. 9,248,152 B2, issued Feb. 2, 2016, Human Neural Stem Cells Expressing Human Choline Acetyltransferase, and Use Thereof, Kim et al. U.S. Pat. No. 7,083,930 B2, issued Aug. 1, 2006, Human Choline Acetyltransferase, Hudson et al.