Fc GLYCAN REMODELING PLATFORM METHOD FOR SITE-SPECIFIC ANTIBODY CONJUGATION AND APPLICATIONS THEREOF
20240335553 ยท 2024-10-10
Assignee
Inventors
Cpc classification
C07K2317/41
CHEMISTRY; METALLURGY
A61K47/6807
HUMAN NECESSITIES
C12N9/2402
CHEMISTRY; METALLURGY
C12Y302/01096
CHEMISTRY; METALLURGY
C07K16/00
CHEMISTRY; METALLURGY
International classification
A61K47/68
HUMAN NECESSITIES
C07K16/00
CHEMISTRY; METALLURGY
Abstract
The present disclosure provides a one-pot chemoenzymatic method for site-specific modification and conjugation of antibodies at their Fc glycan site to produce structurally well-defined antibody conjugates carrying defined drugs and other entities. The method is enabled by the discovery that certain endoglycosidases have the ability to both deglycosylate an antibody and to recognize selectively modified small disaccharide oxazolines for transglycosylation on antibodies without hydrolysis of the resulting products.
Claims
1. An antibody-conjugate comprising a site-specifically functionalized antibody comprising (i) a modified disaccharide core composed of a glucose-?1,4-N-acetylglucosamine conjugated to the asparagine (Asn)-linked N-acetylglucosamine (GlcNAc) on the antibody, with or without a core fucose and (ii) a functional moiety.
2. The antibody conjugate of claim 1, wherein said functional moiety is selected from the group consisting of a therapeutic agent, drug, ligand, azide, biotin, fluorescent probe, and or diagnostic agent, which is site-specifically conjugated to the disaccharide core.
3. The antibody-conjugate of claim 2, wherein the therapeutic agent is selected from the group consisting of antibiotics, analgesics, antibodies; cancer drugs, antivirals, metal chelates, proteins, hormones, and nucleic acids.
4. The antibody-conjugate of claim 2, wherein said functional moiety is azide and said antibody is further modified with click conjugation to a therapeutic agent, drug, ligand, biotin, fluorescent probe, and or diagnostic agent.
5. The antibody-conjugate of claim 1, wherein the site-specifically functionalized antibody comprises alpha-Gal, rhamnose (Rha), tri-GalNAc moiety, or mannose-6-phosphate (M6P).
6. An antibody-conjugate comprising a site-specifically functionalized antibody comprising (i) a modified disaccharide core composed of a mannose-?1,4-N-acetylglucosamine conjugated to the asparagine (Asn)-linked N-acetylglucosamine (GlcNAc) on the antibody, with or without a core fucose, and (ii) a functional moiety.
7. The antibody conjugate of claim 6, wherein said functional moiety is selected from the group consisting of a therapeutic agent, drug, ligand, biotin, fluorescent probe, and or diagnostic agent is site-specifically conjugated to the disaccharide core.
8. The antibody-conjugate of claim 7, wherein the therapeutic agent is selected from the group consisting of antibiotics, analgesics, antibodies; cancer drugs, antivirals, metal chelates, proteins, hormones, and nucleic acids.
9. The antibody-conjugate of claim 6, wherein said functional moiety is directly conjugated to the mannose-?1,4-N-acetylglucosamine disaccharide core without the need of azide click reaction.
10. The antibody-conjugate of claim 6, wherein the site-specifically functionalized antibody comprises alpha-Gal, rhamnose (Rha), tri-GalNAc moiety, or mannose-6-phosphate (M6P).
11. An antibody-conjugate comprising a site-specifically functionalized antibody comprising (i) a modified disaccharide core composed of a galactose-?1,4-N-acetylglucosamine conjugated to the asparagine (Asn)-linked N-acetylglucosamine (GlcNAc) on the antibody, with or without a core fucose, and (ii) a functional moiety.
12. The antibody conjugate of claim 11, wherein said functional moiety is selected from the group consisting of a therapeutic agent, drug, ligand, azide, biotin, fluorescent probe, and or diagnostic agent, which is site-specifically conjugated to the disaccharide core.
13. The antibody-conjugate of claim 12, wherein the therapeutic agent is selected from the group consisting of antibiotics, analgesics, antibodies; cancer drugs, antivirals, metal chelates, proteins, hormones, and nucleic acids.
14. The antibody-conjugate of claim 11, wherein the functional moiety is azide and said antibody is further modified with click conjugation to a therapeutic agent, drug, ligand, biotin, fluorescent probe, and or diagnostic agent.
15. The antibody-conjugate of claim 11, wherein the site-specifically functionalized antibody comprises alpha-Gal, rhamnose (Rha), tri-GalNAc moiety, or mannose-6-phosphate (M6P).
16. A delivery device for the delivery of a therapeutic agent, drug, ligand, or diagnostic agent to a subject in need, wherein the delivery device comprises the site-specifically functionalized antibody of claim 1 and a pharmaceutically acceptable carrier.
17. The delivery device of claim 16, wherein the therapeutic agent is selected from the group consisting of antibiotics, analgesics, antibodies; cancer drugs, antivirals, metal chelates, proteins, hormones, and nucleic acids.
18. A delivery device for the delivery of a therapeutic agent, drug, ligand, or diagnostic agent to a subject in need, wherein the delivery device comprises the site-specifically functionalized antibody of claim 6 and a pharmaceutically acceptable carrier.
19. The delivery device of claim 18, wherein the therapeutic agent is selected from the group consisting of antibiotics, analgesics, antibodies; cancer drugs, antivirals, metal chelates, proteins, hormones, and nucleic acids.
20. A delivery device for the delivery of a therapeutic agent, drug, ligand, or diagnostic agent to a subject in need, wherein the delivery device comprises the site-specifically functionalized antibody of claim 11 and a pharmaceutically acceptable carrier.
21. The delivery device of claim 20, wherein the therapeutic agent is selected from the group consisting of antibiotics, analgesics, antibodies; cancer drugs, antivirals, metal chelates, proteins, hormones, and nucleic acids.
22. A disaccharide oxazoline selected from the group consisting of: (i) the Group I Man?1,4GlcNAc disaccharides depicted in
23. The disaccharide oxazoline of claim 22, selectively modified with a functional moiety.
24. The disaccharide oxazoline of claim 23, wherein said functional moiety is selected from the group consisting of a therapeutic agent, drug, ligand, azide, biotin, fluorescent probe, and or diagnostic agent.
25. The antibody-conjugate of claim 1, comprising a site-specifically functionalized antibody comprising a functional moiety, wherein said site-specifically functionalized antibody is obtained by a method that uses a single enzyme for both deglycosylation and transglycosylation, to provide a site-specifically functionalized antibody, the method comprising the steps of: (a) providing a single reactor, container, column, or pot; (b) introducing a single endoglycosidase having both deglycosylation and transglycosylation activity; (c) introducing an antibody for deglycosylation by the single endoglycosidase thereby providing a deglycosylated intermediate that contains at least one N-acetylglucosamine (GlcNAc) or core-fucosylated N-acetylglucosamine (Fuc?1,6GlcNAc) acceptor; (d) providing a modified glycan oxazoline comprising a disaccharide core; and (e) transglycosylating the modified glycan oxazoline to the N-acetylglucosamine (GlcNAc) or core-fucosylated N-acetylglucosamine (Fuc?1,6GlcNAc) acceptor by the introduced single endoglycosidase of step (b), to provide a site-specifically functionalized antibody; wherein: said modified glycan oxazoline is a Group II Glc?1,4GlcNAc based disaccharide oxazolines, comprising a glucose-?1,4-N-acetylglucosamine disaccharide core and the enzyme is Endo S (SEQ ID NO. 4), or Endo S2 (SEQ ID NO. 1).
26. The antibody of conjugate of claim 25, wherein said functional moiety is selected from the group consisting of a therapeutic agent, drug, ligand, biotin, fluorescent probe, and or diagnostic agent is site-specifically conjugated to the antibody.
27. The antibody-conjugate of claim 6, comprising a site-specifically functionalized antibody comprising a functional moiety wherein said site-specifically functionalized antibody is obtained by a method that uses a single enzyme for both deglycosylation and transglycosylation, to provide a site-specifically functionalized antibody, the method comprising the steps of: (a) providing a single reactor, container, column, or pot; (b) introducing a single endoglycosidase having both deglycosylation and transglycosylation activity; (c) introducing an antibody for deglycosylation by the single endoglycosidase thereby providing a deglycosylated intermediate that contains at least one N-acetylglucosamine (GlcNAc) or core-fucosylated N-acetylglucosamine (Fuc?1,6GlcNAc) acceptor; (d) providing a modified glycan oxazoline comprising a disaccharide core; and (e) transglycosylating the modified glycan oxazoline to the N-acetylglucosamine (GlcNAc) or core-fucosylated N-acetylglucosamine (Fuc?1,6GlcNAc) acceptor by the introduced single endoglycosidase of step (b), to provide a site-specifically functionalized antibody; wherein: said modified glycan oxazoline is a Group I Man?1,4GlcNAc based disaccharide oxazolines comprising a mannose-?1,4-N-acetylglucosamine disaccharide core and the enzyme is Endo S2 (SEQ ID NO. 1).
28. The antibody of conjugate of claim 27, wherein said functional moiety is selected from the group consisting of a therapeutic agent, drug, ligand, biotin, fluorescent probe, and or diagnostic agent is site-specifically conjugated to the antibody.
29. The antibody-conjugate of claim 11, comprising a site-specifically functionalized antibody wherein said site-specifically functionalized antibody is obtained by a method that uses a single enzyme for both deglycosylation and transglycosylation, to provide a site-specifically functionalized antibody, the method comprising the steps of: (a) providing a single reactor, container, column, or pot; (b) introducing a single endoglycosidase having both deglycosylation and transglycosylation activity; (c) introducing an antibody for deglycosylation by the single endoglycosidase thereby providing a deglycosylated intermediate that contains at least one N-acetylglucosamine (GlcNAc) or core-fucosylated N-acetylglucosamine (Fuc?1,6GlcNAc) acceptor; (d) providing a modified glycan oxazoline comprising a disaccharide core; and (e) transglycosylating the modified glycan oxazoline to the N-acetylglucosamine (GlcNAc) or core-fucosylated N-acetylglucosamine (Fuc?1,6GlcNAc) acceptor by the introduced single endoglycosidase of step (b), to provide a site-specifically functionalized antibody; wherein: said modified glycan oxazoline is a Group III Gal?1,4GlcNAc based disaccharide oxazolines, comprising a galactose-?1,4-N-acetylglucosamine disaccharide core wherein the enzyme is Endo S (SEQ ID NO. 4).
30. The antibody of conjugate of claim 29, wherein said functional moiety is selected from the group consisting of a therapeutic agent, drug, ligand, biotin, fluorescent probe, and or diagnostic agent is site-specifically conjugated to the antibody.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0060] Various embodiments of the present disclosure are described herein with reference to the drawings.
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
[0095]
[0096]
[0097]
[0098]
[0099]
[0100]
[0101]
[0102]
[0103]
[0104]
[0105]
[0106]
[0107]
[0108]
[0109]
[0110]
DETAILED DESCRIPTION
[0111] Disclosed herein are modified antibodies prepared via glycan engineering. The disclosure relates to the Fc region of an antibody molecule, wherein the Fc region is specifically glycosylated with oligosaccharides that increase the efficacy and stability of the Fc region, and the antibody or antibody fragment comprising the Fc region. In some embodiments the specifically glycosylated Fc fragment comprises a monoclonal antibody, preferably a human or humanized monoclonal antibody. Methods for generating such Fc glycosylated antibodies or antibody fragments by glycan engineering are disclosed herein
[0112] Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by those skill in the art to which the present disclosure belongs. Any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the disclosed methods and compositions. All publications and patents specifically mentioned herein are incorporated by reference for all purposes including describing and disclosing the chemicals, cell lines, vectors, animals, instruments, statistical analysis and methodologies which are reported in the publications which might be used in connection with the subject matter of the present disclosure.
[0113] As used herein, the term glycan refers to a polysaccharide, or oligosaccharide. Glycan is also used herein to refer to the carbohydrate portion of a glycoconjugate, such as a glycoprotein, glycolipid, glycopeptide, glycoproteome, peptidoglycan, lipopolysaccharide or a proteoglycan.
[0114] The term antibody (Ab) as used herein includes monoclonal antibodies, polyclonal antibodies, multi-specific antibodies (e.g., bispecific antibodies), and antibody fragments, so long as they exhibit the desired biological activity. The term immunoglobulin (Ig) is used interchangeably with antibody herein. A human antibody as used herein refers to an antibody naturally existing in humans, a functional fragment thereof, or a humanized antibody, i.e., a genetically engineered antibody a portion of which (e.g., a frame region or the Fc region) derives from a naturally-occurring human antibody.
[0115] The term monoclonal antibody as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts.
[0116] A mammal for purposes of treatment, refers to any mammal, including humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, cats, cattle, horses, sheep, pigs, goats, rabbits, etc. Preferably, the mammal is human.
[0117] Treating or treatment or alleviation refers to both therapeutic treatment and prophylactic or preventative measures; wherein the object is to prevent or slow down (lessen) the targeted pathologic condition or disorder. Those in need of treatment include those already with the disorder as well as those prone to have the disorder or those in whom the disorder is to be prevented. A subject or mammal is successfully treated if, after receiving a therapeutic amount of an antibody according to the methods of the present disclosure, relief to some extent from one or more of the symptoms associated with the specific pathologic condition or disorder; reduced morbidity and mortality, and improvement in quality of life issues. The above parameters for assessing successful treatment and improvement in the disease are readily measurable by routine procedures familiar to a physician.
[0118] The term therapeutically effective amount refers to an amount of an antibody or a drug effective to treat a disease or disorder in a subject or mammal. See preceding definition of treating. Chronic administration refers to administration of the agent(s) in a continuous mode as opposed to an acute mode, so as to maintain the initial therapeutic effect (activity) for an extended period of time. Intermittent administration is treatment that is not consecutively done without interruption, but rather is cyclic in nature. Administration in combination with one or more further therapeutic agents includes simultaneous (concurrent) and consecutive administration in any order.
[0119] Carriers as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution. Examples of physiologically acceptable carriers include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as TWEEN? polyethylene glycol (PEG), and PLURONICS?.
[0120] The term cytotoxic agent as used herein refers to a substance that inhibits or prevents the function of cells and/or causes destruction of cells. The term is intended to include radioactive isotopes, chemotherapeutic agents e.g., methotrexate, adriamycin, vinca alkaloids (vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents, enzymes and fragments thereof such as nucleolytic enzymes, antibiotics, and toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof, and the various antitumor or anticancer agents disclosed below. Other cytotoxic agents are described below.
[0121] A growth inhibitory agent when used herein refers to a compound or composition which inhibits growth of a cell, either in vitro or in vivo. Examples of growth inhibitory agents include agents that block cell cycle progression, such as agents that induce G1 arrest and M-phase arrest. Such inhibitory agents include, for example, the vinca alkaloids (vincristine, vinorelbine and vinblastine), taxanes, and topoisomerase II inhibitors such as doxorubicin, epirubicin, daunorubicin, etoposide, bleomycin, tamoxifen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C.
[0122] The present disclosure provides for the synthesis of IgG antibodies, or Fc fragments thereof, wherein a desired sugar chain is added to a core fucosylated or nonfucosylated GlcNAc-acceptor, including fucosylated or nonfucosylated GlcNAc-IgG acceptor. As such, the present disclosure allows for the synthesis and remodeling of therapeutic antibodies, or Fc fragments thereof, to provide for certain biological activities, such as, prolonged half-life time in vivo, less immunogenicity, enhanced in vivo activity, increased targeting ability, and/or ability to deliver a therapeutic agent.
[0123] In one aspect a one pot chemoenzymatic remodeling method is provided for both deglycosylation and transglycosylation reactions in a one-pot manner to provide an azido tagged antibody (
[0128] In another embodiment, a one pot two enzyme remodeling method is provided for both deglycosylation and transglycosylation reactions in a one-pot manner to provide an azido tagged antibody (
[0133] In another embodiment, the above two methods may further comprise a click chemistry step for conjugation of a ring-strained cyclooctyne moiety-containing drug or ligand to the azide-tagged antibody via ring-strained cycloaddition reaction to provide homogeneous antibody-drug conjugates or antibody-ligand conjugates. (
[0134] In an aspect, the present disclosure provides for use in the provided one pot method of an activated oligosaccharide moiety, such as an azide-tagged disaccharide oxazoline, as well as its selectively modified derivatives. Such disaccharide oxazolines are utilized as donor substrates for an efficient chemoenzymatic synthesis of homogeneous core fucosylated or nonfucosylated IgG antibodies and IgG-Fc fragments.
[0135] In an embodiment, the azido-modified glycan oxazoline for use in the above methods is selected from the group consisting of the following oxazoline structures: Group I based on the Man?1,4GlcNAc disaccharide structures as depicted in
[0136] In the practice of the provided remodeling methods, a number of disaccharide oxazolines may be used as substrates in the transglycosylation step. Such disaccharide ozazolines include, for example, those of Group I Man?1,4GlcNAc disaccharides depicted in
Group I, Man?1,4GlcNAc Based Oxazolines
[0137] ##STR00004## [0138] R1, R2, R3, R4=OH, N.sub.3, PEG-linked N.sub.3, a fluorescent probe, a biotin moiety, a ligand, or a drug [0139] Man: mannose; GlcNAc, N-acetylglucosamine [0140] PEG linker: a polyethylene glycol (PEG) linker
[0141] In another embodiment, the disaccharide oxazolines include, for example, those of Group II Glc?1,4GlcNAc disaccharides depicted in
Group II, Glc?1,4GlcNAc Based Oxazolines
[0142] ##STR00005## [0143] R1, R2, R3, R4=OH, N.sub.3, PEG-linked N.sub.3, a fluorescent probe, a biotin moiety, a ligand, or a drug [0144] Glc: Glucose; GlcNAc, N-acetylglucosamine [0145] PEG linker: a polyethylene glycol (PEG) linker
[0146] In another embodiment, the disaccharide oxazolines include, for example, those of Group III Gal?1,4GlcNAc depicted in
Group III, Gal?1,4GlcNAc Based Oxazolines
[0147] ##STR00006## [0148] R1, R2, R3, R4=OH, N.sub.3, PEG-linked N.sub.3, a fluorescent probe, a biotin moiety, a ligand, or a drug [0149] Gal, galactose; GlcNAc, N-acetylglucosamine [0150] PEG linker: a polyethylene glycol (PEG) linker
[0151] The disaccharide is selectively modified with one or more azides or other entities at different sites of the disaccharide backbone.
[0152] Provided herein are antibody-conjugates wherein the conjugate is linked to an antibody azido-modified glycan oxazoline selected from the group consisting of the azido-modified glycan oxazolines of Groups I, II, and III as depicted in
[0153] It is envisioned that the disaccharide oxazolines utilized as donor substrates may further comprises an additional moiety or tag including, a therapeutic agent or drug such as for treating cancer, viral infections, substances that activates receptors on the cell plasma membrane, agents that affects intracellular chemistry, agents that affects cellular physics, genes, gene analogs, RNA, RNA analogs, DNA, DNA analogs, amino acid sequences of surface receptors such as CCR5 or CD4, antigenic structure having affinity for a specific antibody; amino acid sequences of receptor ligands such as gp120, gp41 or gp160, receptor antagonists, receptor blockers, enzymes, enzyme substrates, enzyme inhibitors, enzyme modulators, therapeutic proteins, protein analogs, metabolites, metabolite analogs, oligonucleotides, oligonucleotide analogs, antigens, antigen analogs, antibodies or fragments thereof, antibody analogs, an antibody different from the modified antibody which is reactive to another receptor bacteria, viruses, inorganic ions, metal ions, metal clusters, polymers, fluorescent compounds and any combinations thereof.
[0154] In one aspect, the azido-modified oxazoline further comprises spacers. Such spacers include for example, oligoethylene spacers including polyethylene (PEG) linkers. In an embodiment, the azido-modified glycan oxazoline comprises a disaccharide core and multiple polyethylene linkers attached to the disaccharide core or other molecular linkers to forming a dendrimer.
[0155] In one aspect, for the disclosed one pot remodeling methods an endoglycosidase that has both deglycosylation and transglycosylation ability without hydrolytic activity toward the resulting transglycosylation product is utilized. In a non-limiting embodiment, the endoglycosidases may be selected from the group consisting of wild type Endo S, wild type Endo S2, wild type Endo F3 and mutants thereof. In some instances, the wild type enzyme can be coupled with another mutant enzyme of Endo-S, Endo-S2, and Endo-F3 for transglycosylation with azide-tagged glycan oxazoline, when the mutant enzyme is more efficient than the first endoglycosidase for transglycosylation.
[0156] Said endoglycosidases include endoglycosidases from Streptococcus pyogenes, including Endo-S2 and mutants thereof, wherein the endoglycosidases enable the transfer of an oligosaccharide (in the form of an activated sugar oxazoline) en bloc to a fucosylated or nonfucosylated GlcNAc-IgG (or an Fc fragment thereof) to form a new glycoform of IgG (or an Fc fragment thereof). (See, Sequence Listing below)
[0157] In another aspect, the present disclosure provides for Endo-S mutants that show enhanced transglycosylation efficiency and diminished or abrogated product hydrolytic activity. Mutants preferably include site-specific mutations including a mutation at Asp-233. The mutants include, but are not limited to Endo-S D233Q (SEQ ID NO: 2), D233M and D233A (SEQ ID NO: 3). Endo-S2 mutants include those with substitutions at D184 including for example D184M, D184E, D184C, D184G, D184A, D184N, D184Q, D184S and D184T. Endo F3 mutants include, for example, D165A.
[0158] In another aspect, the present invention disclosure provides for a composition comprising at least one Streptococcus pyogenes Endo-S Asp-233 mutant selected from the group consisting of D233Q (SEQ ID NO:2) and D233A (SEQ ID No: 3).
[0159] In an embodiment, the antibody for remodeling can be any antibody, or antibody fragment, characterized by the presence of one or more glycans that can act as substrates for deglycosylation activity through a endoglycosidases mediated reaction. Such antibodies, include for example, those antibodies having high specificity and affinity to antigens expressed on a target cell. In a non-limiting embodiment, the antigens are expressed on target cancer cells.
[0160] In an embodiment, the antibody or antibody fragment is one in which both Ig domains comprise Fc regions that are attached to a monosaccharide moiety (e.g., N-Acetylglucosamine, GlcNAc) or a trisaccharide moiety (e.g., Mannose-N-Acetylglucosamine-N-Acetylglucosamine, Man-GlcNAc-GlcNAc). The antibodies provided herein may be polyclonal or monoclonal antibodies. However, in preferred embodiments, they are monoclonal. In particular embodiments, antibodies of the present disclosure are human antibodies.
[0161] In an embodiment, the antibodies for use in the disclosed methods herein can be prepared from a commercially available therapeutic antibody (e.g., ReoPro? (abciximab), RITUXAN? (rituximab), ZENAPAX? (daclizumab), Simulect? (basiliximab), SYNAGIS? (palivizumab), REMICADE? (infliximab), Herceptin? (trastuzumab), MYLOTARG? (gemtuzumab ozogamicin), Campath? (alemtuzumab), Zevalin? (ibritumomab tiuxetan), HUMIRA? (adalimumab), XOLAIR? (omalizumab), BEXXAR (tositumomab), RAPTIVA (efalizumab), ERBITUX? (cetuximab), Avastin? (bevacizumab), TYSABRI? (natalizumab), human or humanized antibodies produced via a conventional method, preferably those undergoing clinical trials.
[0162] Other monoclonal antibodies suitable for use in the methods provided herein include, but are not limited to cetuximab, rituximab, muromonab-CD3, abciximab, daclizumab, basiliximab, palivizumab, infliximab, trastuzumab, gemtuzumab ozogamicin, alemtuzumab, ibritumomab tiuxctan, adalimumab, omalizumab, tositumomab, tositumomab, efalizumab, bevacizumab, panitumumab, pertuzumab, natalizumab, etanercept, IGN101?, volociximab, Anti-CD80 Mab, Anti-CD23 Mab, CAT-3888?, CDP-791?, craptuzumab, MDX-010?, MDX-060?, MDX-07? matuzumab, CP-675.degree., 206?, CAL? SGN-30, zanolimumab, Adecatumumab?. adecatumumab, oregovomab, nimotuzumab, ABT-874? (briakinumab), denosumab, AM 108?, AMG 714?, fontolizumab, dcaclizumab, golimumab, CNTO 1275? (ustekinumab), ocrelizumab, HumaxCD20?. (ofatumumab), belimumab, epratuzumab, MLN1202?, visilizumab, tocilizumab, ocrerlizumab, certolizumab pegol, eculizumab, pexelizumab, abciximab, ranibizimumab, mepolizumab, TNX-355? and MYO-029? (stamulumab).
[0163] The present disclosure envisions modifying monoclonal antibodies associated with pathogenic infections such as, for example, bacterial, fungal, parasitic or viral infections. In a specific embodiment, the antibodies may be HIV antibodies including, but not limited to 17b, 48d, A32, C11, 2G12, F240, IgG1b12, 19e, X5, TNX-355 and F91, all of which are commercially available.
[0164] In an embodiment, the azido-tagged non-fucosylated or fucosylated antibody is modified with conjugation to other ligands to provide an antibody-conjugate. In an embodiment, the antibody-conjugate comprises a ligand selected from drugs, toxins, labels, proteins, small molecules, thio, biotin and fluorescent label. In an embodiment, the azido-tagged antibody may be modified with conjugation to other ligands by a click chemistry reaction. The clickable ligands may include one or more high-affinity M6P oligosaccharide ligands, the tri-GalNAc or other high-affinity ligands for asialoglycoprotein receptors, rhamnose or alpha-Gal moieties for binding to natural circulation antibodies, and high-affinity glycan ligands for binding to Siglecs or other glycan-binding proteins. Such click chemistry reactions are well known to those skilled in the art.
[0165] As such, the present disclosure provides a delivery device for delivering a drug or therapeutic agent having biological activity to treat a disease or disorder, the delivery device comprising: a remodeled IgG or IgG-Fc fragment having a predetermined sugar chain or sialoglycan and a therapeutic agent or drug attached to the terminal sugar residue or sialic acid. Further antibodies related to cancer or other diseases may also be remodeled for individual fit to certain receptors thereby increasing biological activity.
[0166] In an embodiment, the azido-tagged antibody further comprises alpha-Gal, rhamnose (Rh) or mannose-6-phosphate (M6P).
[0167] In yet another aspect, the present disclosure provides a substantially homogeneous preparation of core fucosylate or nonfucosylated and antibody or Fc fragment thereof having a predetermined oligosaccharide moiety, wherein the substantially homogeneous preparation is produced by any of the aforementioned methods. Also provided are compositions comprising such homogeneous preparations.
[0168] In an embodiment a method is provided for targeting degradation of extracellular and membrane associated proteins through conjugation of high affinity mannose-6-phosphate (M6P) glycan ligands to remodeled antibody molecules.
[0169] Accordingly, a one pot chemoenzymatic remodeling method is provided wherein the conjugate is a M6P glycan wherein said resulting M6P-tagged antibody targets lysosomal mediated target degradation. Said method comprises the steps for both deglycosylation and transglycosylation reactions in the one pot to provide an M6P tagged antibody, the method comprising: [0170] (a) providing a single reactor, container, column, or pot; [0171] (b) introducing a single endoglycosidase, such as Endo-S, wherein the endoglycosidase has both deglycosylation and transglycosylation ability; [0172] (c) introducing an antibody for deglycosylation by the single endoglycosidase thereby providing a deglycosylated intermediate that contains at least one N-acetylglucosamine (GlcNAc) or core-fucosylated N-acetylglucosamine (Fuc?1,6GlcNAc) acceptor; [0173] (d) providing an M6P-Glycan oxazoline; and [0174] (e) transglycosylating the M6P-Glycan oxazoline to the N-acetylglucosamine (GlcNAc) or core-fucosylated N-acetylglucosamine (Fuc?1,6GlcNAc) acceptor by the single endoglycosidase to provide the M6P-tagged antibody.
[0175] In another embodiment, a one pot two enzyme chemoenzymatic remodeling method is provided wherein the conjugate is a M6P glycan and wherein said resulting M6P-tagged antibody targets lysosomal mediated target degradation. Said method comprises the steps for both deglycosylation and transglycosylation reactions in the one pot to provide an M6P tagged antibody, the method comprising: [0176] (a) providing a single reactor, container, column, or pot; [0177] (b) introducing a first endoglycosidase wherein the endoglycosidase has deglycosylation ability; [0178] (c) introducing an antibody for deglycosylation by the single endoglycosidase thereby providing a deglycosylated intermediate that contains at least one N-acetylglucosamine (GlcNAc) or core-fucosylated N-acetylglucosamine (Fuc?1,6GlcNAc) acceptor; [0179] (d) providing a second endoglycosidase and a M6P-Glycan oxazoline; and [0180] (e) transglycosylating the M6P-Glycan oxazoline to the N-acetylglucosamine (GlcNAc) or core-fucosylated N-acetylglucosamine (Fuc?1,6GlcNAc) acceptor by the second endoglycosidase to provide the M6P-tagged antibody.
[0181] In an embodiment, the two enzyme method may utilize wild type Endo S for the deglycosylation step and the S2 mutant (D184M) for the transglycosylation method.
[0182] In an non-limiting embodiment, the M6P-Glycan oxazoline is selected from the group consisting of the phosphorylated glycan oxazolines as depicted in
[0183] In an embodiment, said M6P-tagged antibodies target binding to an extracellular protein. In another embodiment, said M6P-tagged antibodies target binding to a membrane bound protein. Said membrane bound proteins include for example, is HER2 or EGFR.
[0184] In a still further aspect, the present invention provides for a method of treating a disease or disorder comprising administration of a remodeled antibody generated using the one pot chemoenzymatic remodeling methods disclosed herein and having a desired glycosylation state form in an amount sufficient to modulate biological activity in the treated subject.
[0185] In further embodiments, pharmaceutical compositions comprising a remodeled antibody generated using the one pot chemoenzymatic remodeling methods disclosed herein and a pharmaceutical acceptable carrier are provided. The antibodies exhibit properties for use as therapeutic agents, e.g. in the treatment of cancer in a subject for example. Such pharmaceutical compositions comprise a therapeutically effective amount of one or more of a remodeled antibody dissolved or dispersed in a pharmaceutically acceptable carrier. The preparation of a pharmaceutical composition that contains at one or more a remodeled antibody and optionally an additional active ingredient will be known to those of skill in the art in light of the present disclosure, as exemplified by Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990. For human administration, it will be understood that preparations should meet sterility, pyrogenicity, general safety and purity standards as required by FDA Office of Biological Standards or corresponding authorities in other countries. Preferred compositions are lyophilized formulations or aqueous solutions.
[0186] As used herein, pharmaceutically acceptable carrier includes any and all solvents, buffers, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g. antibacterial agents, antifungal agents), isotonic agents, absorption delaying agents, salts, preservatives, antioxidants, proteins, drugs, drug stabilizers, polymers, gels, binders, excipients, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, such like materials and combinations thereof, as would be known to one of skill in the art (see, for example, Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, pp. 1289-1329, incorporated herein by reference). Except insofar as any conventional carrier is incompatible with the active ingredient, its use in the therapeutic or pharmaceutical compositions is contemplated.
[0187] The composition may comprise different types of carriers depending on whether it is to be administered in solid, liquid or aerosol form, and whether it needs to be sterile for such routes of administration as injection. A remodeled antibody (and any additional therapeutic agent) can be administered by any method or any combination of methods as would be known to one of skill in the art (see, for example, Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, incorporated herein by reference). Parenteral administration, in particular intravenous injection, is most commonly used for administering protein or polypeptide molecules such as a remodeled antibody.
[0188] Any of the remodeled antibodies derived using the one pot methods disclosed herein, may be used in therapeutic methods as described herein. For use in the therapeutic methods described herein the remodeled antibody is formulated, dosed, and administered in a fashion consistent with good medical practice. Factors for consideration in this context include the particular disorder being treated, the particular subject being treated, the clinical condition of the subject, the cause of the disease or condition, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners or those of skill in the art.
[0189] For the treatments, the appropriate dosage of the remodeled antibodies (when used alone or in combination with one or more other additional therapeutic agents) will depend on the type of disease to be treated, the route of administration, the body weight of the patient, the severity and course of the disease, whether the remodeled antibody is administered for preventive or therapeutic purposes, previous or concurrent therapeutic interventions, the patient's clinical history and response to the remodeled antibody, and the discretion of the attending physician. The practitioner responsible for administration will, in any event, determine the concentration of active ingredient(s) in a composition and appropriate dose(s) for the individual subject. Various dosing schedules including but not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion are contemplated herein.
[0190] In another embodiment, the provided delivery device is designed to deliver a detectable label or marker to a targeted antigen for diagnostic and prognostic uses. Said a delivery device comprises a remodeled IgG or IgG-Fc fragment having a predetermined sugar chain and the detectable label or marker attached to the remodeled antibody. A detectable label or a marker refers to a composition that is detectable by spectroscopic, photochemical, biochemical, immunochemical, radioactive or chemical means. For example, a useful label includes 32p, 35S, fluorescent dyes, electron-dense reagents, enzymes (e.g., enzymes that are generally used in ELISA), biotin-streptavidin, digoxigenin, hapten, proteins or nucleic acid molecules with a sequence complementary to a target. The detectable label often generates a measurable signal, e.g., a radioactive signal, a color signal or a fluorescent signal, which is usable to quantify an amount of the detectable moiety that binds to the target antigen. Quantification of the signal may be accomplished by, for example, scintillation counting, density gauge, flow cell analysis, ELISA, or direct analysis by mass spectroscopy. Those skilled in the art are familiar with techniques and detection means for a label compound of interest. These techniques and methods are conventional and well known in the art. In another aspect of the embodiment, an article of manufacture (e.g., a kit) containing materials useful for the treatment or diagnosis of diseases or disorders as described above is provided. The article of manufacture comprises a container and a label or package insert on or associated with the container. Suitable containers include, for example, bottles, vials, syringes, IV solution bags, etc. The containers may be formed from a variety of materials such as glass or plastic. The container holds a composition which is by itself or combined with another composition effective for treating, preventing and/or diagnosing the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
[0191] The label or package insert indicates that the composition is used for treating the condition of choice. The article of manufacture may comprise a container with a composition contained therein, wherein the composition comprises a remodeled antibody
[0192] Kits in certain embodiments may further comprise a package insert indicating that the compositions can be used to treat a particular condition. Alternatively, or additionally, the kit may further comprise a second (or third) container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
[0193] The following examples are included to demonstrate preferred embodiments of the present disclosure. It should be appreciated by those of skill in the art that the techniques disclosed in the examples which follow represent techniques discovered by the inventor to function well in the practice of embodiments of the present disclosure, and thus can be considered to constitute preferred modes for its practice. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the present disclosure.
Example 1
[0194] As described below a systematic investigation was done of the selectively modified di-, tri- and tetrasaccharide oxazolines and their donor substrate specificity of a series of endoglycosidase was examined and their mutants in glycan remodeling of therapeutic antibodies. The minimal azide-modified disaccharide structures that could serve as donor substrates of different endoglycosidases for transglycosylation on antibodies was discovered. Since the glycoengineered antibodies carrying the truncated and modified N-glycans become resistant to hydrolysis by the endoglycosidases and their mutants, the discovery led to a simple, one-pot glycan remodeling method that combines the antibody deglycosylation and transglycosylation reactions in one reactor without the need to separate the deglycosylation intermediate and the enzyme.
[0195] The data demonstrate that the azide-tagged antibodies are remarkably efficient for producing homogeneous and site-specific antibody-drug conjugates with well-defined antibody-drug ratios (DARs). This observation provides a general method for producing antibody-drug conjugates (ADCs) using any given antibody, linker, and payload. This method is also particularly useful for fluorescent labeling and introduction of any special ligands such as glycan ligands for targeting. This site-specific conjugation method is also demonstrated to be applicable for attaching high-affinity mannoe-6-phosphate (M6P) oligosaccharide ligands to antibody for targeted protein degradation. This site-specific conjugation method is applicable for attaching any specific glycan ligands for targeting lectins and other glycan-binding proteins, serum antibodies.
[0196] A general method to introduce azido-tags site-selectively at the Fc glycans of antibodies. For the single enzyme one-pot method, a wild type endoglycosidase such as Endo-S2 is used for both deglycosylation and transglycosylation to product the azide-tagged antibody (
[0197] General structures of the modified glycan oxazolines. A systematic investigation of the selectively modified glycan oxazolines was performed and the azide-modified disaccharides as the minimal structures that could serve as donor substrates for modification of antibodies with different endoglycosidases was determined. Such glycan oxazolines are, for example, those selected from the structures of
[0198] Chemical synthesis of the azido-tagged disaccharides. Azide-tagged disaccharide oxazolines or their derivatives can be synthesized by different synthetic routes. The following description just show some typical examples, which does not mean the only method for preparation.
[0199] While it has been shown that smaller synthetic disaccharide oxazolines could serve as substrates of Endo-A and Endo-M for transglycosylation, (Y Zeng et al. Chem Eur J 2006 12:3355-3364) it is not clear whether those antibody-specific endoglycoylases and their mutants can recognize the smaller substrates for transglcyosylation using antibodies as acceptors. To test this, an attempt was made to synthesize a series of azide-tagged disaccharide oxazolines. In 2020, it was reported the synthesis of a PEG-modified core disaccharide oxazoline and its transglycosylation with a model protein as the acceptor. (Goto et al, 2020 Tetrahedr Lett 61: 151475) Considering the flexibility and solubility of PEGs, it was decided to introduce azido groups with PEG-derived scaffolds. Firstly, the disaccharide with two azido groups was designed, in which the PEG-linkers resembled the natural glycan branches so that it might be recognized by the endoglycosidases (
[0200] Next, the disaccharides were synthesized with one or three azido groups (
[0201] Previous studies showed that ADCs with higher DARs tended to provide increased potency. (RP Lyon et al., 2015 Nat Biotechnol 33:733-735) In a handful of cases a DAR as high as 8 has safely been achieved through the use of hydrophilic linker-payloads, as exemplified with the clinically approved Enhertu? and Trodelvy?. (A Bardia et al, 2019 N Engl J Med 380:741-75; W Viricel et al., 2019 Chem Sci 10:4084-4053). To equip antibodies with more biorthogonal tags, the disaccharides were designed carrying four or six azido groups. The synthesis commenced with the branched scaffolds (
[0202] Previous studies showed that modifications of the oxazoline donors may not affect the transglycosylation activities of endoglycosidases. To avoid the construction of the challenging ?1,4-mannosidic bond, the ?-D-Man moiety was replaced with ?-D-Glc to synthesize a Glc?1,4GlcNAc disaccharide (
[0203] Evaluation of substrate specificity of different endoglycosidases toward the synthetic azido-tagged sugar oxazolines. With the oxazolines in hand, the transglycosylation conditions were screened with different endoglycosidases. Compound 7 was selected as the glycosyl donor, and trastuzumab, an anti-Her2 antibody (Herceptin), was used as a model mAb to examine the potential of the synthetic disaccharides for glycan remodeling of antibodies (Table 1). The reaction was started from wild-type Endo S that has been found to be highly active and specific for Fc deglycosylation of intact IgG antibodies. (W Huang et al, 2012 J Am Chem Soc 134:12308-12318; M Collin et al., 2001 EMBO J 20:3046-3055) With a catalytic amount of enzyme (0.2% w/w), no transglycosylation was observed. Increasing the amount of enzyme (1%, w/w) turned out to accelerate this procedure, but the yield was only moderate even after pushing with additions of excess sugar oxazolines. Nevertheless, the product, once formed, was not hydrolyzed by wild type Endo S cither, probably due to its unnatural structure. The mutant, Endo S-D233Q, which could efficiently transfer large bi-antennary glycan oxazoline to antibody (W Huang et al, 2012 J Am Chem Soc 134:12308-12318) was not efficient either, giving 15% yield even when a relatively large amount of enzyme (10%, w/w) was used. Surprisingly, another endoglycosidase from the Streptococcus pyogenes of serotype M49, namely Endo S2, (J Sjogren et al., 2013 Biochem J 455:107-118) exhibited excellent activity towards this azido-tagged disaccharide, with a catalytic amount of enzyme (0.1%?0.2% w/w), the reaction could reach completion within 1 hour. Marginal hydrolysis of product was observed under this condition, which allowed the accumulation of product. Considering the potent transglycosylation activity, together with its efficient hydrolysis of the complex-type N-glycans from the commercial antibody, Endo S2 provided a practical one-pot strategy for remodeling of heterogeneous glycoforms of antibody to produce a homogenous structure. Endo S2 mutant (D184M) was also tested, a glycosynthase with broad substrate specificity and diminished hydrolytic activity (Y Zeng et al, 2006 Chem Eur J 12:3355-3364), and found it exhibited similar activity as compared with wild-type Endo S, relatively large amount of enzyme (3%?5%) was needed for efficient transglycosylation. In addition to the four enzymes, several other endoglycosidases were also tested. Endo F3, which prefers to recognize the core-fucosylated complex-type N-glycans and has been used for remodeling of both Fab and Fc glycans of therapeutic antibody, (JP Giddens et al., 2018 Proc Natl Acad Sci USA 115:12023-12027) didn't show any activity towards this azido-tagged disaccharide. As for Endo A, Endo D and Endo CC that prefer non-fucosylated substrates, the GNF-Herceptin was treated with a fucosidase (BfFucH) to produce an afucosylated Fc glycoform. The results showed that Endo D exhibited some transglycosylation activity, but only transitional product was observed. Endo A or Endo CC didn't afford any product even if a large amount of enzyme (10%, w/w) was used.
[0204] With the optimized condition, the transglycosylation was tried using the other disaccharides (
[0205] Next, the possibility was examined of remodeling antibody glycosylation in a one-pot fashion, thus a mixture of the commercial Herceptin, glycan oxazoline 7, and wild-type Endo S2 was incubated in PBS buffer at room temperature and the reaction was monitored by LC-MS analysis. As expected, the Endo S2-catalyzed deglycosylation of Herceptin took place rapidly and was completed within 5 min under the reaction condition. Then the transglycosylation product was steadily formed over the time without apparent hydrolysis, reaching more than 95% yield within 2 h (
[0206] Site-specific conjugation with the azido-tagged antibodies. With these azido-tagged antibodies in hand, the click chemistry was used to make ADCs, using Monomethyl auristatin E (MMAE) as a model warhead, which has been used for making the FDA-approved ADCs (
[0207] Finally, the cancer cell killing potency of the ADCs was examined with different drug-antibody ratios (DARs). Two breast-cancer cell lines expressing high (BT474) and low (T47D) levels of HER2 were used. The results showed that the ADCs had dramatically increased cytotoxicity with the increase of DARs in HER2 overexpressed cell line (BT474). However, no significant trends of cell killing were observed in antigen negative cell line (T47D), indicating the high selectivity of the ADCs for the target cells.
[0208] Site-specific labeling of antibodies with biotin or fluorescent groups. Functionalized antibodies have been used extensively for diagnostics, in vivo imaging, therapy and as a tool for molecular biology, inspiring the development of methods for preciso engineering of intact antibodies. Conventional methods such as global lysine labeling with N-hydroxysuccinimide (NHS) esters (aa Wakankar et al., 2010 Bioconjug Chem 21:1588-1595) or by cysteine conjugation via reduction of disulfide bonds and reaction with malcimides (S O Doronina et al., 2003 Nat Biotechnol 21:778-784), lack control of attachment sites and stoichiometry thus produce nonhomogeneous conjugates. With the azido-tagged antibodies as a universal platform, site-specific labeling of intact antibodies turned out to be straightforward. A number of dibenzoazacyclooctyne (DBCO)-ended probes carrying different functional groups including biotin and rhodamine were incubated with the azido-tagged antibodies, and the reactions were monitored by LC-MS. It was found that the click chemistry gradually afforded the desired compounds (
[0209] Encouraged by the one-pot remodeling of intact antibody with azido-tagged disaccharide (
[0210] Site-specific conjugation of ?-Gal and rhamnose for complement-dependent cytotoxicity (CDC). Complement-dependent cytotoxicity (CDC) is one of the major mechanisms for antibody-mediated killing of target cells (s Andrighetto et al., 2019 Int J Mol Sci 20), Nevertheless, many therapeutic antibodies are limited by their low potency in stimulating a strong complement-dependent cytotoxicity. It was next tested as to whether one could apply the chemoenzymatic approach to make ?-Gal or rhamnose (Rha) antigen-antibody conjugates so that natural anti ?-Gal and anti-Rha IgG and IgM antibodies can be recruited to cause strong CDC responses to kill the target cells (cancer, bacteria, viruses). Previous studies showed that the presentation of multiple copies of the ?-Gal epitopes (multivalency) was important for an efficient cancer cell killing (J Sianturi et al., 2019 Angew Chem Int Ed 58:4526-4530), so the poly-lysine based dendrimer with multiple copies of ?-Gal trisaccharide or Rha were used for conjugation, affording the ?-Gal/Rha-antibody conjugates with tailored numbers of glycan ligands (
[0211] Site-specific conjugation of specific glycan or peptide ligands to antibody for targeting. The method also covers the site-specific conjugation of any other glycan ligands or other peptide/protein ligands for targeting and enhanced therapeutics. These include, for example, conjugation of GalNAc multivalent ligands for targeting asialoglycoprotein receptors to livers; conjugation of high-mannose type glycan ligands for targeting macrophages and dendritic cells; and conjugation of sialyl glycans to Siglecs on T-cells and tumor cells.
[0212] Site-specific introduction of high-affinity mannose-6-phosphate (M6P) ligands into antibody for lysosomal targeted protein degradation. Traditional drug development efforts are mainly focused on small molecules that target druggable proteins such as enzymes and receptors (A L Hopkin et al., 2002 Nat Rev Drug Disc 1:727-730). However, the undruggable targets that cannot be modulated by small molecules such as transcription factors, protein complexes, RAS family proteins, regulatory/scaffolding proteins (C M Crews 2010 Chem Biol 17:551-555; M J Bond 2021 doi: 10.1039/D1031CB00011J) etc., account for more than 85% of human proteome (J N Spradlin et al., 2021 Acc Chem Res doi 10.1021/acs.accounts. 1021c00065), thus controllable degradation of targeted proteins represents a new strategy to tackle the undruggability. Proteolysis targeting chimeras (PROTACs) that degrade proteins of interest (POI) through the ubiquitin-proteasome system (J Lu et al., 2015 Chem Biol 22:755-763) have been successfully employed in the degradation of different types of target proteins related to various diseases, including cancer (M Schapira et al., 2019 Nat rev Drug Disc 18:949-963; Y Zou et al., 2019 Cell Bichem Funct 37:21-30; A D Cotton et al., 2022 J Am Chem Soc 143:593-598), viral infection (K Montrose et al., 2014 Biochem Biophys Res Commun 453:735-740), immune disorders (R Kolb et al., 2021 Nat Commun 12:1281) and neurodegenerative diseases (S TOMISHIGE ET AL., 2021 Ange Chem Int Edd 60:3346-3354). However, this strategy is limited to target engagement within the cells for ubiquitination (P M Cromm et al., 2017 Cell Chem Biol 24:1181-1190), leaving membrane and extracellular proteins untargetable, thus the development of complementary strategies that include proteins without cytosolic binding domains are greatly needed.
[0213] Lysosome is another major destination for protein degradation through autophagy and endocytosis (C A Lamb et al., 2013 Bioessays 35:34-45). Unlike the proteasomal pathway, the lysosomal pathway for protein degradation is not limited to proteins that have intracellular domains. In 2020, lysosome-targeting chimeras (LYTACs) consisting of an antibody for recruiting and ligands of lysosomal-targeting receptor (CI-MPR) for developed for delivery (S M Banik et al, 2020 Nature 584:291-297). Here the important glycan ligand mannose-6-phosphate (M6P), which can be recognized by CI-MPR and play a critical role in intracellular transport of lysosomal enzymes (S Kornfield 1987 FASEB 1:462-468; K Von Figura et al., 1986 Annu Rev Biochem 1986 55:167-193) will induce internalization of the chimera once introduced to the antibody. In this way they successfully achieved the depletion of secreted and membrane-associated proteins. Despite these promising results, however, the CI-MPR-driven LYTACs suffered from heterogeneity of M6Pn polymers (S M Banik et al, Nature 584:291-297), and the random conjugation may also result in potential instability and rapid clearance. Preliminary experiments showed that the Man6P ?-1,2Man disaccharide moiety was the minimal structure for CI-MPR binding, allowing one to construct homogeneous LYTACs using the azido-tagged antibody platform in a site-specific manner (
[0214] Considering that the introduction of unnatural structures may be immunogenic in humans, it was investigated whether one could introduce the essential M6P disaccharide through natural linkages, thus the tetrasaccharide oxazoline containing the Man6P?1,2Man disaccharide moiety was selected as the donor substrate to examine the transglycosylation activities of different endoglycosidases to make M6P-modified antibodies. To this end, trastuzumab, an anti-Her2 antibody (Herceptin), was used as a model mAb (Table 2). Experiments were started from wild-type Endo S that has been found to be highly active and specific for Fc deglycosylation of intact IgG antibodies (W Huang et al, 2012 J Am Chem Soc 134:12308-12318; M Collin et al., 2001 EMBO J. 20:3046-3055).
[0215] With a catalytic amount of enzyme (0.2% w/w), it was found that wild-type Endo S was quite efficient for transglycosylation, more than 70% of the starting material was transformed into the desired product within 1 hour, and the reaction could be driven to completion if another batch of oxazoline (10 equiv.) was added. Marginal hydrolysis of the attached glycans was observed under this condition, which allowed for the accumulation of product. Considering the potent transglycosylation activity, together with its efficient hydrolysis of the complex-type N-glycans from the commercial antibody, wild-type Endo S provided a practical one-pot strategy for remodeling of heterogeneous glycoforms of antibody to produce a homogeneous structure. Then, its mutant, Endo S-D233Q was tested, which could efficiently transfer large biantennary glycan oxazoline to antibodies (W Huang et al, 2012 J Am Chem Soc 134:12308-12318) but was found to show much slower transglycosylation as compared with wild-type Endo S. Relatively large amount of enzyme and oxazoline, together with longer incubation time were needed to drive the reaction to completion. In comparison, it was found another endoglycosidase from the Streptococcus pyogenes of serotype M49, namely Endo S2 (J Sjogren et al., 2013 Biochem J 455:107-118) also exhibited good transglycosylation activity and slow hydrolysis of the product with a catalytic amount of enzyme (0.1%, w/w). However, this enzyme would rapidly hydrolyze the glycan oxazoline, thus large excess amount of oxazoline was needed to promote this reaction.
[0216] In order to reduce the hydrolysis of oxazoline substrate, the mutant Endo S2-D184M was tested, a glycosynthase with broad substrate specificity and diminished hydrolytic activity (T Li et al., 2016 J Biol Chem 291:16508-16518) and it was found to exhibit excellent transglycosylation activity. With catalytic amount of enzyme (0.1%?0.2% w/w) and reduced equivalents of oxazoline (10 equiv.), the reaction smoothly afforded the product within 1 hour. As expected, no additional oxazoline was needed and marginal hydrolysis of the product was observed, thus providing another practical method for production of M6P-containing antibodies. In addition to the four enzymes, several other endoglycosidases were tested. Endo F3, which prefers to hydrolyze the core-fucosylated complex-type N-glycans (JP Giddens et a 2016 J Biol Chem 291:9356-9370) showed slow transglycosylation if a large amount of enzyme (10%, w/w) was added. And Endo F3-D165A, a glycosynthase mutant that has been used for remodeling of both Fab and Fc glycans of therapeutic antibody (JP Giddens et al., 2018 PNAS USA 115:12023-12027) didn't show significant activity toward this azido-tagged disaccharide, only trace of transitional product was observed. As for Endo A, Endo D and Endo CC that prefer non-fucosylated substrates, the GNF-Herceptin was treated with a fucosidase (BfFucH) to produce an afucosylated Fc glycoform. The results showed that all these three enzymes didn't produce cancer any product even large amount of enzyme (10%, w/w) was used.
[0217] With the optimized condition in hand, the transglycosylation was tried in a preparative scale. The results showed that Endo S2-D184M worked well with GNF-Herceptin, the desired product carrying two phosphorylated glycans was isolated in 95% yield after protein A purification, and the excess glycan oxazoline could be recovered in the form of free oligosaccharide, which was readily converted into the glycan oxazoline in a single step with DMC/Et.sub.3N (n Noguchi et al., 2009 J Org Chem 74:2210-2212) thus permitting the recycling of glycan oxazoline for transglycosylation. Besides Herceptin, another therapeutic antibody named Cetuximab that targets epidermal growth factor receptor (anti-EGFR) for the treatment of colorectal cancer and squamous-cell carcinoma (CH Chung et al., 2008 N Engl J Med 358:1109-1117) was also remodeled by this chemoenzymatic method. Cetuximab is glycosylated in both Fab and Fc domains with tremendous heterogeneity in the N-glycan structures (J Qian et al., 2007 364:8-18). Previous studies showed that wild-type Endo S2 is highly specific for hydrolyzing the Fc glycans (JP Giddens et al., 2018 Proc Natl Acad Sci USA 115:12023-12027), thus the commercial Cetuximab was firstly treated with Endo S2-WT to produce the deglycosylated Fc glycoform, then the resulting GNF-Ctx successfully afforded the phosphorylated product following the same chemoenzymatic method as monitored by LC-MS, which was isolated in 90% yield. Finally, to further verify that the glycans were specifically conjugated to the Fc domain, the products were digested with the protease IdeS followed by LC-MS analysis (G Chevreux et al., Anal Biochem 2011 415:212-214). The results showed that the shift of molecular weight was consistent with the attached glycans, thus confirmed the structure of the products (
[0218]
Example 2
[0219] Antibody-drug conjugates (ADCs) hold great promise for targeted cancer cell killing. Site-specific antibody-drug conjugation is highly desirable for synthesizing homogeneous ADCs with optimal safety profiles and high efficacy. The synthesis and evaluation of new disaccharide oxazolines as enzyme substrates for examining the scope of the site-specific conjugation is described herein. Specifically, azide-functionalized disaccharide oxazolines derived from Man?1,4GlcNAc, Glc?1,4GlcNAc, and Gal?1,4GlcNAc (LacNAc), respectively, were synthesized. Enzymatic evaluation revealed that wild-type Endo-S2 demonstrated highly relaxed substrate specificity and could accommodate all the three types of disaccharide derivatives for transglycosylation to provide site-specifically azide-tagged antibodies, which were readily clicked with a payload to generate homogeneous ADCs. Moreover, it was found that Endo-S2 was able to accommodate drug-preloaded minimal disaccharide oxazolines as donor substrate for glycan transfer, enabling an efficient, single-step and site-specific antibody-drug conjugation without the need of click reaction. The ability of Endo-S2 to accommodate simpler and more easily synthesized disaccharide oxazoline derivatives for Fc glycan remodeling further expanded the scope of this bioconjugation method for constructing homogeneous antibody-drug conjugates in a single step manner. Finally, cell-based assays indicated that the synthetic homogeneous ADCs demonstrated potent targeted cancer cell killing.
[0220] Described herein is the synthesis and evaluation of selectively modified new disaccharide oxazolines, including the Glc-?1,4-GlcNAc and Gal-?1,4-GlcNAc (LacNAc) disaccharides, as substrates for enzymatic Fc-glycan remodeling of antibodies. It was found that wild-type Endo-S2 had a remarkable flexibility to accommodate the unnatural core disaccharides for transglycosylation to provide azide-functionalized antibodies. Moreover, it was discovered that the wild-type Endo-S2 could perform a simultaneous deglycosylation and glycosylation of an antibody with the drug-loaded disaccharide oxazoline substrates to give homogeneous ADCs in a single step. The resulting ADCs showed high selectivity for the target cells as indicated in the cytotoxicity studies.
[0221] Recent studies have shown that wild-type Endo-S2 could accommodate selectively modified disaccharide oxazolines corresponding to the natural disaccharide (Man?1,4GlcNAc) core for transglycosylation without product hydrolysis. However, whether this enzyme could recognize and transfer unnatural core disaccharide structures to antibodies remains to be tested. As described herein, simpler disaccharide derivatives, such as Glc?1,4GlcNAc and Gal?1,4GlcNAc (LacNAc) oxazolines were tested which are much easier to synthesize than the Man?1,4GlcNAc core. To explore the substrate specificity of Endo-S2 and to identify simple functionalized disaccharide oxazoline substrates for antibody glycan remodeling, three selectively modified disaccharide cores (Man?1,4GlcNAc, Glc?1,4GlcNAc, and Gal?1,4GlcNAc) were designed and synthesized with anamine or azide functional group at the 6 position for further derivatization (
[0222] To test if the Glc- or Gal-containing disaccharide oxazolines (14 and 24) could still be recognized by wild-type Endo-S2 for Fc glycan remodeling of antibodies, the one-pot transglycosylation was tested using trastuzumab (Herceptin) as a model antibody (
[0223] Encouraged by the excellent transglycosylation activities of the azido-tagged disaccharide oxazolines, it was attempted to pre-introduce the cytotoxic drug to the disaccharide oxazolines and to test the feasibility of a single-step glycan remodeling for constructing ADCs. To achieve this strategy, several factors needed to be considered. First, the drug should tolerate the DMC/Et.sub.3N treatment for sugar oxazoline formation. Second, it needs to be stable under alkaline conditions. Lastly, the drug-disaccharide oxazoline should have sufficient solubility in aqueous solution. Monomethyl auristatin E (MMAE) was chosen as the cytotoxic drug to test the strategy. Thus, compound 28 (Ou et al., 2021 Bioconjug Chem 32;1888-1897) bearing a cleavable dipeptide linker (valine-citrulline) was reacted with bis-NHS-PEG5 to give the NHS-activated payload 29, which was further conjugated with the disaccharides via amine-coupling reaction, followed by oxazoline formation in one-pot, providing the drug-oxazoline conjugates 1?3 in good yields after RP-HPLC purification (
[0224] With the drug-sugar oxazoline conjugates in hand, it was investigated whether the one-step synthesis of ADCs via the Endo-S2-catalyzed transglycosylation (
[0225] Finally, the cytotoxicity of the synthetic ADCs (33, 34, and 35) was tested in breast cancer cell lines, the SK-BR-3 and BT474 cell lines that have high levels of HER2 expression and the T47D that has low level expression of HER2 antigen. The trastuzumab-MMAE conjugate (36) (with a DAR of 2) that was synthesized previously using a two-step approach.sup.18 was used as a reference for comparison. It was found that all these ADCs achieved significant cell killing of the high antigen-expressed cell lines (SK-BR-3 and BT474) with almost the same potency, as indicated by the half-maximal effective concentration (EC.sub.50) values. On the other hand, no apparent killing was observed in the T47D cell line that expresses low levels of HER2 under the tested concentrations, indicating the high selectivity of the synthetic ADCs for the target cells.
[0226] As described herein, a highly efficient method for a single-step and site-specific chemoenzymatic synthesis of homogeneous antibody-drug conjugates is established. The findings that Endo-S2 can accept different disaccharide oxazolines, including the simpler and more easily synthesized cellobiose and N-acetyllactosamine derivatives for Fc glycan remodeling, further expands the scope of the chemoenzymatic method for antibody bioconjugation. In addition, the ability of Endo-S2 to perform deglycosylation of native antibodies and simultaneously transfer drug-preloaded disaccharide oxazolines enables a truly single-step protocol to construct homogeneous antibody-drug conjugates.
Materials and Methods
[0227] General procedure. All chemicals, reagents, and solvents were purchased from Sigma-Aldrich and TCI and unless specially noted applied in the reaction without further purification. TLC was performed using silica gel on glass plates (Sigma-Aldrich), and spots were detected under UV light (254 nm) then charring with 5% (v/v) sulfuric acid in EtOH or cerium molybdate stain (CAM) followed by heating at 150? C. Silica gel (200-425 mesh) for flash chromatography was purchased from Sigma-Aldrich. NMR spectra were recorded on a 400 MHZ spectrometer (Bruker, Tokyo, Japan) with CDCl.sub.3 or D20 as the solvent. The chemical shifts were assigned in ppm, and multiplicities are indicated by s (singlet), d (doublet), t (triplet), q (quartet), and m (multiplet). Coupling constants (J) are reported in Hertz. MALDI-TOF was performed on a Bruker Autoflex Speed Mass Spectrometer in positive reflectron mode with DHB (ACN/H.sub.2O=1:1) as the matrix. HRMS was performed on an Exactive Plus Orbitrap Mass Spectrometer (Thermo Scientific) equipped with a C18 column. Preparative HPLC was performed with a Waters 600 HPLC instrument and Waters C18 columns (5.0 ?m, 10?250 mm). The column was eluted with a suitable gradient of MeCNH.sub.2O containing 0.1% TFA or FA at a flow rate of 4 mL/min. LC-MS analysis was performed on an Ultimate 3000 HPLC system coupled to an Exactive Plus Orbitrap mass spectrometer (Thermo Fisher Scientific) with C4 (whole antibody, gradient, 5-95% aq MeCN containing 0.1% FA for 6 min, 0.4 mL/min) or C8 (IdeS digestion, gradient, 25-35% aq MeCN containing 0.1% FA for 6 min, 0.4 mL/min) column. Deconvolution data was transformed by MagTran software.
6-O-2-[2-(2-aminoethoxy)ethoxy]ethyl-?-D-mannopyranosyl-(1?4)-2-acetamido-2-deoxy-?-D-glucopyranoside (5)
[0228] A mixture of 4 (Zhang et al., 2021 ACS Chem Biol 16:2502-2514) (15.0 mg, 0.014 mmol) and Pd/C (10 wt. % loading, 10 mg) in THF (1.5 mL) and H.sub.2O (0.5 mL) was added 3 M HCl (aq, 9 ?L, 2 eq), then stirred under H.sub.2 atmosphere overnight. After LC-MS analysis showed the complete conversion to free amine, the reaction mixture was filtered through a Celite pad, then concentrated and purified by Sephadex LH-20 (H.sub.2O) to give 5 (7.2 mg, 97%) as hydrochloride salt. 1H NMR (400 MHZ, D.sub.2O) ? 5.07 (0.77H, m), 4.61-4.59 (1.31H, m), 3.96-3.95 (1.00H, m), 3.85-3.80 (0.81H, m), 3.78-3.76 (1.90H, m), 3.75-3.73 (1.04H, m), 3.69-3.67 (0.99H, m), 3.66-3.63 (3.34H, m), 3.63-3.56 (11.1H, m), 3.54-3.49 (1.90H, m), 3.48-3.43 (2.39H, m), 3.10 (2H, t, J=4.6 Hz), 1.92 (3H, s); .sup.13C NMR (100 MHZ, D.sub.2O) ? 174.47, 174.17, 100.19, 94.81, 90.50, 79.54, 79.25, 74.68, 74.49, 72.64, 72.36, 70.44, 70.40, 69.92, 69.88, 69.73, 69.58, 69.40, 69.16, 66.58, 66.29, 63.81, 60.16, 60.03, 56.06, 53.63, 39.06, 22.13, 21.84; HRMS: [M+H].sup.+ calcd for C.sub.20H.sub.39N.sub.2O.sub.13.sup.+, 515.2447; found, 515.2442.
Benzyl 2-O-benzyl-4,6-O-benzylidene-3-O-p-methoxybenzyl-?-D-glucopyranosyl-(1?4)-2-azido-3,6-di-O-benzyl-2-deoxy-?-D-glucopyranoside (8)
[0229] To a solution of 7 (Yamaguchi et al., 2016 J Am Chem Soc 138:12472-85) (290 mg, 0.31 mmol) in MeOH (2.0 mL) was added sodium methoxide to maintain a pH of 10, the solution was heated to 50? C. and stirred overnight. After the complete disappearance of the starting material, the solution was diluted with CH.sub.2Cl.sub.2, successively washed with H.sub.2O and brine, then concentrated to dryness. The residue was dissolved in dry N,N-dimethylformamide (2.0 mL) and cooled to 0? C., sodium hydride (24 mg) and benzyl bromide (100 ?L) were added successively, and the mixture was slowly warmed to room temperature. After the completion of the reaction as indicated by TLC, MeOH was added to quench the excess sodium hydride. The reaction was diluted with CH.sub.2Cl.sub.2, and successively washed with H.sub.2O and brine. The organic layer was dried over anhydrous Na.sub.2SO.sub.4. After concentration, the residue was purified by flash column chromatography (hexanes/EtOAc=10:1?5:1) to afford 8 (248 mg, 87% for 2 steps) as white solid. R.sub.f=0.45 (hexanes/EtOAc=5:1); 1H NMR (400 MHZ, CDCl.sub.3) ? 7.53-7.51, 7.45-7.26 (27H, m, ArH), 6.85-6.83 (2H, m, ArH), 5.52 (1H, s, PhCH), 4.97-4.93 (2H, m, PhCH.sub.2), 4.88-4.83 (2H, m, PhCH.sub.2), 4.78-4.68 (4H, m, PhCH.sub.2), 4.63 (1H, d, J=12.1 Hz, PhCH.sub.2), 4.56 (1H, d, J=7.8 Hz), 4.43 (1H, d, J=12.1 Hz, PhCH.sub.2), 4.31 (1H, d, J=8.1 Hz), 4.21 (1H, dd, J=5.0 Hz, J=10.5 Hz), 4.06 (1H, dd, J=9.3 Hz, J=9.3 Hz), 3.88 (1H, dd, J=3.7 Hz, J=11.1 Hz), 3.82 (3H, s, OCH.sub.3), 3.70-3.58 (3H, m), 3.54-3.45 (2H, m), 3.40-3.33 (2H, m), 3.30-3.26 (1H, m), 3.22-3.15 (1H, m); .sup.13C NMR (100 MHz, CDCl.sub.3) ? 159.26, 138.37, 138.31, 138.05, 137.42, 136.89, 130.62, 129.70, 129.00, 128.48, 128.45, 128.32, 128.27, 128.25, 128.07, 127.97, 127.95, 127.82, 127.73, 127.68, 126.07, 113.75, 102.79, 101.14, 100.38, 82.54, 81.78, 81.33, 80.83, 76.46, 75.51, 75.25, 75.18, 74.75, 73.30, 70.79, 68.71, 67.62, 65.85, 65.73, 55.29; MALDI-TOF: [M+Na].sup.+ calcd for C.sub.55H.sub.57N.sub.3NaO.sub.11.sup.+, 958.39; found, 958.05.
Benzyl 2,4-di-O-benzyl-3-O-p-methoxybenzyl-?-D-glucopyranosyl-(1?4)-2-azido-3,6-di-O-benzyl-2-deoxy-?-D-glucopyranoside (9)
[0230] To a solution of 8 (110 mg, 0.118 mmol) in BH.sub.3.Math.THF (1 M, 2.0 mL) was added a solution of Bu.sub.2BOTf in CH.sub.2Cl.sub.2 (1 M, 200 ?L) under argon atmosphere at 0? C. and the mixture was stirred at 0? C. for 40 min when TLC indicated the completion of the reaction. Et.sub.3N (150 ?L) was added to the mixture, followed by careful addition of MeOH (500 ?L). The mixture was co-evaporated with MeOH for three times and the residue was purified by silica gel flash chromatography (hexanes/EtOAc=6:1?2:1) to afford 9 (100 mg, 91%) as a white solid. R/=0.30 (hexanes/EtOAc=3:1); 1H NMR (400 MHZ, CDCl.sub.3) ? 7.45-7.32, 7.25-7.23 (27H, m, ArH), 6.88-6.86 (2H, m, ArH), 5.00-4.96 (2H, m, PhCH.sub.2), 4.88-4.84 (3H, m, PhCH.sub.2), 4.83-4.78 (3H, m, PhCH.sub.2), 4.73 (1H, d, J=12.0 Hz, PhCH.sub.2), 4.67-4.62 (2H, m), 4.51-4.48 (2H, m), 4.34 (1H, d, J=8.1 Hz), 4.02 (1H, dd, J=9.4 Hz, J=9.4 Hz), 3.87 (1H, dd, J=3.7 Hz, J=11.1 Hz), 3.83 (3H, s, OCH.sub.3), 3.73-3.66 (2H, m), 3.60-3.52 (2H, m), 3.48 (1H, dd, J=9.1 Hz, J=9.1 Hz), 3.41-3.31 (4H, m), 3.22-3.17 (1H, m), 1.68 (1H, s); .sup.13C NMR (100 MHZ, CDCl.sub.3) ? 159.28, 138.42, 138.36, 138.13, 137.96, 136.91, 130.65, 129.56, 128.51, 128.42, 127.99, 127.91, 127.89, 127.81, 127.74, 127.71, 127.41, 113.87, 102.51, 100.41, 84.48, 82.86, 81.35, 77.97, 76.46, 75.50, 75.19, 75.16, 75.08, 75.04, 74.87, 73.40, 70.81, 67.60, 65.91, 61.84, 55.32; MALDI-TOF: [M+Na].sup.+ calcd for C.sub.55H.sub.59N.sub.3NaO.sub.11.sup.+, 960.40; found, 959.99.
Benzyl 2,4-di-O-benzyl-3-O-p-methoxybenzyl-?-D-glucopyranosyl-(1?4)-2-acetamido-3,6-di-O-benzyl-2-deoxy-?-D-glucopyranoside (10)
[0231] A solution of 9 (35.0 mg, 0.037 mmol) in a mixture of AcSH/pyridine/CHCl.sub.3 (0.6 mL/0.4 mL/0.6 mL) was stirred at 50? C. for 15 h. After the completion of the reaction as monitored by TLC, the resulting mixture was concentrated and the residue was subjected to flash chromatography on silica gel (hexanes/Acetone=4:1?2:1) to afford 10 (31.6 mg, 89%) as white solid. R.sub.f=0.20 (hexanes/Acetone=3:1); 1H NMR (400 MHZ, CDCl.sub.3) ? 7.40-7.28, 7.23-7.21 (27H, m, ArH), 6.86-6.84 (2H, m, ArH), 5.65 (1H, d, J=7.6 Hz), 5.00 (1H, d, J=7.6 Hz), 4.94-4.92 (2H, m), 4.89-4.87 (1H, m), 4.86 (1H, m), 4.84-4.75 (3H, m), 4.67-4.58 (4H, m), 4.53-4.46 (2H, m), 4.19 (1H, dd, J=9.0 Hz, J=9.0 Hz), 3.89 (1H, dd, J=8.6 Hz, J=8.6 Hz), 3.87 (1H, dd, J=3.9 Hz, J=11.0 Hz), 3.82 (3H, s, OCH.sub.3), 3.75-3.69 (2H, m), 3.59-3.54 (2H, m), 3.48-3.34 (4H, m), 3.23-3.20 (1H, m), 1.85 (3H, s); .sup.13C NMR (100 MHZ, CDCl.sub.3) ? 170.47, 159.23, 138.83, 138.37, 138.12, 138.08, 137.58, 130.68, 129.51, 128.47, 128.44, 128.41, 128.40, 127.98, 127.90, 127.87, 127.81, 127.78, 127.70, 127.51, 113.83, 102.63, 98.91, 84.41, 82.81, 77.95, 77.76, 77.34, 75.43, 74.99, 74.85, 74.28, 73.32, 70.86, 68.11, 61.96, 56.87, 55.29, 23.61; MALDI-TOF: [M+Na].sup.+ calcd for C.sub.57H.sub.63NNaO.sub.12.sup.+, 976.42; found, 976.25.
Benzyl 2,4-di-O-benzyl-3-O-p-methoxybenzyl-6-O-2-[2-(2-azidoethoxy)ethoxy]ethyl-?-D-glucopyranosyl-(1?4)-2-acetamido-3,6-di-O-benzyl-2-deoxy-?-D-glucopyranoside (11)
[0232] To a solution of 10 (23.0 mg, 0.024 mmol) and the tosylate linker (Orgueira et al., Chem Eur J 2003 9:140-69) (23.8 mg, 0.073 mmol) in anhydrous DMF (0.6 mL) was added 60% sodium hydride (5.0 mg, 0.125 mmol) at 0? C. After stirring for 0.5 h at 0? C. then 6 h at room temperature, MeOH (50 ?L) and AcOH (10 ?L) were added to the reaction mixture at 0? C. The reaction mixture was concentrated to dryness. The residue was then purified by column chromatography on silica-gel (hexanes/Acetone=5:1?3:2) to give 11 (22.7 mg, 85%) as a white solid. R.sub.f=0.30 (hexanes/Acetone=2:1); 1H NMR (400 MHZ, CDCl.sub.3) ? 7.39-7.26 7.22-7.20 (27H, m, ArH), 6.85-6.83 (2H, m, ArH), 5.67 (1H, d, NH, J=7.8 Hz), 4.94-4.82 (6H, m), 4.79-4.74 (2H, m), 4.68-4.63 (2H, m), 4.61-4.56 (2H, m), 4.51-4.45 (2H, m), 4.05-4.03 (2H, m), 3.88 (1H, dd, J=4.1 Hz, J=10.7 Hz), 3.81 (3H, s, OCH.sub.3), 3.77-3.65 (3H, m), 3.61-3.48 (14H, m), 3.39 (1H, dd, J=8.1 Hz, J=8.1 Hz), 3.34-3.28 (3H, m), 1.82 (3H, s); .sup.13C NMR (100 MHZ, CDCl.sub.3) ? 170.14, 159.19, 139.09, 138.43, 138.40, 138.17, 137.66, 130.77, 129.49, 128.43, 128.41, 128.40, 128.33, 128.26, 128.13, 128.06, 127.96, 127.88, 127.85, 127.80, 127.74, 127.69, 127.66, 127.63, 127.47, 113.80, 102.82, 99.13, 84.50, 82.76, 77.86, 77.73, 76.92, 75.39, 75.06, 75.02, 74.99, 74.81, 73.61, 73.25, 70.87, 70.69, 70.59, 70.55, 69.93, 69.85, 68.38, 55.50, 55.29, 50.60, 23.50; MALDI-TOF MS: [M+Na].sup.+ calcd for C.sub.63H.sub.74N.sub.4NaO.sub.14.sup.+, 1133.51; found, 1133.27.
6-O-2-[2-(2-aminoethoxy)ethoxy]ethyl-?-D-glucopyranosyl-(1?4)-2-acetamido-2-deoxy-?-D-glucopyranoside (12)
[0233] A mixture of 11 (20.0 mg, 0.018 mmol) and Pd/C (10 wt. % loading, 10 mg) in THF (1.5 mL) and H.sub.2O (0.5 mL) was added 3 M HCl (aq, 12 ?L, 2 eq), then stirred under H.sub.2 atmosphere overnight. After LC-MS analysis showed the complete deprotection and conversion of the azide to free amine, the reaction mixture was filtered through a Celite pad. The filtrate was concentrated, and the residue was purified by Sephadex LH-20 (H.sub.2O) to give 12 (9.2 mg, 93%) as hydrochloride salt. 1H NMR (400 MHZ, D.sub.2O) ? 5.09 (0.52H, m), 4.62 (0.43H, d, J=7.9 Hz), 4.43-4.39 (1.04H, m), 4.26-4.22 (0.22H, m), 4.04-4.01 (0.26H, m), 3.89-3.82 (1.40H, m), 3.80-3.73 (3.73H, m), 3.67-3.55 (13.8H, m), 3.55-3.51 (2.34H, m), 3.43-3.38 (1.57H, m), 3.36-3.31 (1.26H, m), 3.24-3.18 (1.31H, m), 3.11 (1.18, t, J=4.9 Hz), 1.94 (3H, s); .sup.13C NMR (100 MHZ, D.sub.2O) ? 174.53, 174.29, 102.59, 94.78, 90.51, 79.45, 79.11, 75.35, 74.69, 74.48, 73.05, 72.42, 70.10, 70.02, 69.63, 69.58, 69.46, 69.20, 69.15, 66.56, 60.34, 59.99, 59.85, 56.22, 53.74, 39.11, 22.16, 21.87; HRMS: [M+H].sup.+ calcd for C.sub.20H.sub.39N.sub.2O.sub.13.sup.+, 515.2447; found, 515.2440.
6-O-2-[2-(2-azidoethoxy)ethoxy]ethyl-?-D-glucopyranosyl-(1?4)-2-acetamido-2-deoxy-?-D-glucopyranoside (13)
[0234] To a solution of 12 (9.0 mg, 0.016 mmol) in H.sub.2O (1.0 mL) was added freshly prepared solution of TfN.sub.3 Orgueira et al. 2003, Chem Eur J 9) in CH.sub.2Cl.sub.2 (0.5 mL, ?0.16 mmol) containing K.sub.2CO.sub.3 (6.8 mg) and CuSO.sub.4 (0.8 mg) at 0? C. Then MeOH was added to make the solution homogenous, and the mixture was stirred at room temperature for 36 h. The reaction mixture was filtered, and the filtrate was concentrated to dryness. The residue was purified on a Sephadex LH-20 column by elution with H.sub.2O. Fractions containing the product were pooled and lyophilized, then further purified by preparative RP-HPLC (gradient, 5-15% aq MeCN containing 0.1% FA for 30 min; flow rate, 4 mL/min) to give 13 (7.2 mg, 81%) as a white solid after lyophilization. 1H NMR (400 MHZ, D.sub.2O) ? 5.09 (0.58H, d, J=2.5 Hz), 4.61 (0.47H, d, J=7.7 Hz), 4.42-4.40 (0.97H, m), 3.88-3.83 (1.23H, m), 3.80-3.75 (2.89H, m), 3.75-3.73 (1.01H, m), 3.65-3.56 (12.9H, m), 3.53-3.49 (1.75H, m), 3.43-3.38 (2.83H, m), 3.36-3.31 (1.18H, m), 3.24-3.19 (1.20H, m), 1.94 (3H, s); .sup.13C NMR (100 MHZ, D.sub.2O) ? 174.51, 174.27, 102.61, 94.79, 90.48, 79.57, 79.30, 75.34, 74.70, 74.50, 73.05, 72.40, 70.11, 69.58, 69.53, 69.49, 69.19, 69.14, 60.05, 59.90, 56.20, 53.74, 50.10, 22.14, 21.84; HRMS: [M+H].sup.+ calcd for C.sub.20H.sub.37N.sub.4O.sub.13.sup.+, 541.2352; found, 541.2344.
2-Methyl-{6-O-2-[2-(2-azidoethoxy)ethoxy]ethyl-?-D-glucopyranosyl-(1?4)-1,2-dideoxy-?-D-glucopyrano}-[2,1-d]-2-oxazoline (14)
[0235] To a solution of 13 (3.3 mg, 6.1 ?mol) in H.sub.2O (150 ?L) were added Et.sub.3N (30 mol. equiv.) and 2-chloro-1,3-dimethylimidazolinium chloride (DMC, 20 mol. equiv.) at 0? C. The reaction mixture was kept at this temperature for 8 h then purified by gel filtration on a Sephadex G-10 column that was eluted with 0.1% aq Et.sub.3N to afford 14 (3.0 mg, 94%) as white solid after lyophilization with aq. NaOH (0.05 mol. equiv., to keep the product at a basic condition). 1H NMR (400 MHZ, D.sub.2O) ? 5.96 (1H, d, J=7.3 Hz), 4.35 (1H, d, J=7.9 Hz), 4.26-4.23 (1H, m), 4.08-4.06 (1H, m), 3.78-3.75 (1H, m), 3.70 (1H, dd, J=2.3 Hz, J=12.4 Hz), 3.64-3.57 (12H, m), 3.54-3.52 (1H, m), 3.47-3.43 (1H, m), 3.40-3.37 (2H, m), 3.34-3.29 (2H, m), 3.18-3.14 (1H, m), 2.88-2.86 (1H, m), 1.94 (3H, s); .sup.13C NMR (100 MHZ, D.sub.2O) ? 168.29, 104.14, 99.72, 78.35, 75.35, 74.74, 72.98, 70.79, 70.22, 69.58, 69.48, 69.18, 65.12, 61.52, 50.07, 12.85; HRMS: [M+H].sup.+ calcd for C.sub.20H.sub.35N.sub.4O.sub.12.sup.+, 523.2246; found, 523.2233.
Benzyl 2,3,4,6-tetra-O-acetyl-?-D-galactopyranosyl-(1?4)-2-azido-3,6-di-O-benzyl-2-deoxy-?-D-glucopyranoside (17)
[0236] A mixture of trichloroacetimidate donor 15 (Wu et al., ACS Chem Biol 2014 9:468-750) (810 mg, 1.65 mmol), acceptor 16 (570 mg, 1.2 mmol) and activated 4 ? molecular sieves (1.5 g) in anhydrous CH.sub.2Cl.sub.2 (15.0 mL) was stirred at room temperature under an argon atmosphere for 1.5 h. It was then cooled to ?40? C., and TMSOTf (27 ?L, 0.15 mmol) was added. After stirring at ?40? C. for 50 min, the mixture was quenched with triethylamine (50 ?L). The mixture was filtered, and the filtrate was concentrated in vacuo. The residue was purified by flash silica gel chromatography (hexanes/EtOAc=10:1?3:2) to give 17 (832 mg, 86%) as white foam. R/=0.30 (hexanes/EtOAc=2:1); 1H NMR (400 MHZ, CDCl.sub.3) ? 7.46-7.30 (15H, m, ArH), 5.29 (1H, d, J=3.3 Hz), 5.13 (1H, dd, J=8.0 Hz, J=10.4 Hz), 4.99-4.93 (2H, m), 4.85 (1H, dd, J=3.5 Hz, J=10.4 Hz), 4.81-4.74 (2H, m), 4.70 (1H, d, J=12.0 Hz, PhCH), 4.60 (1H, d, J=8.0 Hz), 4.50 (1H, d, J=12.0 Hz, PhCH), 4.30 (1H, d, J=8.1 Hz), 4.07-4.01 (2H, m), 3.87 (1H, dd, J=6.0 Hz, J=11.1 Hz), 3.79-3.72 (2H, m), 3.59 (1H, dd, J=7.0 Hz, J=7.0 Hz), 3.50 (1H, dd, J=8.3 Hz, J=9.8 Hz), 3.37 (1H, dd, J=9.1 Hz, J=9.1 Hz), 3.32-3.30 (1H, m), 2.13 (3H, s), 2.01 (3H, s), 2.00 (3H, s), 1.99 (3H, s); .sup.13C NMR (100 MHZ, CDCl.sub.3) ? 170.19, 170.07, 169.18, 138.21, 137.73, 136.76, 128.63, 128.49, 128.23, 128.13, 128.04, 128.00, 127.95, 127.93, 127.72, 100.51, 100.07, 80.95, 76.05, 75.14, 74.85, 73.70, 70.95, 70.93, 70.52, 69.58, 67.44, 66.80, 65.78, 60.60, 20.78, 20.66, 20.64, 20.59; MALDI-TOF: [M+Na].sup.+ calcd for C.sub.41H.sub.47N.sub.3NaO.sub.14.sup.+, 828.29; found, 828.05.
Benzyl 2,3,4-tri-O-benzyl-6-O-(tert-Butyldiphenylsilyl)-?-D-galactopyranosyl-(1?4)-2-azido-3,6-di-O-benzyl-2-deoxy-?-D-glucopyranoside (18)
[0237] To a solution of 17 (340 mg, 0.422 mmol) in MeOH (4.0 mL) was added sodium methoxide until pH=10, the solution was heated to 50? C. and stirred overnight. After the complete disappearance of the starting material, the reaction mixture was diluted with CH.sub.2Cl.sub.2, successively washed with H.sub.2O and brine. The organic layer was dried over anhydrous Na.sub.2SO.sub.4 and filtered. The filtrate was concentrated to dryness to give the crude deacylated intermediate. The residue was then dissolved in dry N,N-dimethylformamide (3.0 mL), imidazole (144 mg, 2.11 mmol) and tert-Butyl(chloro)diphenylsilane (312 ?L, 1.2 mmol) were added successively, and the resulting mixture was stirred at room temperature until the completion of the reaction as indicated by TLC. The reaction mixture was diluted with CH.sub.2Cl.sub.2, successively washed with H.sub.2O and brine. The organic layer was dried over anhydrous Na.sub.2SO.sub.4 and filtered. The filtrate was concentrated to dryness. Then the residue was dissolved in dry N,N-dimethylformamide (3.0 mL) and cooled to 0? C., sodium hydride (135 mg, 3.38 mmol) and benzyl bromide (300 ?L, 2.53 mmol) were added successively, and the mixture was slowly warmed to room temperature. After the completion of the reaction as monitored by TLC, MeOH was added to quench the excess sodium hydride. The reaction mixture was diluted with CH.sub.2Cl.sub.2, successively washed with H.sub.2O and brine. The organic layer was dried over anhydrous Na.sub.2SO.sub.4 and filtered. The filtrate was concentrated and the residue was purified by flash column chromatography on silica gel (hexanes/EtOAc=15:1?8:1) to give 18 (328 mg, 68% for 3 steps) as colorless syrup. R.sub.f=0.40 (hexanes/EtOAc=4:1); 1H NMR (400 MHZ, CDCl.sub.3) ? 7.59-7.55, 7.46-7.25 (40H, m, ArH), 5.12 (1H, d, J=11.4 Hz), 5.00 (1H, d, J=10.0 Hz), 4.94 (1H, d, J=12.1 Hz), 4.86-4.76 (4H, m), 4.71-4.62 (3H, m), 4.60-4.58 (2H, m), 4.44-4.37 (2H, m), 4.28 (1H, d, J=8.1 Hz), 4.07 (1H, d, J=2.3 Hz), 3.96 (1H, dd, J=9.2 Hz, J=9.2 Hz), 3.89-3.84 (2H, m), 3.79 (1H, dd, J=9.5 Hz, J=9.5 Hz), 3.73-3.70 (1H, m), 3.65 (1H, dd, J=9.5 Hz, J=5.0 Hz), 3.48-3.42 (2H, m), 3.33-3.23 (3H, m), 1.08 (9H, s); .sup.13C NMR (100 MHz, CDCl.sub.3) ? 139.27, 138.88, 138.68, 138.31, 138.01, 136.99, 135.57, 134.86, 133.25, 133.19, 129.85, 129.73, 128.54, 128.48, 128.37, 128.29, 128.17, 128.10, 128.04, 127.97, 127.92, 127.88, 127.81, 127.77, 127.71, 127.64, 127.58, 127.51, 127.38, 127.21, 102.75, 100.45, 82.44, 81.38, 80.22, 76.11, 75.50, 75.40, 75.32, 74.79, 74.33, 73.76, 73.26, 72.84, 70.76, 67.85, 65.67, 61.16, 27.02, 26.96, 26.62, 19.23; MALDI-TOF: [M+Na].sup.+ calcd for C.sub.70H.sub.75N.sub.3NaO.sub.10Si.sup.+, 1168.51; found, 1168.22.
Benzyl 2,3,4-tri-O-benzyl-6-O-(tert-Butyldiphenylsilyl)-?-D-galactopyranosyl-(1?4)-2-acetamido-3,6-di-O-benzyl-2-deoxy-?-D-glucopyranoside (19)
[0238] A solution of 18 (300 mg, 0.262 mmol) in a mixture of AcSH/pyridine/CHCl.sub.3 (0.8 mL/0.6 mL/0.8 mL) was stirred at 50? C. for 14 h. After the completion of the reaction as monitored by TLC, the resulting mixture was concentrated and the residue was subjected to flash chromatography on silica gel (hexanes/EtOAc=4:1?1:1) to afford 19 (240 mg, 79%) as colorless syrup. R.sub.f=0.30 (hexanes/EtOAc=2:1); 1H NMR (400 MHZ, CDCl.sub.3) ? 7.60-7.56, 7.44-7.23, 7.20-7.18 (40H, m, ArH), 5.78 (1H, d, J=7.7 Hz), 5.08 (1H, d, J=11.3 Hz), 4.97 (1H, d, J=6.8 Hz), 4.89 (1H, d, J=11.9 Hz), 4.86-4.77 (5H, m), 4.63-4.51 (4H, m), 4.42-4.39 (2H, m), 4.06-4.02 (2H, m), 3.94 (1H, dd, J=7.5 Hz, J=7.5 Hz), 3.89-3.76 (4H, m), 3.68-3.64 (2H, m), 3.55-3.49 (1H, m), 3.45 (1H, dd, J=9.8 Hz, J=2.8 Hz), 3.30-3.26 (1H, m), 1.81 (3H, s), 1.07 (9H, s); .sup.13C NMR (100 MHZ, CDCl.sub.3) ? 170.12, 139.12, 138.70, 138.62, 138.50, 138.37, 137.68, 135.53, 133.14, 129.87, 129.75, 128.44, 128.32, 128.30, 128.22, 128.12, 128.10, 127.99, 127.89, 127.82, 127.79, 127.76, 127.68, 127.66, 127.56, 127.53, 127.37, 127.19, 103.13, 99.06, 82.26, 80.08, 77.13, 76.66, 75.32, 75.24, 74.65, 74.31, 73.84, 73.68, 73.16, 72.89, 70.74, 68.73, 61.38, 55.02, 26.95, 23.47, 19.19; MALDI-TOF: [M+Na].sup.+ calcd for C.sub.72H.sub.79NNaO.sub.11Si.sup.+, 1184.53; found, 1184.07.
Benzyl 2,3,4-tri-O-benzyl-?-D-galactopyranosyl-(1?4)-2-acetamido-3,6-di-O-benzyl-2-deoxy-?-D-glucopyranoside (20)
[0239] To a solution of 19 (215 mg, 0.185 mmol) in THF (2.0 mL) was added TBAF (1 M in THF, 900 ?L), and the mixture was stirred at 40? C. for 2 h. After the completion of the reaction as monitored by TLC, the resulting mixture was concentrated and the residue was subjected to flash chromatography on silica gel (hexanes/EtOAc=5:1?1:1) to afford 20 (140 mg, 82%) as a colorless syrup. R/=0.25 (hexanes/Acetone=2:1); 1H NMR (400 MHZ, CDCl.sub.3) ? 7.38-7.24 (30H, m, ArH), 5.70 (1H, d, J=7.8 Hz), 4.99-4.93 (3H, m), 4.90 (1H, d, J=12.1 Hz), 4.85-4.73 (4H, m), 4.64-4.54 (4H, m), 4.44-4.41 (2H, m), 4.13 (1H, dd, J=8.2 Hz, J=8.2 Hz), 3.96 (1H, dd, J=8.0 Hz, J=8.0 Hz), 3.88-3.78 (3H, m), 3.74-3.73 (1H, m), 3.69-3.62 (2H, m), 3.55-3.49 (1H, m), 3.45-3.36 (2H, m), 3.26-3.23 (1H, m), 1.85 (3H, s); .sup.13C NMR (100 MHZ, CDCl.sub.3) ? 170.42, 138.67, 138.62, 138.49, 138.39, 138.29, 137.61, 128.47, 128.38, 128.36, 128.32, 128.25, 128.19, 128.10, 127.92, 127.77, 127.74, 127.57, 127.54, 127.50, 103.19, 98.95, 82.48, 79.92, 77.48, 75.34, 75.13, 75.00, 74.41, 74.38, 73.71, 73.17, 73.11, 70.72, 68.64, 62.00, 55.71, 23.57; MALDI-TOF: [M+Na].sup.+ calcd for C.sub.56H.sub.61NNaO.sub.11.sup.+, 946.41; found, 946.04.
Benzyl 2,3,4-tri-O-benzyl-6-O-2-[2-(2-azidoethoxy)ethoxy]ethyl-?-D-galactopyranosyl-(1?4)-2-acetamido-3,6-di-O-benzyl-2-deoxy-?-D-glucopyranoside (21)
[0240] To a solution of 20 (120 mg, 0.13 mmol) and the tosylate linker (128 mg, 0.39 mmol) in anhydrous DMF (2.5 mL) was added 60% sodium hydride (26 mg, 0.65 mmol) at 0? C. After stirring for 0.5 h at 0? C. then 6 h at room temperature, the reaction was diluted with CH.sub.2Cl.sub.2, successively washed with H.sub.2O and brine and dried over anhydrous Na.sub.2SO.sub.4. The mixture was filtered, and the filtrate was concentrated. The residue was purified by column chromatography on silica-gel (hexanes/Acetone=6:1?2:1) to give 21 (120 mg, 85%) as a colorless syrup. R/=0.30 (hexanes/Acetone=2:1); 1H NMR (400 MHZ, CDCl.sub.3) ? 7.37-7.23 (30H, m, ArH), 5.78 (1H, d, J=7.7 Hz), 4.99 (1H, d, J=11.5 Hz), 4.96-4.89 (3H, m), 4.87-4.80 (2H, m), 4.76-4.74 (2H, m), 4.64-4.54 (4H, m), 4.47-4.41 (2H, m), 4.07 (1H, dd, J=8.0 Hz, J=8.0 Hz), 4.00 (1H, dd, J=7.5 Hz, J=7.5 Hz), 3.93 (1H, d, J=2.5 Hz), 3.88-3.84 (1H, m), 3.81-3.77 (2H, m), 3.69-3.60 (8H, m), 3.57-3.51 (4H, m), 3.48-3.40 (4H, m), 3.35 (2H, t, J=5.0 Hz), 1.86 (3H, s); .sup.13C NMR (100 MHZ, CDCl.sub.3) d 170.12, 138.98, 138.88, 138.66, 138.50, 138.34, 137.68, 128.39, 128.34, 128.31, 128.21, 128.16, 127.99, 127.90, 127.84, 127.69, 127.59, 127.55, 127.49, 127.46, 103.15, 99.12, 82.26, 79.92, 75.34, 75.22, 74.62, 73.76, 73.60, 73.13, 72.72, 70.70, 70.61, 70.55, 70.39, 70.04, 69.05, 68.72, 55.12, 50.65, 23.53; MALDI-TOF: [M+Na].sup.+ calcd for C.sub.62H.sub.72N.sub.4NaO.sub.13.sup.+, 1103.50; found, 1103.10.
6-O-2-[2-(2-aminoethoxy)ethoxy]ethyl-?-D-galactopyranosyl-(1?4)-2-acetamido-2-deoxy-?-D-glucopyranoside (22)
[0241] To a mixture of 21 (75.0 mg, 0.069 mmol) and Pd/C (10 wt. % loading, 40 mg) in THF (4.5 mL) and H.sub.2O (1.5 mL) was added 3 M HCl (aq, 46 ?L, 2 eq), then the mixture was stirred under a H.sub.2 atmosphere overnight. After LC-MS indicated the completion deprotection and conversion of the azide to amine, the reaction mixture was filtered through a Celite pad. The filtrate was concentrated and the residue was purified by Sephadex LH-20 (H.sub.2O) to give 22 (37.2 mg, 97%) as hydrochloride salt. 1H NMR (400 MHZ, D.sub.2O) ? 5.10 (0.56H, m), 4.62 (0.42H, d, J=7.6 Hz), 4.37 (1.05H, d, J=7.9 Hz), 3.90-3.82 (2.22H, m), 3.81-3.76 (3.46H, m), 3.74-3.70 (0.71H, m), 3.65-3.55 (15.61H, m), 3.47-3.42 (1.28H, m), 3.00-2.98 (1.61H, m), 1.94 (3H, s); 13C NMR (100 MHZ, D.sub.2O) ? 174.51, 174.26, 102.98, 94.83, 90.51, 79.40, 79.07, 74.69, 73.33, 72.48, 72.40, 71.67, 70.80, 70.09, 70.00, 69.87, 69.62, 69.55, 69.49, 69.42, 69.21, 68.67, 67.95, 67.91, 60.35, 60.08, 59.93, 56.12, 53.70, 39.30, 22.18, 21.89; HRMS: [M+H].sup.+ calcd for C.sub.20H.sub.39N.sub.2O.sub.13.sup.+, 515.2447; found, 515.2440.
6-O-2-[2-(2-azidoethoxy)ethoxy]ethyl-?-D-galactopyranosyl-(1?4)-2-acetamido-2-deoxy-?-D-glucopyranoside (23)
[0242] To a solution of 22 (9.0 mg, 0.016 mmol) in H.sub.2O (1.0 mL) was added a freshly prepared solution of TfN.sub.3 (Orgueira et al., 2003 Chem eu J 2003 9:140-69) in CH.sub.2Cl.sub.2 (0.5 mL, ?0.16 mmol) containing K.sub.2CO.sub.3 (6.8 mg) and CuSO.sub.4 (0.8 mg) at 0? C., then MeOH was added to make the solution homogenous. The mixture was stirred at room temperature for 36 h and then the reaction mixture was filtered. The filtrate was concentrated to dryness and the residue was purified on a Sephadex LH-20 column by elution with H.sub.2O. Fractions containing the product were pooled and lyophilized, then further purified by preparative RP-HPLC (gradient, 5-15% aq MeCN containing 0.1% FA for 30 min; flow rate, 4 ml/min) to give 23 (7.5 mg, 85%) as white solid. 1H NMR (400 MHZ, D.sub.2O) ? 5.09 (0.64H, m), 4.61 (0.43H, d, J=7.6 Hz), 4.37 (1.01H, d, J=7.8 Hz), 3.88-3.82 (2.28H, m), 3.79-3.75 (3.59H, m), 3.74-3.70 (0.62H, m), 3.67-3.54 (15.67H, m), 3.51-3.50 (0.41H, m), 3.47-3.38 (2.97H, m), 3.12-3.09 (0.23H, m), 1.94 (3H, s); .sup.13C NMR (100 MHZ, D.sub.2O) ? 174.50, 174.25, 102.98, 94.82, 90.47, 79.44, 79.17, 74.72, 73.36, 72.46, 72.40, 70.79, 70.12, 69.94, 69.57, 69.55, 69.49, 69.18, 68.64, 60.11, 59.96, 56.12, 53.71, 50.11, 22.14, 21.84; HRMS: [M+H].sup.+ calcd for C.sub.20H.sub.37N.sub.4O.sub.13.sup.+, 541.2352; found, 541.2336.
2-Methyl-{6-O-2-[2-(2-azidoethoxy)ethoxy]ethyl-?-D-galactopyranosyl-(1?4)-1,2-dideoxy-?-D-glucopyrano}-[2,1-d]-2-oxazoline (24)
[0243] To a solution of compound 23 (5.3 mg, 9.8 ?mol) in H.sub.2O (200 ?L) were added Et.sub.3N (30 mol. equiv.) and 2-chloro-1,3-dimethylimidazolinium chloride (DMC, 20 mol. equiv.) at 0? C. The reaction mixture was kept at this temperature for 7 h then purified by gel filtration on a Sephadex G-10 column that was eluted with 0.1% aq Et.sub.3N to afford 24 (4.9 mg, 96%) as white solid after lyophilization with aqueous NaOH (0.05 mol. equiv.). 1H NMR (400 MHZ, D.sub.2O) ? 5.98 (1H, d, J=7.3 Hz), 4.31 (1H, d, J=7.8 Hz), 4.29-4.27 (1H, m), 3.80 (1H, d, J=3.1 Hz), 3.74-3.69 (2H, m), 3.67-3.57 (14H, m), 3.56-3.50 (2H, m), 3.42-3.38 (3H, m), 3.36-3.32 (1H, m), 1.96 (3H, s); .sup.13C NMR (100 MHZ, D.sub.2O) ? 168.22, 104.68, 99.86, 78.52, 73.50, 72.49, 71.02, 70.79, 70.23, 70.07, 69.57, 69.55, 69.51, 69.37, 69.20, 68.85, 65.29, 61.67, 50.12, 12.90; HRMS: [M+H].sup.+ calcd for C.sub.20H.sub.35N.sub.4O.sub.12.sup.+, 523.2246; found, 523.2236.
[0244] Compound (25). A solution of commercial trastuzumab (100 ?g) and oxazoline 6 (14 ?g, 20 eq per glycosylation site) was incubated with wild-type Endo-S2 (0.1 ?g) at 28? C. in 4 ?L of 150 mM PBS buffer (pH=7.0), and the reaction was monitored by LC-MS of aliquots. Within 30 min, LC-MS analysis indicated the completion of the transglycosylation with conversion yield >95%. LC-MS: calculated for whole antibody, M=146909 Da; found (m/2), 146912 (deconvolution data); After IdeS digestion, LC-MS calculated for Fc part, M=24656 Da; found (m/z), 24656 (deconvolution data).
[0245] Compound (26). A solution of commercial trastuzumab (100 ?g) and oxazoline 14 (10.5 ?g, 15 eq per reaction site) was incubated with wild-type Endo-S2 (0.3 ?g) at 28? C. in 4 ?L of 150 mM PBS buffer (pH=7.0), and the reaction was monitored by LC-MS of aliquots. LC-MS analysis indicated the completion of the transglycosylation with conversion yield >95% within 2 h. LC-MS: calculated for whole antibody, M=146909 Da; found (m/z), 146911 (deconvolution data); After IdeS digestion, LC-MS calculated for Fc part, M=24656 Da; found (m/z), 24656 (deconvolution data).
[0246] Compound (27). A solution of commercial trastuzumab (100 ?g) and oxazoline 24 (10.5 ?g, 15 eq per reaction site) was incubated with wild-type Endo-S2 (0.5 ?g) at 28? C. in 4 ?L of 150 mM PBS buffer (pH=7.0), and the reaction was monitored by LC-MS of aliquots. LC-MS analysis indicated the completion of the transglycosylation within 2 h, with conversion yield >95%. LC-MS: calculated for whole antibody, M=146909 Da; found (m/z), 146912 (deconvolution data); After IdeS digestion, LC-MS calculated for Fc part, M=24656 Da; found (m/z), 24657 (deconvolution data).
Compound (29).
[0247] To a solution of bis-PEG5-NHS (6.0 mg, 11.3 ?mol) in anhydrous DMSO (100 ?L) was added 28 (3.2 mg, 2.8 ?mol) in anhydrous DMSO (100 ?L) in 5 portions every 10 min, and Et.sub.3N was added to keep the pH=8.5. After the completion of the reaction as monitored by LC-MS, 10% TFA (aq) was added (60 ?L), and the reaction mixture was directly purified by preparative-HPLC (gradient, 30-70% aq MeCN containing 0.1% TFA for 40 min, 4 mL/min) to give 29 (3.6 mg, 82%) as white foam. RP-HPLC retention time, t.sub.R=22.5 min (gradient, 20-70% aq MeCN containing 0.1% FA for 30 min; flow rate, 0.4 mL/min). ESI-MS [M+H].sup.+ calcd for C.sub.76H.sub.122N.sub.11O.sub.22.sup.+, 1540.88; found, 1541.29; [M+Na].sup.+ calcd for C.sub.76H.sub.121N.sub.11NaO.sub.22.sup.+, 1562.86; found, 1563.28.
[0248] Compound (1). To a solution of 5 (1.4 mg, 2.55 ?mol) and 29 (2.1 mg, 1.36 ?mol) in anhydrous DMSO (40 ?L) was added Et.sub.3N (0.6 ?L) to adjust pH=8.5. The mixture was kept at room temperature until the complete consumption of 29 to give the crude product 30 in DMSO that was directly used in the next step without further purification. RP-HPLC retention time for 30, t.sub.R=16.9 min (gradient, 20-70% aq MeCN containing 0.1% FA for 30 min; flow rate, 0.4 mL/min). HRMS: [M+H].sup.+ calcd for C.sub.92H.sub.155N.sub.12O.sub.32.sup.+, 1941.0898; found, 1941.0847. To the residue obtained in the first step was added H.sub.2O (80 ?L) and Et.sub.3N (40 mol. equiv.), the mixture was cooled to 0? C. and 2-chloro-1,3-dimethylimidazolinium chloride (DMC, 30 mol. equiv.) was added. After 12 h at 0? C., the reaction was purified by preparative-HPLC (gradient, 25-60% aq MeCN containing 0.1% NH.sub.3.Math.H.sub.2O for 40 min, 4 mL/min) to give oxazoline 1 (1.9 mg, 73% for 2 steps) as white foam. HRMS: [M+H].sup.+ calcd for C.sub.92H.sub.153N.sub.12O.sub.31.sup.+, 1922.0759; found, 1922.0703.
[0249] Compound (2). To a solution of 12 (1.4 mg, 2.60 ?mol) and 29 (2.0 mg, 1.30 ?mol) in anhydrous DMSO (40 ?L) was added Et.sub.3N (0.6 ?L) to adjust pH=8.5. The mixture was kept at room temperature until the complete consumption of 29 to give the crude product (31), which was used in the next step without further purification. RP-HPLC retention time for 31, t.sub.R=17.1 min (gradient, 20-70% aq MeCN containing 0.1% FA for 30 min; flow rate, 0.4 mL/min). HRMS: [M+H].sup.+ calcd for C.sub.92H.sub.155N.sub.12O.sub.32.sup.+, 1941.0898; found, 1941.0851. To the residue obtained in the first step was added H.sub.2O (80 ?L) and Et.sub.3N (40 mol. equiv.). The mixture was cooled to 0? C. and 2-chloro-1,3-dimethylimidazolinium chloride (DMC, 30 mol. equiv.) was added. After 12 h at 0? C., the reaction was purified by preparative-HPLC (gradient, 25-60% aq MeCN containing 0.1% NH.sub.3.Math.H.sub.2O for 40 min, 4 mL/min) to give oxazoline 2 (2.0 mg, 80% for 2 steps) as white foam. HRMS: [M+H].sup.+ calcd for C.sub.92H.sub.153N.sub.12O.sub.31.sup.+, 1922.0759; found, 1922.0800.
[0250] Compound (3). To a solution of 22 (2.3 mg, 4.14 ?mol) and 29 (3.2 mg, 2.07 ?mol) in anhydrous DMSO (60 ?L) was added Et.sub.3N (0.8 ?L) to adjust pH=8.5. The mixture was kept at room temperature until the complete consumption of 29 to give the crude product (32), which was used directly for the oxazoline formation without further purification. RP-HPLC retention time for 32, t.sub.R=17.1 min (gradient, 20-70% aq MeCN containing 0.1% FA for 30 min; flow rate, 0.4 mL/min). HRMS: [M+H].sup.+ calcd for C.sub.92H.sub.155N.sub.12O.sub.32.sup.+, 1941.0898; found, 1941.0836. To the residue obtained in the first step was added H.sub.2O (100 ?L) and Et.sub.3N (40 mol. equiv.), the mixture was cooled to 0? C. and 2-chloro-1,3-dimethylimidazolinium chloride (DMC, 30 mol. equiv.) was added. After 12 h at 0? C., the reaction mixture was subjected to preparative-HPLC (gradient, 25-60% aq MeCN containing 0.1% NH.sub.3.Math.H.sub.2O for 40 min, 4 mL/min) to give oxazoline 3 (2.8 mg, 70% for 2 steps) as a white foam. HRMS: [M+H].sup.+ calcd for C.sub.92H.sub.153N.sub.12O.sub.31.sup.+, 1922.0759; found, 1922.0731.
[0251] Compound (33). A solution of commercial trastuzumab (500 ?g) and oxazoline 1 (200 ?g, 15 eq per glycosylation site) was incubated with wild-type Endo-S2 (1.0 ?g) at 28? C. in 25 ?L of 150 mM PBS buffer containing 5% of DMSO (pH=7.0). LC-MS monitoring indicated the complete transglycosylation after 1 h. The reaction mixture was diluted with 50 mM PB (3 mL) and filtered by 0.22 ?m filter to remove most of the hydrophobic payload, and the residue was purified using protein A chromatography to give the antibody-drug conjugate (33) (470 ?g, 95%). LC-MS: calculated for the whole ADC, M=149709 Da; found (m/z), 149709 (deconvolution data); After IdeS digestion, LC-MS calculated for the drug-conjugated Fc monomer, M=26056 Da; found (m/z), 26057 (deconvolution data).
[0252] Compound (34). A solution of commercial trastuzumab (500 ?g) and oxazoline 2 (250 ?g, 20 eq per reaction site) was incubated with wild-type Endo-S2 (10 ?g) at 28? C. in 25 ?L of 150 mM PBS buffer containing 5% of DMSO (pH=7.0), and the reaction was monitored by LC-MS of aliquots. After 1 h, another portion of oxazoline 2 (60 ?g, 5 eq per reaction site) was added to push the reaction. Within 1.5 h, LC-MS analysis indicated the completion of the transglycosylation with a conversion yield of >95%. The reaction mixture was diluted with 50 mM PB (3 mL) and filtered by 0.22 ?m filter to remove most of the hydrophobic payload, and the residue was purified using protein A chromatography to give 34 (460 ?g, 93%). LC-MS: calculated for the ADC, M=149709 Da; found (m/z), 149708 (deconvolution data); After IdeS digestion, LC-MS calculated for the drug-conjugated Fc monomer, M=26056 Da; found (m/z), 26057 (deconvolution data).
[0253] Compound (35). A solution of commercial trastuzumab (500 ?g) and oxazoline 3 (250 ?g, 20 eq per glycosylation site) was incubated with wild-type Endo-S2 (5 ?g) at 28? C. in 25 ?L of 150 mM PBS buffer containing 5% of DMSO (pH=7.0), and the reaction was monitored by LC-MS analysis. After 1 h, another portion of oxazoline 3 (60 ?g, 5 eq per glycosylation site) was added to push the reaction. Within 2 h, LC-MS analysis indicated the completion of the transglycosylation with a conversion yield of >95%. The reaction mixture was diluted with 50 mM PB (3 mL) and filtered by 0.22 ?m filter to remove most of the hydrophobic payload. The residue was purified using protein A chromatography to give 35 (430 ?g, 86%). LC-MS: calculated for the ADC, M=149709 Da; found (m/z), 149710 (deconvolution data); After IdeS digestion, LC-MS calculated for the drug-conjugated Fc monomer, M=26056 Da; found (m/z), 26057 (deconvolution data).
[0254] Culture conditions. SK-BR-3 cells (ATCC? HTB-30?) were maintained in suspension in McCoy's 5a Medium (ATCC? 30-2007) containing 10% fetal bovine serum (FBS, not heated), 100 U/mL penicillin and 100 ?g/mL streptomycin in T-75 flasks (CELLTREAT). BT474 cells (ATCC? HTB-20?) were maintained in suspension in Hybri-Care Medium (ATCC? 46-X) containing 10% fetal bovine serum (FBS), 100 U/mL penicillin and 100 ?g/mL streptomycin in T-75 flasks (CELLTREAT). T47D cells (ATCC? HTB-133?) were maintained in suspension in RPMI-1640 Medium (ATCC? 30-2001) containing 10% fetal bovine serum (FBS), 4 mg/L insulin, 100 U/mL penicillin and 100 ?g/mL streptomycin in T-75 flasks (CELLTREAT).
[0255] Cytotoxicity assays. For SK-BR-3 and T47D cell lines, the cells were plated into 96-well plates with 10,000 cells per well. These plates were incubated overnight at 37? C. and 5% CO.sub.2. Serial 3-fold dilution was applied to the ADC samples with the corresponding medium from 5000 ng/mL to 0.085 ng/mL. The samples were added to three wells (150 ?L per well) with every single concentration and the cells were cultured at 37? C. and 5% CO.sub.2 for three days before the addition of Cell Counting Kit-8 (Sigma). The absorbance of formazan released by viable cells was measured at 450 nm using a spectrophotometer after incubation for 2?3 h at 37? C. and 5% CO.sub.2. Finally, the EC.sub.50 values and the cell viability curve were calculated by GraphPad Prism software. For the BT474 cell line, the cells were plated into 96-well plates with 4,000 cells per well. These plates were incubated overnight at 37? C. and 5% CO.sub.2. Serial 3-fold dilution was applied to the ADC samples with the corresponding medium from 5000 ng/ml to 0.085 ng/ml. The samples were added to three wells (200 ?L per well) with every single concentration and the cells were cultured at 37? C. and 5% CO.sub.2 for six days before the addition of Cell Counting Kit-8 (Sigma). The absorbance of formazan released by viable cells was measured at 450 nm using a spectrophotometer after incubation for 2?3 h at 37? C. and 5% CO.sub.2. Finally, the EC.sub.50 values and the cell viability curve were calculated by GraphPad Prism software.
Example 3
[0256] Described in this Example is the design, synthesis, and evaluation of a series of simple disaccharide oxazoline derivatives modified with different functional groups and the evaluation of them as donor substrates for antibody glycoengineering. The substrate specificity of different endoglycosidases (Endo-S, Endo-S2, Endo-F3, Endo-A, Endo-CC, and their mutants) toward these synthetic substrates in glycan remodeling of therapeutic antibodies, using trastuzumab (Herceptin) as a model antibody was studied. It was found that wild-type Endo-S2 exhibited the best activity in transferring the functionalized disaccharides with site-selectively modified azide, biotin, or fluorescent tags to antibodies, but the transglycosylation products, once formed, were resistant to hydrolysis by the wild-type enzyme, due to the truncated modifications. Combining with the excellent Fc deglycosylation activity of Endo-S2, a simple one-pot deglycosylation and transglycosylation method was devised for direct labeling and functionalization to give structurally well-defined and homogeneously tagged antibodies (
Results
[0257] Chemical Synthesis of the Azido-Tagged Disaccharides. While it has been shown that smaller synthetic disaccharide oxazolines could serve as substrates of endoglycosidases Endo-A and Endo-M for transglycosylation (Zeng et al, 2006 Eu J 12:3355-3364) it is not clear whether these antibody-specific ENGases and their mutants can recognize the smaller substrates for trans-glycosylation using antibodies as acceptors. To test this hypothesis, a series of azido-tagged disaccharide oxazolines were synthesized. Considering the flexibility and solubility of PEGs, it was decided to introduce azido groups with PEG-derived scaffolds. Recently, Mizuno and co-workers have shown that PEGylated sugar oxazolines could serve as donor substrates of Endo-M for transglycosylation (Goto K et al., 2020 Tetrahedron Lett. 61:151475). Thus, a Man?1,4GlcNAc oxazoline carrying two azide groups was designed as a first target, in which the PEG-linkers resembled the natural glycan branches, so that it might be recognized favorably by the endoglycosidases (
[0258] Next, the disaccharides were synthesized with one or three azido groups (
[0259] Chemical Synthesis of the Disaccharide Derivatives Carrying a Cluster of Azide Groups. Previous studies have demonstrated that ADCs with higher DARs tend to provide increased target cell killing potency (Strop et al., 2015 Nat. Biotechno 33:694-696; Lyon et al., 2015 Nat Biotechnol 33:733-735). In a handful of cases, a DAR as high as 8 has been achieved through the use of hydrophilic linker payloads, as exemplified with clinically approved Enhertu and Trodelvy (Lyon et al., 2015 Nat Biotechnol 33:733-735; Barida et al., 2019 N Eng J Med 380:741-751; Viricel et al., 2019 Chem Sci 10:4048-4053). To equip antibodies with more biorthogonal tags, we designed disaccharides carrying four or six azido groups. The synthesis commenced with the branched scaffolds (
[0260] Evaluation of the Synthetic Disaccharide Oxazolines as Donor Substrates for Enzymatic Antibody Glycan Remodeling. With the disaccharide oxazolines in hand, their suitability as donor substrates for antibody-glycan remodeling was tested by the catalysis of different endoglycosidases. For the purpose, trastuzumab was chosen, an anti-Her2 antibody (Herceptin), as a typical monoclonal antibody and the synthetic disaccharide oxazoline (7) carrying two PEG-spaced azide groups as the donor substrate to examine the enzymatic reactions. The results are summarized in
[0261] Among the endoglycosidases tested, it was found that Endo-S2, 58 an endoglycosidase from Streptococcus pyogenes of serotype M49 (Endo-S2) with relaxed substrate specificity, exhibited remarkable activity toward the azido-tagged disaccharide oxazoline 7 for transglycosylation. With only a catalytic amount of enzyme (0.1%, w/w, enzyme/antibody) and 20 mol equivalents of the azido-disaccharide oxazoline, the reaction could reach completion within 1 h under mild conditions [rt, phosphate-buffered saline (PBS) buffer, and pH 7.0]. It was found that the transglycosylation product (33), once formed, was largely resistant to hydrolysis by the wild-type enzyme, mainly due to truncated modifications. The Endo-S2 mutant (D184M), a glycosynthase with broad substrate specificity and diminished hydrolytic activity (Li et al., 2016 J Biol Chem 291:16508-165518).
[0262] It was also tested and found that the D184M mutant could also use the azide-disaccharide oxazoline for transglycosylation, but the activity was lower than that of the wild-type enzyme, and a relatively large amount of the mutant enzyme (1%, w/w) was required to drive the reaction. Again, the transglycosylation product was not hydrolyzed by the mutant, allowing accumulation of the product. Next, wild-type Endo-S, the first endoglycosidase from Streptococcus pyogenes that shows Fc-specific deglycosylation activity was tested. (Goodfellow et al., 2012 J Am Chem Soc 134:8030-8033; Collin et al., 2001 EMBO J 20:3046-3055) Endo-S could transfer the modified disaccharide oxazoline (7), but, in contrast to wild-type Endo-S2, at least 10-fold more enzyme was required to drive the reaction. Similarly, the Endo-S D233Q mutant, which was a glycosynthase that could act efficiently on complex type N-glycan oxazoline and azido-Man3GlcNAc oxazoline corresponding to the N-glycan core for Fc glycan remodeling (Huang et al., 2012 J Am Chem Soc 134:12308-12318) just showed very low activity on 7, probably because the minimal structure and the modification made it a poor substrate for the enzyme.
[0263] In addition to Endo-S2 and Endo-S, several other endoglycosidases were tested. Endo-F3 is an endoglycosidase from Elizabethkingia meningoseptica that efficiently hydrolyzes core-fucosylated complex-type N-glycans (Tarentino et al., 1995 Glycobiology 5:599-601). It has been previously reported that wild-type Endo-F3 and its mutant Endo-F3 D165A can transfer with complex-type glycan oxazoline and core Man3GlcNAc oxazoline for N-glycopeptide synthesis and antibody glycan remodeling (Huang et al., 2011 Chem Bio Chem 12:932-941: Giddens et al., 2018 Proc Natl Acad USA 115:12023-12027: Giddens et al., 2016 J Biol Chem 291:9356-9370). However, it was found that neither wild-type Endo-F3 nor its glycosynthase mutant (D165A) could efficiently act on the azido-tagged disaccharide oxazoline for transglycosylation. As for endoglycosidases Endo-A (from Arthrobacter protophormiae) (Takegawa et al., 1997 ArchBiochem Biophys 338:22-28; Ochiai et al., J Am Chem Soc 130:13790-13803) Endo-D) Fan et al., 2012 J Biol Chem 287:11272-11281) and Endo-CC (Eshima et al, 2015 PLOS One 10 No e0132859) it was found that they were not able to transfer the azide-disaccharide oxazoline (7) to the Fuc?1,6GlcNAc-Herceptin. This is expected, as these three endoglycosidases cannot accept core-fucosylated GlcNAc as an acceptor. To test if nonfucosylated GlcNAc-Herceptin could serve as an acceptor, the core-fucose was removed from the Fuc?1,6Glc-NAc-Herceptin (32) by treatment with an ?-fucosidase (BfFucH) to produce the nonfucosylated Fc glycoform. However, Endo-A, Endo-D, and Endo-CC were not able to show the transglycosylation product, as monitored by LC-ESI-MS analysis, when even a large amount of enzyme (10%, w/w) was used (
[0264] One-Pot Chemoenzymatic Fc Glycan Remodeling with Different Azido-Tagged Disaccharide Oxazolines using Wild-Type Endo-S2. Given the observation that wild-type Endo-S2 could act on the minimal azido-disaccharide oxazoline for efficient transglycosylation without product hydrolysis and the fact that Endo-S2 is highly active for antibody Fc deglycosylation, it was envisioned that a one-pot and site-specific Fc glycan remodeling of antibodies should be possible to produce homogeneous azido-tagged antibody glycoforms. Indeed, when commercial Herceptin was treated with Endo-S2 together with the azido-disaccharide oxazoline (7) at rt in a PBS buffer (pH 7.0), LC-ESI-MS monitoring indicated that the Herceptin deglycosylation was complete within 10 min, followed by the appearance and accumulation of the transglycosylation product (33). The transglycosylation was complete within 1 h under the described conditions (
[0265] One-Pot Chemoenzymatic Fc Glycan Remodeling with Biotin- and Fluorophore-tagged Disaccharide Oxazolines. Encouraged by the one-pot introduction of the azido functionality, it was investigated whether one could directly transfer a more complex structure, such as biotin- or fluorophore-tagged disaccharide, to an intact antibody with Endo-S2; in this way, the antibody could be labeled in one step, which would be attractive for diagnostics and in vivo imaging and as tools for molecular biology (Freise et al., 2015 Mol Immunol 67:142-152; Zhou et al., 2017 Biomedicines 5:64; Boeggeman et al., 2009 20:1228-1236). To this end, biotin or TAMRA was introduced to the disaccharide, either via amine coupling reaction (39) or click chemistry (40), and it was found that the modified disaccharide oxazolines could still serve as good substrates of Endo-S2. The biotinylated disaccharide was transferred to the intact antibody to give 41 in 95% yield within 1.5 h with the catalytic amount of enzyme (0.1%, w/w), and the TAMRA-tagged disaccharide oxazoline could afford about 85% of product (42) if additional portions of oxazoline were added (
[0266] Synthesis of Structurally Well-Defined, Homogeneous ADCs by Copper-free Strain-Promoted Click Reactions. With these azido-tagged antibodies in hand, next, click chemistry was tried to make ADCs, using monomethyl auristatin E (MMAE) as a model warhead, a microtubule-disrupting agent that has been used for making the FDA-approved ADCs (
[0267] Comparative Study of the Cancer Cell Killing Potency of the ADCs with Different DARs. To demonstrate the potency of ADCs with different DARs, cytotoxicity assays in breast cancer cell lines expressing high or low levels of HER2 were conducted. The results showed that all the ADCs achieved significant cell killing of the high target (HER2)-expressing cell line BT474- and ADCs with higher DARs were more potent, as indicated by the half-maximal effective concentration (EC50) values (
[0268] Accordingly, a general and robust chemoenzymatic method for Fc glycan-mediated antibody labeling and conjugation is established. This method is enabled by the design, synthesis, and evaluation of various functionalized disaccharide oxazolines as donor substrates for Fc-specific endoglycosidase-catalyzed transglycosylation. The discovery that wild-type Endo-S2 exhibited excellent activity toward various selectively modified disaccharide oxazolines for transglycosylation, yet the resulting modified antibodies were resistant to enzymatic hydrolysis due to the modifications has led to a general platform for site-specific antibody labeling and conjugation. In particular, the relaxed substrate specificity of Endo-S2 allows direct labeling of antibodies with azide-, biotin-, or fluorescent tags, making it possible to achieve single-step labeling of intact antibodies in a site-selective manner. The flexibility to introduce varied numbers of azide functional groups provides a general and robust strategy to produce homogeneous ADCs with well-defined DARs ranging from 2 to 12. Since all the IgG antibodies carry highly conserved Fc-N-glycans, it is expected that this general Fc-glycan-mediated labeling and conjugation method will find wide applications not only for antibody-drug conjugation but also for cell labeling, imaging, and diagnosis.
Materials and Methods
[0269] Chemical Synthesis of Glycan Substrates. General. All chemicals, reagents, and solvents were purchased from Sigma-Aldrich and TCI and unless specially noted applied in the reaction without further purification. Thin-layer chromatography was performed using silica gel on glass plates (Sigma-Aldrich), and spots were detected under UV light (254 nm) and then charred with 5% (v/v) sulfuric acid in EtOH or cerium molybdate stain followed by heating at 150? C. Silica gel (200-425 mesh) for flash chromatography was purchased from Sigma-Aldrich. NMR spectra were recorded on a 400 MHz spectrometer (Bruker, Tokyo, Japan) with CDCl.sub.3 or D20 as the solvent. The chemical shifts were assigned in ppm, and multiplicities are indicated by s (singlet), d (doublet), t (triplet), q (quartet), and m (multiplet). Coupling constants (J) are reported in Hertz. MALDI-TOF was performed on a Bruker Autoflex speed mass spectrometer in the positive reflectron mode with DHB (ACN/H2O=1:1) as the matrix. HRMS was performed on an Exactive Plus Orbitrap mass spectrometer (Thermo Scientific) equipped with a C18 column. Preparative HPLC was performed with a Waters 600 HPLC instrument and Waters C18 columns (7.0 ?m, 19?300 mm). The column was eluted with a suitable gradient of MeCNH2O containing 0.1% FA at a flow rate of 10 mL/min. The detailed procedures for the chemical synthesis of the disaccharide derivatives and other small-molecule compounds (1-31, 39, and 40) are provided in the Supporting Information of (ACS Chem Biol 2021 Nov. 19;16 (11) incorporated herein in its entirety. The syntheses of antibody conjugates are described below.
[0270] Preparation of Azido-, Biotin-, or TAMRA-Functionalized Antibodies. General. LC-MS analysis was performed on an Ultimate 3000 HPLC system coupled to an Exactive Plus Orbitrap mass spectrometer (Thermo Fisher Scientific) with a C4 (whole antibody, gradient, 5-95% aq MeCN containing 0.1% FA for 6 min, 0.4 mL/min) or C8 (IdeS digestion, gradient, 25-35% aq MeCN containing 0.1% FA for 6 min, 0.4 mL/min, or 5-95% aq MeCN containing 0.1% FA for 6 min, 0.4 mL/min) column. Deconvolution data were transformed using MagTran software.
[0271] Synthesis of 33 (
[0272] Synthesis of 34 (
[0273] Synthesis of 35 (
[0274] Synthesis of 36 (
[0275] Synthesis of 37 (
[0276] Synthesis of 38 (
[0277] Synthesis of 41 (
[0278] Synthesis of 42 (
[0279] Synthesis of 43 (
[0280] Synthesis of 44 (
[0281] Synthesis of 45 (
[0282] Synthesis of 46 (
[0283] Synthesis of 47 (
[0284] Synthesis of 48 (
[0285] Cell Killing Studies with Breast Cancer Cell Lines. BT474 cells (ATCC HTB-20) were maintained in a suspension in Hybri-Care medium (ATCC 46-X) containing 10% fetal bovine serum (FBS), 100 U/mL penicillin, and 100 ?g/mL streptomycin in T-75 flasks (CELLTREAT). T47D cells (ATCC HTB-133) were maintained in a suspension in RPMI-1640 medium (ATCC 30-2001) containing FBS, 4 mg/L insulin, 100 U/mL penicillin, and 100 ?g/mL streptomycin in T-75 flasks (CELLTREAT). For the cytotoxicity assays, cells were plated into 96-well plates with 10,000 cells per well. These plates were incubated overnight at 37? C. and 5% CO.sub.2. Serial threefold dilution was applied to the ADC samples with the corresponding medium from 5000 to 0.085 ng/mL. The samples were added to three wells (150 ?L per well) with every single concentration, and the cells were cultured at 37? C. and 5% CO.sub.2 for three days before the addition of cell counting kit-8 (Sigma). The absorbance of formazan released by viable cells was measured at 450 nm using a spectrophotometer after incubation for 2-3 h at 37? C. and 5% CO.sub.2. Finally, the EC50 values and the cell viability curve were calculated using GraphPad Prism software.
Example 4
[0286] Lysosome-targeting chimeras (LYTACs) offer an opportunity for the degradation of extracellular and membrane-associated proteins of interest. Described herein is an efficient chemoenzymatic method that enables a single-step and site-specific conjugation of high-affinity mannose-6-phosphate (M6P) glycan ligands to antibodies without the need of protein engineering and conventional click reactions that would introduce unnatural moieties, yielding homogeneous antibody-M6P glycan conjugates for targeted degradation of membrane-associated proteins. Using trastuzumab and cetuximab as model antibodies, it was shown that the wild-type endoglycosidase S (Endo-S) could efficiently perform the antibody deglycosylation and simultaneous transfer of a M6P-glycan from a synthetic M6P-glycan oxazoline to the deglycosylated antibody in a one-pot manner, giving structurally well-defined antibody-M6P glycan conjugates. A two-step procedure, using wild-type Endo-S2 for deglycosylation followed by transglycosylation with an Endo-S2 mutant (D184M), was also efficient to provide M6P glycan-antibody conjugates. The chemoenzymatic approach was highly specific for Fc glycan remodeling when both Fc and Fab domains were glycosylated, as exemplified by the selective Fc-glycan remodeling of cetuximab. SPR binding analysis indicated that the M6P-conjugates possessed a nanomolar range of binding affinities for the cation-independent mannose-6-phosphate receptor (CI-MPR). Preliminary cell-based assays showed that the M6P-trastuzumab and M6P-cetuximab conjugates were able to selectively degrade the membrane-associated HER2 and EGFR, respectively. This modular glycan-remodeling strategy is expected to find wide applications for antibody-based lysosome-targeted degradation of extracellular and membrane proteins.
Results
[0287] Screening of endoglycosidases for site-specific enzymatic transfer of phosphorylated glycans to antibodies. The phosphorylated tetrasaccharide oxazoline (1) corresponding to the ?-1,3-branch of the N-glycans has recently been identified as a good substrate of wild-type Endo-A and Endo-F3 for transglycosylation to yield high-affinity ligands for CI-MPR (Zhang et al., Chem Sci 2021 12:12451-12462). To test if this M6P-glycan oxazoline can be efficiently transferred to an intact antibody by an enzyme, a panel of endoglycosidases were screened using the deglycosylated trastuzumab (Herceptin) as the acceptor and the phosphorylated tetrasaccharide oxazoline (1) as the donor substrate. The results were summarized in
[0288] Evaluation of additional M6P-glycan oxazolines as donor substrates for antibody glycan remodeling. After identifying the D184M mutant of Endo-S2 as an efficient mutant for glycosylation of trastuzumab with synthetic M6P-tetrasaccharide oxazoline (1), the glycosylation of the deglycosylated trastuzumab with two additional phosphorylated N-glycan oxazolines (4 and 5) that we have previously synthesized was examined and compared (Yamaguchi et al., J Am Chem Soc 2016 138:12472-85). As expected, the D184M mutant of Endo-S2 could efficiently act on glycan oxazoline 1 to produce the glycoform (3) carrying the corresponding M6P-containing N-glycan at the Fc domain (
[0289] In addition to trastuzumab, M6P-glycan remodeling of cetuximab was also performed, a therapeutic antibody that targets the epidermal growth factor receptor (EGFR) for the treatment of colorectal cancer and squamous-cell carcinoma (Chung et al., N Engl J Med 2008 358:1109-1117). Cetuximab is glycosylated in both Fab and Fc domains with tremendous heterogeneity in the N-glycan structures (Qian et al., Anal Biochem 2007 364:8-18) Previous studies have shown that wild-type Endo-S2 is highly specific for hydrolyzing the Fc glycans. (Giddens et al., Proc Natl Acad Sci USA 2018 115:12023-12027). Thus, the commercial cetuximab was first treated with wild-type Endo-S2 to produce the deglycosylated Fc glycoform. Then the resulting GNF-cetuximab (8) was used as an acceptor for Endo-S2 D184M-catalyzed transglycosylation with glycan oxazoline 1 and 5, affording the M6P-glycan remodeled cetuximab 9 and 10, respectively. It was found that the M6P-glycan remodeling of cetuximab was equally efficient as that of trastuzumab, and the products (9 and 10) were isolated in over 90% yield after protein A purification. To further verify that the M6P glycans were specifically conjugated to the Fc domain, the antibody products (9 and 10) were digested with the protease IdeS followed by LC-ESI-MS analysis of the Fab and Fc domains (Chevreux et al., Anal Biochem 2011 415:22-4) LC-ESI-MS analysis showed that the change of molecular weight of the Fc domain monomer was consistent with the attachment of the corresponding M6P glycan in antibody 9 and 10, respectively, but the Fab domains appeared as a mixture of glycoforms that did not change before and after the enzymatic glycoengineering procedures. These results confirm that the chemoenzymatic glycan remodeling approach is highly selective at the Fc domain without modification of the Fab domains. In addition, MALDI-TOF MS analysis of the N-glycans released from the Fc and Fab domains of antibody 9 further confirmed that the Fc domain of 9 carried a single M6P glycan, while the Fab glycans were intact before and after the glycan remodeling (
[0290] SPR binding studies. Next, the binding affinities of the M6P-modified antibodies to the lysosomal-targeting receptor (CI-MPR) using the SPR technology was evaluated. It was found that the antibodies carrying the M6P tetrasaccharide moiety corresponding to the ?-1,3-branch (3 and 9) and the bis-phosphorylated heptasaccharide moiety (7 and 10) showed high-affinity for the M6P receptor, CI-MPR (
[0291] Degradation of membrane-associated antigens with the M6P glycan-remodeled antibodies. Two antibodies were selected, the M6P-modified trastuzumab (3) that recognizes HER2 and the M6P-modified cetuximab (9) that targets EGFR, to examine their potential for targeted degradation of the respective antigens in a cell-based assay. Thus, BT474 (with endogenous HER2 expression) and HepG2 (with endogenous EGFR expression) cell lines were incubated with 3 and 9 for 48 h, respectively, and the total antigen levels were measured by Western blot. It was found that M6P-modified trastuzumab (3) could degrade 55% of HER2 with a concentration as low as 10 nM, while trastuzumab alone degraded HER2 at 18% (
[0292] The targeted degradation EGFR by the cetuximab-M6P glycan conjugate (9) produced in the present method was comparable to the cetuximab conjugate carrying the polymeric M6Pn-glycopeptide, where ca. 70% EGFR degradation was observed. (Banik et al., Nature 584:291-297). Next, the surface levels of HER2 and EGFR was measured by flow cytometry after the cells were treated with native or M6P-modified antibodies (
[0293] A highly efficient chemoenzymatic method for site-specific bioconjugation of high-affinity M6P glycan ligands to antibodies is established herein. The method provides structurally well-defined homogeneous M6P glycan-antibody conjugates that show high-affinity for the CI-MPR. The cell-based assays indicate that the M6P-trastuzumab and M6P-cetuximab conjugates can selectively degrade the membrane-associated HER2 and EGFR, respectively. This study provides the first example of endoglycosidase-catalyzed transfer of synthetic phosphorylated N-glycans to antibodies. This modular glycan-remodeling strategy enables the construction of homogeneous antibody-M6P-glycan conjugates in a single-step and site-specific manner without the need of protein engineering and conventional click reactions that would introduce unnatural moieties. It is expected that this method could be equally applicable to other antibodies to generate M6P-antibody conjugates for targeted degradation of extracellular and membrane proteins of interest.
Methods and Methods
[0294] Enzymatic glycosylation of the deglycosylated antibodies with phosphorylated glycan oxazolines as the donor substrates. General. LC-ESI-MS analysis was performed on an Ultimate 3000 HPLC system coupled to an Exactive Plus Orbitrap mass spectrometer (Thermo Fisher Scientific) with C4 (whole antibody, gradient, 5-95% aq MeCN containing 0.1% FA for 6 min, 0.4 mL/min) or C8 (IdeS digestion, gradient, 25-35% aq MeCN containing 0.1% FA for 6 min, 0.4 mL/min) column. Deconvolution data was transformed by MagTran software.
[0295] Synthesis of trastuzumab M6P-glycoform 3. A solution of the deglycosylated trastuzumab (2) (2.1 mg) and oxazoline 1 (220 ?g, 10 eq per reaction site) was incubated with Endo S2-D184M (2.1 ?g) at 25? C. in 210 ?L of 150 mM PBS buffer (pH=7.2), and the reaction was monitored by LC-ESI-MS of the aliquots. Within 2 h, LC-ESI-MS analysis indicated the completion of the transglycosylation, the product was purified using protein A chromatography to give 3 (2.0 mg, 95%). ESI-MS: calculated for whole antibody, M=147403 Da; found (m/z), 147406 (deconvolution data); calculated for the Fc monomer after IdeS digestion, M=24903 Da; found (m/z), 24904 (deconvolution data).
[0296] Synthesis of trastuzumab M6P-glycoform 6. A solution of the deglycosylated trastuzumab (2) (300 ?g) and oxazoline 4 (70 ?g, 20 eq per reaction site) was incubated with Endo S2-D184M (15 ?g) at 25? C. in 15 ?L of 150 mM PBS buffer (pH=7.2), and the reaction was monitored by LC-ESI-MS of the aliquots. After 1 h, another portion of oxazoline 4 (35 ?g, 10 eq per reaction site) was added and the reaction was carried out for another 30 min when LC-ESI-MS indicated the completion of transglycosylation. The product was purified on protein A column to give 6 (285 ?g, 95%). ESI-MS: calculated for whole antibody, M=147563 Da; found (m/z), 147564 (deconvolution data); calculated for the Fc monomer after IdeS digestion, M=24983 Da; found (m/z), 24984 (deconvolution data).
[0297] Synthesis of trastuzumab M6P-glycoform 7. A solution of the deglycosylated trastuzumab (2) (300 ?g) and oxazoline 5 (110 ?g, 20 eq per reaction site) was incubated with Endo S2-D184M (15 ?g) at 25? C. in 15 ?L of 150 mM PBS buffer (pH=7.2), and the reaction was monitored by LC-ESI-MS of the aliquots. After 1 h, another portion of oxazoline 5 (55 ?g, 10 eq per reaction site) was added and the reaction was run for another 30 min when LC-ESI-MS indicated the completion of the transglycosylation reaction. The product was purified using protein A chromatography to give 7 (270 ?g, 90%). ESI-MS: calculated for whole antibody, M=148535 Da; found (m/z), 148537 (deconvolution data); calculated for the Fc monomer after IdeS digestion, M=25470 Da; found (m/z), 25470 (deconvolution data).
[0298] Synthesis of cetuximab M6P-glycoform 9. A solution of the deglycosylated cetuximab (8) (2.1 mg) and the M6P tetrasaccharide oxazoline (1) (220 ?g, 20 eq per reaction site) was incubated with Endo S2-D184M (3.0 ?g) at 25? C. in 210 ?L of 150 mM PBS buffer (pH=7.2), and the reaction was monitored by LC-ESI-MS of the aliquots. The reaction was complete after 2 h and the product was purified using protein A chromatography to give 9 (1.9 mg, 90%). ESI-MS, calculated for the Fc monomer after IdeS digestion, M=24903 Da; found (m/z), 24904 (deconvolution data).
[0299] Synthesis of cetuximab M6P-glycoform 10. A solution of the deglycosylated cetuximab (8) (300 ?g) and the glycan oxazoline (5) (110 ?g, 20 eq per reaction site) was incubated with Endo S2-D184M (15 ?g) at 25? C. in 15 ?L of 150 mM PBS buffer (pH=7.2), and the reaction was monitored by LC-ESI-MS of the aliquots. After 1 h, another portion of oxazoline 5 (55 ?g, 10 eq per reaction site) was added and the mixture was incubated for another 30 min when LC-ESI-MS indicated the completion of the reaction. The product was purified using protein A chromatography to give 10 (270 ?g, 90%). ESI-MS: calculated for the Fc monomer after IdeS digestion, M=25470 Da; found (m/z), 25470 (deconvolution data).
[0300] Surface Plasmon Resonance (SPR) Measurements. SPR experiments were performed on a Biacore T200 instrument (GE Healthcare). Recombinant human IGF-II R (CI-MPR) was purchased from R&D Systems. Approximately 6000 resonance units (RU) of CI-MPR was immobilized on a CM5 sensor chip in a sodium acetate buffer (25 ?g/mL, pH 4.0) at 25? C., using the amine coupling kit provided by the manufacturer. M6P-modified antibodies were determined at 25? C. under a flow rate of 10 L/min. HBS-P+ buffer (10 mM HEPES, 150 mM NaCl, 0.05% surfactant P20, pH 7.4) was used as sample buffer and running buffer. Association was measured for 3 min and dissociation for 10 min at the same flow rate (10 ?L/min). The surface regeneration was performed by 2 M MgCl.sub.2 at a flow rate of 10 ?L/min for 60 s. Antibody analytes were flowed over an immobilized chip with 2-fold serial dilution of the highest concentration of 500 nM. Kinetic analyses were performed by global fitting of the binding data to a 1:1 Langmuir binding model using BIAcore T200 evaluation software.
[0301] Western blot. BT474 (ATCC? HTB-20?) or HepG2 (ATCC? HB-8065?) cells were treated with native or M6P-modified antibodies at a final concentration of 10 nM, whole-cell lysate in Laemmli sample buffer was subjected to SDS-PAGE and Western blotting. The primary antibodies used in this study were against EGFR (Cell signaling technology), HER2 (Cell signaling technology), and Beta-actin (Life technology). Horseradish peroxidase-conjugated anti-rabbit IgG was used in this study as the secondary antibody. The specific reactions were detected with chemiluminescence substrate, and the signal was recorded digitally using ChemiDoc MP Imaging System (Bio-Rad). Relative band intensity was calculated using ImageJ software (NIH).
[0302] Flow Cytometry. HER2 or EGFR expression on the target cell surface were examined by flow cytometry. BT474 or HepG2 cells were trypsinized, centrifuged for 5 min at 2000 rpm, then washed with PBS, cells were stained with PE conjugated anti-human CD340 (erbB2/HER2) antibody (BioLegend) or PE conjugated anti-human EGFR (BioLegend) or PE conjugated Isotype control antibody in PBS at 4 degree for 30 min. After staining, cells were washed with PBS, then fixed with 2.5% formalin, Flow cytometry was performed using FACSCanto II cell sorter (BD), data were analyzed using FlowJo software (BD).
[0303] The documents listed below and referenced herein are incorporated herein by reference in their entireties, except for any statements contradictory to the express disclosure herein, subject matter disclaimers or disavowals, and except to the extent that the incorporated material is inconsistent with the express disclosure herein, in which case the language in this disclosure controls. Incorporation by reference of the following shall not be considered an admission by the applicant that the incorporated materials are prior art to the present disclosure, nor shall any document be considered material to patentability of the present disclosure.
TABLE-US-00001 SequenceListings Aminoacidsequencesof: Endo-S2wildtype(SEQIDNO.1) Endo-Swildtype(SEQIDNO.4) Endo-F3wildtype(SEQIDNO.5) Endo-S2D184andmutants(D184M(SEQIDNO.10),D184E(SEQIDNO.8), D184C(SEQIDNO.7),D184G(SEQIDNO.9),D184A(SEQIDNO.6), D184N(SEQIDNO.11),D184Q(SEQIDNO.12),D184S(SEQIDNO.13), D184T(SEQIDNO.14)) Endo-SD233A(SEQIDNO.3),D233Q(SEQIDNO.2),D233M(SEQIDNO.15) mutants Endo-F3D165A(SEQIDNO.16)mutant Signalpeptideismarkedgray EndoS2(37-819) 102030405060 MDKHLLVKRTLGCVCAATLMGAALATHHDSLNTVKAEEKTVQTGKTDQQVGAKLVQEIRE 708090100110120 GKRGPLYAGYFRTWHDRASTGIDGKQQHPENTMAEVPKEVDILFVFHDHTASDSPFWSEL 130140150160170180 KDSYVHKLHQQGTALVQTIGVNELNGRTGLSKDYPDTPEGNKALAAAIVKAFVTDRGVDG 190200210220230240 LDIDIEHEFTNKRTPEEDARALNVFKEIAQLIGKNGSDKSKLLIMDTTLSVENNPIFKGI 250260270280290300 AEDLDYLLRQYYGSQGGEAEVDTINSDWNQYQNYIDASQFMIGESFFEESASKGNLWFDV 310320330340350360 NEYDPNNPEKGKDIEGTRAKKYAEWQPSTGGLKAGIFSYAIDRDGVAHVPSTYKNRTSTN 370380390400410420 LQRHEVDNISHTDYTVSRKLKTLMTEDKRYDVIDQKDIPDPALREQIIQQVGQYKGDLER 430440450460470480 YNKTLVLTGDKIQNLKGLEKLSKLQKLELRQLSNVKEITPELLPESMKKDAELVMVGMTG 490500510520530540 LEKLNLSGLNRQTLDGIDVNSITHLTSFDISHNSLDLSEKSEDRKLLMTLMEQVSNHQKI 550560570580590600 TVKNTAFENQKPKGYYPQTYDTKEGHYDVDNAEHDILTDFVFGTVTKRNTFIGDEEAFAI 610620630640650660 YKEGAVDGRQYVSKDYTYEAFRKDYKGYKVHLTASNLGETVTSKVTATTDETYLVDVSDG 670680690700710720 EKVVHHMKLNIGSGAIMMENLAKGAKVIGTSGDFEQAKKIFDGEKSDRFFTWGQTNWIAF 730740750760770780 DLGEINLAKEWRLFNAETNTEIKTDSSLNVAKGRLQILKDTTIDLEKMDIKNRKEYLSND 790800810820830840 ENWTDVAQMDDAKAIFNSKLSNVLSRYWRFCVDGG Endo-Ssequence:(37-995)(SEQIDNO.2) 102030405060 MDKHLLVKRTLGCVCAATLMGAALATHHDSLNTVKAEEKTVQVQKGLPSIDSLHYLSENS 708090100110120 KKEFKEELSKAGQESQKVKEILAKAQQADKQAQELAKMKIPEKIPMKPLHGPLYGGYFRT 130140150160170180 WHDKTSDPTEKDKVNSMGELPKEVDLAFIFHDWTKDYSLFWKELATKHVPKLNKQGTRVI 190200210220230240 RTIPWRFLAGGDNSGIAEDTSKYPNTPEGNKALAKAIVDEYVYKYNLDGLDVDVEHDSIP 250260270280290300 KVDKKEDTAGVERSIQVFEEIGKLIGPKGVDKSRLFIMDSTYMADKNPLIERGAPYINLL 310320330340350360 LVQVYGSQGEKGGWEPVSNRPEKTMEERWQGYSKYIRPEQYMIGFSFYEENAQEGNLWYD 370380390400410420 INSRKDEDKANGINTDITGTRAERYARWQPKTGGVKGGIFSYAIDRDGVAHQPKKYAKQK 430440450460470480 EFKDATDNIFHSDYSVSKALKTVMLKDKSYDLIDEKDFPDKALREAVMAQVGTRKGDLER 490500510520530540 FNGTLRLDNPAIQSLEGLNKFKKLAQLDLIGLSRITKLDRSVLPANMKPGKDTLETVLET 550560570580590600 YKKDNKEEPATIPPVSLKVSGLTGLKELDLSGFDRETLAGLDAATLTSLEKVDISGNKLD 610620630640650660 LAPGTENRQIFDTMLSTISNHVGSNEQTVKFDKQKPTGHYPDTYGKTSLRLPVANEKVDL 670680690700710720 QSQLLFGTVTNQGTLINSEADYKAYQNHKIAGRSFVDSNYHYNNFKVSYENYTVKVTDST 730740750760770780 LGTTTDKTLATDKEETYKVDFFSPADKTKAVHTAKVIVGDEKTMMVNLAEGATVIGGSAD 790800810820830840 PVNARKVFDGQLGSETDNISLGWDSKQSIIFKLKEDGLIKHWRFFNDSARNPETTNKPIQ 850860870880890900 EASLQIFNIKDYNLDNLLENPNKFDDEKYWITVDTYSAQGERATAFSNTLNNITSKYWRV 910920930940950960 VFDTKGDRYSSPVVPELQILGYPLPNADTIMKTVTTAKELSQQKDKFSQKMLDELKIKEM 970980990 ALETSLNSKIFDVTAINANAGVLKDCIEKRQLLKK Endo-F3sequence:(40-329)(SEQIDNO.5) 102030405060 MKKIFFAQCSILLLMLGSCSKMTEDMTPESVNKEASVKSATALAGSNGVCIAYYITDGRN 708090100110120 PTFKLKDIPDKVDMVILFGLKYWSLQDTTKLPGGTGMMGSFKSYKDLDTQIRSLQSRGIK 130140150160170180 VLQNIDDDVSWQSSKPGGFASAAAYGDAIKSIVIDKWKLDGISLDIEHSGAKPNPIPTFP 190200210220230240 GYAATGYNGWYSGSMAATPAFLNVISELTKYFGTTAPNNKQLQIASGIDVYAWNKIMENF 250260270280290300 RNNFNYIQLQSYGANVSRTQLMMNYATGTNKIPASKMVFGAYAEGGTNQANDVEVAKWTP 310320 TQGAKGGMMIYTYNSNVSYANAVRDAVKN EndoS2Mutantsequences(SEQIDNO.6):D184A(X=A);D184C(X=C); D184E(X=E);D184G(X=G);D184M(X=M);D184N(X=N); D184Q(X=Q)D184S(X=S);D184T(X=T) 102030405060 MDKHLLVKRTLGCVCAATLMGAALATHHDSLNTVKAEEKTVQTGKTDQQVGAKLVQEIRE 708090100110120 GKRGPLYAGYFRTWHDRASTGIDGKQQHPENTMAEVPKEVDILFVFHDHTASDSPEWSEL 130140150160170180 KDSYVHKLHQQGTALVQTIGVNELNGRTGLSKDYPDTPEGNKALAAAIVKAFVTDRGVDG 190200210220230240 LDIXIEHEFTNKRTPEEDARALNVEKEIAQLIGKNGSDKSKLLIMDTTLSVENNPIEKGI 250260270280290300 AEDLDYLLRQYYGSQGGEAEVDTINSDWNQYQNYIDASQFMIGFSFFEESASKGNLWFDV 310320330340350360 NEYDPNNPEKGKDIEGTRAKKYAEWQPSTGGLKAGIFSYAIDRDGVAHVPSTYKNRTSTN 370380390400410420 LQRHEVDNISHTDYTVSRKLKTLMTEDKRYDVIDQKDIPDPALREQIIQQVGQYKGDLER 430440450460470480 YNKTLVLTGDKIQNLKGLEKLSKLQKLELRQLSNVKEITPELLPESMKKDAELVMVGMTG 490500510520530540 LEKLNLSGLNRQTLDGIDVNSITHLTSFDISHNSLDLSEKSEDRKLLMTLMEQVSNHQKI 550560570580590600 TVKNTAFENQKPKGYYPQTYDTKEGHYDVDNAEHDILTDFVFGTVTKRNTFIGDEEAFAI 610620630640650660 YKEGAVDGRQYVSKDYTYEAFRKDYKGYKVHLTASNLGETVTSKVTATTDETYLVDVSDG 670680690700710720 EKVVHHMKLNIGSGAIMMENLAKGAKVIGTSGDFEQAKKIFDGEKSDRFFTWGQTNWIAF 730740750760770780 DLGEINLAKEWRLFNAETNTEIKTDSSLNVAKGRLQILKDTTIDLEKMDIKNRKEYLSND 790800810820830840 ENWTDVAQMDDAKAIFNSKLSNVLSRYWRFCVDGGASSY Endo-SMutantsequence:D233A(X=A);D233Q(X=Q);D233M(X=M) 102030405060 MDKHLLVKRTLGCVCAATLMGAALATHHDSLNTVKAEEKTVQVQKGLPSIDSLHYLSENS 708090100110120 KKEFKEELSKAGQESQKVKEILAKAQQADKQAQELAKMKIPEKIPMKPLHGPLYGGYFRT 130140150160170180 WHDKTSDPTEKDKVNSMGELPKEVDLAFIFHDWTKDYSLFWKELATKHVPKLNKQGTRVI 190200210220230240 RTIPWRFLAGGDNSGIAEDTSKYPNTPEGNKALAKAIVDEYVYKYNLDGLDVXVEHDSIP 250260270280290300 KVDKKEDTAGVERSIQVFEEIGKLIGPKGVDKSRLFIMDSTYMADKNPLIERGAPYINLL 310320330340350360 LVQVYGSQGEKGGWEPVSNRPEKTMEERWQGYSKYIRPEQYMIGFSFYEENAQEGNLWYD 370380390400410420 INSRKDEDKANGINTDITGTRAERYARWQPKTGGVKGGIFSYAIDRDGVAHQPKKYAKQK 430440450460470480 EFKDATDNIFHSDYSVSKALKTVMLKDKSYDLIDEKDFPDKALREAVMAQVGTRKGDLER 490500510520530540 FNGTLRLDNPAIQSLEGLNKFKKLAQLDLIGLSRITKLDRSVLPANMKPGKDTLETVLET 550560570580590600 YKKDNKEEPATIPPVSLKVSGLTGLKELDLSGFDRETLAGLDAATLTSLEKVDISGNKLD 610620630640650660 LAPGTENRQIFDTMLSTISNHVGSNEQTVKFDKQKPTGHYPDTYGKTSLRLPVANEKVDL 670680690700710720 QSQLLFGTVTNQGTLINSEADYKAYQNHKIAGRSFVDSNYHYNNFKVSYENYTVKVTDST 730740750760770780 LGTTTDKTLATDKEETYKVDFFSPADKTKAVHTAKVIVGDEKTMMVNLAEGATVIGGSAD 790800810820830840 PVNARKVFDGQLGSETDNISLGWDSKQSIIFKLKEDGLIKHWRFFNDSARNPETTNKPIQ 850860870880890900 EASLQIFNIKDYNLDNLLENPNKFDDEKYWITVDTYSAQGERATAFSNTLNNITSKYWRV 910920930940950960 VFDTKGDRYSSPVVPELQILGYPLPNADTIMKTVTTAKELSQQKDKFSQKMLDELKIKEM 970980990 ALETSLNSKIFDVTAINANAGVLKDCIEKRQLLKK Endo-F3mutantsequence:Endo-F3D165A 102030405060 MKKIFFAQCSILLLMLGSCSKMTEDMTPESVNKEASVKSATALAGSNGVCIAYYITDGRN 708090100110120 PTFKLKDIPDKVDMVILFGLKYWSLQDTTKLPGGTGMMGSFKSYKDLDTQIRSLQSRGIK 130140150160170180 VLQNIDDDVSWQSSKPGGFASAAAYGDAIKSIVIDKWKLDGISLAIEHSGAKPNPIPTFP 190200210220230240 GYAATGYNGWYSGSMAATPAFLNVISELTKYFGTTAPNNKQLQIASGIDVYAWNKIMENF 250260270280290300 RNNFNYIQLQSYGANVSRTQLMMNYATGTNKIPASKMVFGAYAEGGTNQANDVEVAKWTP 310320 TQGAKGGMMIYTYNSNVSYANAVRDAVKN