MODULATORS OF SORTILIN ACTIVITY

20240294569 ยท 2024-09-05

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention relates to compounds of formula (I), which are modulators of sortilin activity. The invention also relates to pharmaceutical compositions comprising these compounds and to the use of these compounds in the treatment or prevention of medical conditions where modulation of sortilin activity is beneficial.

    Claims

    1. A compound of formula (I) ##STR00084## or a pharmaceutically acceptable salt, solvate, hydrate, tautomer, optical isomer, N-oxide, and/or prodrug thereof; wherein R.sup.1, R.sup.2 and R.sup.3 are each independently selected from the group consisting of halo, H, (C.sub.1-C.sub.4)alkyl, halo-(C.sub.1-C.sub.4)alkyl, (C.sub.2-C.sub.4)alkenyl, and halo-(C.sub.2-C.sub.4)alkenyl; R.sup.4 is selected from the group consisting of H, (C.sub.1-C.sub.10)alkyl, halo-(C.sub.1-C.sub.10)alkyl, (C.sub.2-C.sub.10)alkenyl, halo-(C.sub.2-C.sub.10)alkenyl, (C.sub.3-C.sub.8)aryl, halo-(C.sub.3-C.sub.8)aryl, (C.sub.3-C.sub.8)heteroaryl, halo-(C.sub.3-C.sub.8)heteroaryl, (C.sub.1-C.sub.6)-alkylene-(C.sub.3-C.sub.20)-aryl, (C.sub.1-C.sub.6)-alkylene-(C.sub.3-C.sub.20)-heteroaryl, (C.sub.1-C.sub.6)-alkylene-(3- to 10-membered-heterocyclic ring); wherein the aryl group in (C.sub.1-C.sub.6)-alkylene-(C.sub.3-C.sub.20)-aryl, the heteroaryl group in (C.sub.1-C.sub.6)-alkylene-(C.sub.3-C.sub.20)-heteroaryl or the heterocyclic ring in (C.sub.1-C.sub.6)-alkylene-(3- to 10-membered heterocyclic ring) is optionally substituted with one or more substituents independently selected from halo, H, OH, (C.sub.1-C.sub.4)alkyl, halo-(C.sub.1-C.sub.4)alkyl, (C.sub.1-C.sub.4)alkoxy and halo-(C.sub.1-C.sub.4)alkoxy; R.sup.5 is selected from the group consisting of H, (C.sub.1-C.sub.10)alkyl, and (C.sub.2-C.sub.10)alkenyl; wherein the alkyl and alkenyl groups are optionally substituted with halo, an amide group and phenol; and R.sup.6 is selected from the group consisting of (C.sub.1-C.sub.10)alkyl, halo-(C.sub.1-C.sub.10)alkyl, (C.sub.2-C.sub.10)alkenyl, halo-(C.sub.2-C.sub.10)alkenyl and 3- to 10-membered-heterocyclic ring; wherein the heterocyclic ring is optionally substituted with one or more substituents independently selected from halo, OH, (C.sub.1-C.sub.4)alkyl, halo-(C.sub.1-C.sub.10)alkyl, acetyl, (C.sub.1-C.sub.4)alkoxy, and halo-(C.sub.1-C.sub.4)alkoxy.

    2. The compound according to claim 1, wherein R.sup.1, R.sup.2 and R.sup.3 are each independently selected from the group consisting of halo, (C.sub.1-C.sub.2)alkyl and halo-(C.sub.1-C.sub.2)alkyl.

    3. The compound according to claim 1, wherein R.sup.1, R.sup.2 and R.sup.3 are each independently selected from F, CH.sub.3 and CF.sub.3.

    4. The compound according to claim 1, wherein R.sup.4 is selected from the group consisting of H, (C.sub.1-C.sub.6)alkyl, halo-(C.sub.1-C.sub.6)alkyl, (C.sub.3-C.sub.8)aryl, (C.sub.1-C.sub.3)-alkylene-(C.sub.3-C.sub.10)-aryl, (C.sub.1-C.sub.3)-alkylene-(C.sub.3-C.sub.10)-heteroaryl and (C.sub.1-C.sub.3)-alkylene-(3- to 10-membered-heterocyclic ring); wherein the aryl group in (C.sub.1-C.sub.3)-alkylene-(C.sub.3-C.sub.10)-aryl, the heteroaryl group in (C.sub.1-C.sub.3)-alkylene-(C.sub.3-C.sub.10)-heteroaryl or the heterocyclic ring in (C.sub.1-C.sub.3)-alkylene-(3- to 10-membered heterocyclic ring) is optionally substituted with one or more substituents independently selected from halo, H, OH, (C.sub.1-C.sub.3)alkyl, halo-(C.sub.1-C.sub.3)alkyl, (C.sub.1-C.sub.3)alkoxy and halo-(C.sub.1-C.sub.3)alkoxy.

    5. The compound according to claim 1, wherein R.sup.4 is selected from the group consisting of: ##STR00085## ##STR00086##

    6. The compound according to claim 1, wherein R.sup.5 is selected from the group consisting of H and (C.sub.1-C.sub.4)alkyl; wherein the alkyl group is optionally substituted with halo, an amide group and phenol.

    7. The compound according to claim 1, wherein R.sup.5 is selected from the group consisting of: ##STR00087##

    8. The compound according to claim 1, wherein R.sup.6 is selected from the group consisting of (C.sub.1-C.sub.3)alkyl, halo-(C.sub.1-C.sub.3)alkyl, and 3- to 8-membered-heterocyclic ring; wherein the heterocyclic ring is optionally substituted with one or more substituents independently selected from halo, OH, (C.sub.1-C.sub.4)alkyl and acetyl.

    9. The compound according to claim 1, wherein R.sup.6 is selected from the group consisting of: ##STR00088## ##STR00089##

    10. The compound according to claim 1, wherein the compound of Formula (I) is: (2S)-2-[(2S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-(1-methyl-1H-imidazol-4-yl)propanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-(1,3-thiazol-4-yl)propanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S)-2-[(2S)-4-carbamoyl-2-{[(2S)-pyrrolidin-2-yl]formamido}butanamido]-3-(1,3-thiazol-4-yl)propanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-(1H-indol-3-yl)propanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2R)-morpholin-2-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-(1-methyl-1H-imidazol-5-yl)propanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2R)-pyrrolidin-2-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S)-2-[(2S)-3-carbamoyl-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-(1,3-thiazol-4-yl)propanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-(morpholin-4-yl)propanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-(pyridin-2-yl)propanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S,3S)-2-[(2S)-2-acetamido-3-(4-hydroxyphenyl)propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2R)-oxolan-2-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-oxolan-2-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S,3S)-2-[(2S)-2-{[(2R)-4-acetylmorpholin-2-yl]formamido}-3-(4-hydroxyphenyl)propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(3S)-morpholin-3-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(3R)-morpholin-3-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-morpholin-2-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-(pyridin-4-yl)propanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-(pyridin-3-yl)propanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-(thiophen-3-yl)propanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(3R)-pyrrolidin-3-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(3S)-pyrrolidin-3-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-piperazin-2-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2R)-piperazin-2-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; (2S)-5,5-dimethyl-2-[(2S,3S)-3-methyl-2-[(2S)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]pentanamido]hexanoic acid; (2S)-5,5-dimethyl-2-[(2S,3S)-3-methyl-2-(2-{[(2S)-pyrrolidin-2-yl]formamido}acetamido)pentanamido]hexanoic acid; (2S)-5,5-dimethyl-2-[(2S,3S)-3-methyl-2-[(2S)-3-methyl-2-{[(2S)-pyrrolidin-2-yl]formamido}butanamido]pentanamido]hexanoic acid; (2S)-5,5,5-trifluoro-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2R)-oxolan-2-yl]formamido}propanamido]-3-methylpentanamido]pentanoic acid; (2S)-5,5,5-trifluoro-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-oxolan-2-yl]formamido}propanamido]-3-methylpentanamido]pentanoic acid; (2S)-2-[(2S,3S)-2-[(2S)-2-acetamido-3-(4-hydroxyphenyl)propanamido]-3-methylpentanamido]-5,5,5-trifluoropentanoic acid; and (2S)-2-[(2S,3S)-2-[(2S)-2-{[(2R)-4-acetylmorpholin-2-yl]formamido}-3-(4-hydroxyphenyl)propanamido]-3-methylpentanamido]-5,5,5-trifluoropentanoic acid.

    11. A pharmaceutical composition comprising a compound according to claim 1 and a pharmaceutically acceptable carrier, excipient, and/or diluent.

    12. A method of treating a patient having a disease, comprising administering a compound according to claim 1.

    13. The method of claim 12, wherein the disease is a neurodegenerative disorder, an inflammatory disorder, a cancer, pain, diabetes mellitus, diabetic retinopathy, glaucoma, uveitis, cardiovascular disease, hereditary eye conditions or hearing loss.

    14. The method of claim 12, wherein the neurodegenerative disorder is selected from frontotemporal dementia, Alzheimer's disease, Parkinson's disease and spinal cord injury; wherein the inflammatory disorder may be selected from inflammatory diseases and neuroinflammation; wherein the cancer is selected from breast cancer, lung cancer, ovarian cancer, prostate cancer, thyroid cancer, pancreatic cancer, glioblastoma and colorectal cancer; and wherein the hearing loss is selected from noise-induced hearing loss, ototoxicity induced hearing loss, age-induced hearing loss, idiopathic hearing loss, tinnitus and sudden hearing loss.

    Description

    DESCRIPTION OF THE FIGURES

    [0007] FIG. 1 depicts two X-Ray derived pictures a) and b) of the compound of Example 12 bound to h-Sortilin.

    DISCLOSURE OF THE INVENTION

    [0008] In a first aspect, the present invention provides a compound of formula (I)

    ##STR00001##

    or a pharmaceutically acceptable salt, solvate, hydrate, tautomer, optical isomer, N-oxide, and/or prodrug thereof; wherein [0009] R.sup.1, R.sup.2 and R.sup.3 are each independently selected from the group consisting of halo, H, (C.sub.1-C.sub.4)alkyl, halo-(C.sub.1-C.sub.4)alkyl, (C.sub.2-C.sub.4)alkenyl, and halo-(C.sub.2-C.sub.4)alkenyl; [0010] R.sup.4 is selected from the group consisting of H, (C.sub.1-C.sub.10)alkyl, halo-(C.sub.1-C.sub.10)alkyl, (C.sub.2-C.sub.10)alkenyl, halo-(C.sub.2-C.sub.10)alkenyl, (C.sub.3-C.sub.8)aryl, halo-(C.sub.3-C.sub.8)aryl, (C.sub.3-C.sub.8)heteroaryl, halo-(C.sub.3-C.sub.8)heteroaryl, (C.sub.1-C.sub.6)-alkylene-(C.sub.3-C.sub.20)-aryl, (C.sub.1-C.sub.6)-alkylene-(C.sub.3-C.sub.20)-heteroaryl, (C.sub.1-C.sub.6)-alkylene-(3- to 10-membered-heterocyclic ring); [0011] wherein the aryl group in (C.sub.1-C.sub.6)-alkylene-(C.sub.3-C.sub.20)-aryl, the heteroaryl group in (C.sub.1-C.sub.6)-alkylene-(C.sub.3-C.sub.20)-heteroaryl or the heterocyclic ring in (C.sub.1-C.sub.6)-alkylene-(3- to 8-membered heterocyclic ring) is optionally substituted with one or more substituents independently selected from halo, H, OH, (C.sub.1-C.sub.4)alkyl, halo-(C.sub.1-C.sub.4)alkyl, (C.sub.1-C.sub.4)alkoxy and halo-(C.sub.1-C.sub.4)alkoxy; [0012] R.sup.5 is selected from the group consisting of H, (C.sub.1-C.sub.10)alkyl, and (C.sub.2-C.sub.10)alkenyl; [0013] wherein the alkyl and alkenyl groups are optionally substituted with halo, an amide group and phenol; and [0014] R.sup.6 is selected from the group consisting of (C.sub.1-C.sub.10)alkyl, halo-(C.sub.1-C.sub.10)alkyl, (C.sub.2-C.sub.10)alkenyl, halo-(C.sub.2-C.sub.10)alkenyl and 3- to 10-membered-heterocyclic ring; [0015] wherein the heterocyclic ring is optionally substituted with one or more substituents independently selected from halo, OH, (C.sub.1-C.sub.4)alkyl, halo-(C.sub.1-C.sub.10)alkyl, acetyl, (C.sub.1-C.sub.4)alkoxy, and halo-(C.sub.1-C.sub.4)alkoxy.

    [0016] It has been found that compounds of formula (I) inhibit or antagonise sortilin and therefore may be useful in conditions where sortilin inhibition is beneficial. Such conditions include a neurodegenerative disorder, an inflammatory disorder, a cancer, pain, diabetes mellitus, diabetic retinopathy, glaucoma, uveitis, cardiovascular disease, hereditary eye conditions or hearing loss. The neurodegenerative disorder may be selected from frontotemporal dementia, Alzheimer's disease, Parkinson's disease and spinal cord injury; the inflammatory disorder may be selected from inflammatory diseases and neuroinflammation; the cancer may be selected from breast cancer, lung cancer, ovarian cancer, prostate cancer, thyroid cancer, pancreatic cancer, glioblastoma and colorectal cancer; and the hearing loss may be selected from noise-induced hearing loss, ototoxicity induced hearing loss, age-induced hearing loss, idiopathic hearing loss, tinnitus and sudden hearing loss.

    [0017] As used herein, the term sortilin may refer to full length sortilin (also referred to as immature sortilin), comprising a signal peptide, a propeptide, a Vps10p domain, a 10 CC domain, a transmembrane domain and a large cytoplasmic tail, having an amino acid sequence according to SEQ ID NO: 1 or SEQ ID NO: 2, or it may refer to mature sortilin, comprising a Vps10p domain, a 10 CC domain, a transmembrane domain and a large cytoplasmic tail, having an amino acid sequence according to SEQ ID NO: 3, or a naturally occurring fragment, homologue or variant thereof. The term sortilin or sortilin molecule are used interchangeably herein. It is understood that sortilin is capable of interacting with a pro-neurotrophin molecule to form a sortilin/pro-neurotrophin complex. This sortilin/pro-neurotrophin complex may or may not be capable of interacting with a p75NTR molecule to form a trimeric complex comprising sortilin, pro-neurotrophin and p75NTR. It is understood that this trimeric complex may be responsible for adverse biological responses, such as stimulating apoptosis in retinal and ganglion cells, and controlling growth cone retraction of projecting axons..sup.5, 7, 15, 16

    [0018] As used herein, the term pro-neurotrophin refers to the larger precursors of neurotrophins, which undergo proteolytic cleavage to yield the mature form of the neurotrophin. Neurotrophins are a family of proteins that induce the survival, development and function of neurons, and are commonly referred to as growth factors. Pro-neurotrophins are biologically active and have distinct roles compared to their neurotrophin counterparts, such as induction of apoptosis. Examples of pro-neurotrophins include proNGF, proBDNF, proNT3 and proNT4. Pro-neurotrophins may also control synaptic plasticity. Whereas mature neurotrophins induce synaptic strength, in their proforms they may weaken synapses,

    [0019] The compounds of the invention may be sortilin inhibitors or antagonists. As used herein, the term sortilin antagonist refers to a substance that interferes with, blocks, or otherwise attenuates the effect of, a sortilin protein binding to a pro-neurotrophin (e.g., proNGF, proNT3, proBDNF) and preventing the formation of the trimeric complex between sortilin, p75NTR and the pro-neurotrophin. The term sortilin antagonist also includes a substance or agent that interferes with the formation of a high affinity trimeric complex. In the latter scenario, it is recognised that a trimeric complex may be formed in that sortilin can bind to p75NTR (but not proNGF) and p75NTR can simultaneously bind the NGF domain of proNGF. However, the resulting trimeric complex may be of lower affinity for its receptor and as a result have significantly reduced capacity to stimulate apoptosis via the mechanism described above. Skeldal et al (J. Biol. Chem. 2012 Dec. 21; 287(52):43798-809)17 demonstrated that the apoptotic function of the trimeric complex is abolished when sortilin is devoid in its intracellular domain. The term sortilin antagonist also includes a substance or agent that interferes with, blocks, or otherwise attenuates the effect of, a sortilin protein interacting with p75NTR. This interaction may be completely prevented, in which case the trimeric complex is prevented from forming, or only partially prevented, in which case the trimeric complex may be formed but may have reduced biological potency.

    [0020] Skeldal et al showed that complex formation between sortilin and p75NTR relies on contact points in the extracellular domains of the receptors and that the interaction critically depends on an extracellular juxtamembrane 23-amino acid sequence of p75NTR. Thus, the sortilin antagonist may interfere with this 23-amino acid sequence or proximal sequences in the molecules.

    [0021] It is preferred that R.sup.1, R.sup.2 and R.sup.3 are each independently selected from the group consisting of halo, (C.sub.1-C.sub.2)alkyl and halo-(C.sub.1-C.sub.2)alkyl.

    [0022] In a preferred aspect of the invention, R.sup.1, R.sup.2 and R.sup.3 are each independently selected from F, CH.sub.3 and CF.sub.3. Most preferably, R.sup.1, R.sup.2 and R.sup.3 are the same. For example, in an exemplary compound of the invention, R.sup.1, R.sup.2 and R.sup.3 may each be F, CH.sub.3 or CF.sub.3.

    [0023] In another preferred aspect of the invention, R.sup.4 is selected from the group consisting of H, (C.sub.1-C.sub.6)alkyl, halo-(C.sub.1-C.sub.6)alkyl, (C.sub.3-C.sub.10)aryl, (C.sub.1-C.sub.3)-alkylene-(C.sub.3-C.sub.10)-aryl, (C.sub.1-C.sub.3)-alkylene-(C.sub.3-C.sub.10)-heteroaryl and (C.sub.1-C.sub.3)-alkylene-(3- to 10-membered-heterocyclic ring). The aryl group in (C.sub.1-C.sub.3)-alkylene-(C.sub.3-C.sub.10)-aryl, the heteroaryl group in (C.sub.1-C.sub.3)-alkylene-(C.sub.3-C.sub.10)-heteroaryl or the heterocyclic ring in (C.sub.1-C.sub.3)-alkylene-(3- to 10-membered heterocyclic ring) is optionally substituted with one or more substituents independently selected from halo, H, OH, (C.sub.1-C.sub.3)alkyl, halo-(C.sub.1-C.sub.3)alkyl, (C.sub.1-C.sub.3)alkoxy and halo-(C.sub.1-C.sub.3)alkoxy.

    [0024] The alkyl, haloalkyl, alkenyl, haloalkenyl groups and the alkyl, haloalkyl, alkoxy and haloalkoxy substituents may be linear or branched.

    [0025] The substituent may be attached at any position of the aryl, heteroaryl or heterocyclic ring. The one or more substituents may be attached to a carbon atom, heteroatom or combinations thereof. Preferably, there are no substituents or between one to three substituents.

    [0026] The heteroaryl or heterocyclic ring may comprise one, two or more heteroatoms. Preferably, the heteroaryl or heterocyclic ring comprises one or two heteroatoms. The heteroatom may be selected from N, S or O. In groups with more than one heteroatom present, the heteroatoms may be the same or they may be different.

    [0027] The heterocyclic ring may be aliphatic. It may be monocyclic, bicyclic or tricyclic. Preferably, the heterocyclic ring is monocyclic or bicyclic. Preferably, the heterocyclic ring has between 5-10 members, more preferably between 5-9 members.

    [0028] The aryl and heteroaryl groups may also be monocyclic, bicyclic or tricyclic. Preferably, monocyclic or bicyclic. Preferably, the aryl and heteroaryl groups have a ring size of between 5-10 members, more preferably between 5-9 members.

    [0029] In some preferred embodiments, R.sup.4 is selected from the group consisting of:

    ##STR00002## ##STR00003##

    [0030] The chirality of the carbon of formula (I) attached to R.sup.4 is either (R) or (S). Preferably, when groups (ii)-(xii) are included in formula (I), the chirality of this carbon is (S); and when group (i) is included in formula (I), the chirality of this carbon is (S) or (R).

    [0031] In another preferred aspect of the invention, R.sup.5 is selected from the group consisting of H and (C.sub.1-C.sub.4)alkyl. The alkyl group is optionally substituted with halo, an amide group and phenol.

    [0032] Preferably, R.sup.5 is selected from the group consisting of:

    ##STR00004##

    [0033] In another preferred aspect of the invention, R.sup.6 is selected from the group consisting of (C.sub.1-C.sub.3)alkyl, halo-(C.sub.1-C.sub.3)alkyl, and 3- to 8-membered-heterocyclic ring). The heterocyclic ring is optionally substituted with one or more substituents independently selected from halo, OH, (C.sub.1-C.sub.4)alkyl and acetyl.

    [0034] Most preferably, R.sup.6 is selected from the group consisting of R.sup.6 is selected from the group consisting of:

    ##STR00005## ##STR00006##

    [0035] Particular compounds of the invention are those listed below. [0036] (2S)-2-[(2S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-(1-methyl-1H-imidazol-4-yl)propanamido]-5,5-dimethylhexanoic acid; [0037] (2S)-2-[(2S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-(1,3-thiazol-4-yl)propanamido]-5,5-dimethylhexanoic acid; [0038] (2S)-2-[(2S)-2-[(2S)-4-carbamoyl-2-{[(2S)-pyrrolidin-2-yl]formamido}butanamido]-3-(1,3-thiazol-4-yl)propanamido]-5,5-dimethylhexanoic acid; [0039] (2S)-2-[(2S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-(1H-indol-3-yl)propanamido]-5,5-dimethylhexanoic acid; [0040] (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; [0041] (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2R)-morpholin-2-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; [0042] (2S)-2-[(2S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-(1-methyl-1H-imidazol-5-yl)propanamido]-5,5-dimethylhexanoic acid; [0043] (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2R)-pyrrolidin-2-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; [0044] (2S)-2-[(2S)-2-[(2S)-3-carbamoyl-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-(1,3-thiazol-4-yl)propanamido]-5,5-dimethylhexanoic acid; [0045] (2S)-2-[(2S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-(morpholin-4-yl)propanamido]-5,5-dimethylhexanoic acid; [0046] (2S)-2-[(2S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-(pyridin-2-yl)propanamido]-5,5-dimethylhexanoic acid; [0047] (2S)-2-[(2S,3S)-2-[(2S)-2-acetamido-3-(4-hydroxyphenyl)propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; [0048] (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2R)-oxolan-2-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; [0049] (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-oxolan-2-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; [0050] (2S)-2-[(2S,3S)-2-[(2S)-2-{[(2R)-4-acetylmorpholin-2-yl]formamido}-3-(4-hydroxyphenyl)propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; [0051] (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(3S)-morpholin-3-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; [0052] (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(3R)-morpholin-3-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; [0053] (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-morpholin-2-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; [0054] (2S)-2-[(2S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-(pyridin-4-yl)propanamido]-5,5-dimethylhexanoic acid; [0055] (2S)-2-[(2S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-(pyridin-3-yl)propanamido]-5,5-dimethylhexanoic acid; [0056] (2S)-2-[(2S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]-3-(thiophen-3-yl)propanamido]-5,5-dimethylhexanoic acid; [0057] (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(3R)-pyrrolidin-3-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; [0058] (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(3S)-pyrrolidin-3-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; [0059] (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-piperazin-2-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; [0060] (2S)-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2R)-piperazin-2-yl]formamido}propanamido]-3-methylpentanamido]-5,5-dimethylhexanoic acid; [0061] (2S)-5,5-dimethyl-2-[(2S,3S)-3-methyl-2-[(2S)-2-{[(2S)-pyrrolidin-2-yl]formamido}propanamido]pentanamido]hexanoic acid; [0062] (2S)-5,5-dimethyl-2-[(2S,3S)-3-methyl-2-(2-{[(2S)-pyrrolidin-2-yl]formamido}acetamido)pentanamido]hexanoic acid; [0063] (2S)-5,5-dimethyl-2-[(2S,3S)-3-methyl-2-[(2S)-3-methyl-2-{[(2S)-pyrrolidin-2-yl]formamido}butanamido]pentanamido]hexanoic acid; [0064] (2S)-5,5,5-trifluoro-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2R)-oxolan-2-yl]formamido}propanamido]-3-methylpentanamido]pentanoic acid; [0065] (2S)-5,5,5-trifluoro-2-[(2S,3S)-2-[(2S)-3-(4-hydroxyphenyl)-2-{[(2S)-oxolan-2-yl]formamido}propanamido]-3-methylpentanamido]pentanoic acid; [0066] (2S)-2-[(2S,3S)-2-[(2S)-2-acetamido-3-(4-hydroxyphenyl)propanamido]-3-methylpentanamido]-5,5,5-trifluoropentanoic acid; and [0067] (2S)-2-[(2S,3S)-2-[(2S)-2-{[(2R)-4-acetylmorpholin-2-yl]formamido}-3-(4-hydroxyphenyl)propanamido]-3-methylpentanamido]-5,5,5-trifluoropentanoic acid;

    [0068] The compounds of formula (I) of the invention are intended for use in the treatment or prevention of a neurodegenerative disorder, an inflammatory disorder, a cancer, pain, diabetes mellitus, diabetic retinopathy, glaucoma, uveitis, cardiovascular disease, hereditary eye conditions or hearing loss.

    [0069] Preferably the neurodegenerative disorder is selected from frontotemporal dementia, Alzheimer's disease, Parkinson's disease and spinal cord injury.

    [0070] Preferably the inflammatory disorder may be selected from inflammatory diseases and neuroinflammation;

    [0071] Preferably the cancer is selected from breast cancer, lung cancer, ovarian cancer, prostate cancer, thyroid cancer, pancreatic cancer, glioblastoma and colorectal cancer.

    [0072] Preferably the hearing loss is selected from noise-induced hearing loss, ototoxicity induced hearing loss, age-induced hearing loss, idiopathic hearing loss, tinnitus and sudden hearing loss.

    [0073] Thus, in an embodiment, the compounds for use according to the invention may disrupt interaction between a sortilin molecule and a pro-neurotrophin molecule, or disrupt the interaction between a sortilin molecule and a p75NTR molecule. Said sortilin molecule may be mature sortilin.

    [0074] Preferably, the compounds of the present invention are sortilin inhibitors. As used herein, the term sortilin inhibitor refers to a compound that binds to a sortilin protein, thereby preventing it from binding to a pro-neurotrophin or a p75NTR molecule and preventing the formation of the aforementioned trimeric complex, or resulting in the formation of a trimeric complex that is less active or inactive.

    [0075] Preferably, the compounds of the present invention prevent the protein-protein interaction between a sortilin molecule and a pro-neurotrophin or a p75NTR molecule, further preventing the formation of the apoptotic trimeric complex usually formed between sortilin, pro-neurotrophin and the p75NTR receptor, or resulting in the formation of a low affinity trimeric complex, which is biologically less active or inactive or has minimal activity.

    [0076] Thus, the compound may bind to sortilin, a pro-neutrophin or a p75NTR molecule. The antagonistic action may be due to direct blocking of protein-protein interaction or it could be by steric hindrance when bound at a site of one of these proteins apart from the binding site.

    [0077] According to a second aspect of the invention, there is provided a pharmaceutical composition comprising a compound according to the first aspect of the invention and one or more pharmaceutically acceptable carriers, excipients, and/or diluents.

    [0078] In a third aspect of the invention, there is provided a compound according to the first aspect of the invention, or a pharmaceutical composition according to the second aspect of the invention for use in therapy.

    [0079] According to a fourth aspect of the invention, there is provided a compound according to the first aspect of the invention, or a pharmaceutical composition according to the second aspect of the invention for use in the treatment or prevention of a neurodegenerative disorder, an inflammatory disorder, a cancer, pain, diabetes mellitus, diabetic retinopathy, glaucoma, uveitis, cardiovascular disease, hereditary eye conditions or hearing loss.

    [0080] Preferably, the neurodegenerative disorder is selected from frontotemporal dementia, Alzheimer's disease, Parkinson's disease and spinal cord injury.

    [0081] Preferably, the hearing loss is selected from noise-induced hearing loss, ototoxicity induced hearing loss, age-induced hearing loss, idiopathic hearing loss, tinnitus and sudden hearing loss.

    [0082] Preferably, the cancer is selected from breast cancer, lung cancer, ovarian cancer, prostate cancer, thyroid cancer, pancreatic cancer, glioblastoma, and colorectal cancer.

    [0083] Preferably the cardiovascular disease is selected from atherosclerosis, cardiomyopathy, heard attack, arrhythmias, and coronary artery disease.

    [0084] According to a fifth aspect of the invention, there is provided the use of the compound according to the first aspect of the invention for the manufacture of a medicament for the treatment or prevention of a neurodegenerative disorder, an inflammatory disorder, a cancer, pain, diabetes mellitus, diabetic retinopathy, glaucoma, uveitis, cardiovascular disease, hereditary eye conditions or hearing loss.

    [0085] According to a sixth aspect of the invention, there is provided a method for the treatment or prevention of a disease or condition responsive to sortilin modulation comprising administering a therapeutically effective amount of the compound according to the first aspect of the invention or the pharmaceutical composition according the second aspect of the invention.

    [0086] The compounds of the invention may include isotopically-labelled and/or isotopically-enriched forms of the compounds. The compounds of the invention herein may contain unnatural proportions of atomic isotopes at one or more of the atoms that constitute such compounds. Examples of isotopes that can be incorporated into the disclosed compounds include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorus, sulfur, chlorine, such as .sup.2H, .sup.3H, .sup.11C, .sup.13C, .sup.14C, .sup.13N, .sup.15O, .sup.17O, .sup.32P, .sup.35S, .sup.18F, .sup.36Cl.

    [0087] The compounds of the invention may be used as such or, where appropriate, as pharmacologically acceptable salts (acid or base addition salts) thereof. The pharmacologically acceptable addition salts mentioned below are meant to comprise the therapeutically active non-toxic acid and base addition salt forms that the compounds are able to form. Compounds that have basic properties can be converted to their pharmaceutically acceptable acid addition salts by treating the base form with an appropriate acid. Exemplary acids include inorganic acids, such as hydrogen chloride, hydrogen bromide, hydrogen iodide, sulphuric acid, phosphoric acid; and organic acids such as formic acid, acetic acid, propanoic acid, hydroxyacetic acid, lactic acid, pyruvic acid, glycolic acid, maleic acid, malonic acid, oxalic acid, benzenesulphonic acid, toluenesulphonic acid, methanesulphonic acid, trifluoroacetic acid, fumaric acid, succinic acid, malic acid, tartaric acid, citric acid, salicylic acid, p-aminosalicylic acid, pamoic acid, benzoic acid, ascorbic acid and the like. Compounds that have acidic properties can be converted to their pharmaceutically acceptable basic addition salts by treating the acid form with an appropriate base. Exemplary base addition salt forms are the sodium, potassium, calcium salts, and salts with pharmaceutically acceptable amines such as, for example, ammonia, alkylamines, benzathine, and amino acids, such as, e.g. arginine and lysine. The term addition salt as used herein also comprises solvates which the compounds and salts thereof are able to form, such as, for example, hydrates, alcoholates and the like.

    [0088] Throughout the present disclosure, a given chemical formula or name shall also encompass all pharmaceutically acceptable salts, solvates, hydrates, N-oxides, and/or prodrug forms thereof. It is to be understood that the compounds of the invention include any and all hydrates and/or solvates of the compound formulas. It is appreciated that certain functional groups, such as the hydroxy, amino, and like groups form complexes and/or coordination compounds with water and/or various solvents, in the various physical forms of the compounds. Accordingly, the above formulas are to be understood to include and represent those various hydrates and/or solvates.

    [0089] Compounds of the invention also include tautomeric forms. Tautomeric forms result from the swapping of a single bond with an adjacent double bond together with the concomitant migration of a proton. Tautomeric forms include prototropic tautomers which are isomeric protonation states having the same empirical formula and total charge. Example prototropic tautomers include ketoneenol pairs, amideimidic acid pairs, lactamlactim pairs, amideimidic acid pairs, enamineimine pairs, and annular forms where a proton can occupy two or more positions of a heterocyclic system, for example, 1H- and 3H-imidazole, 1H, 2H- and 4H-1,2,4-triazole, 1H- and 2H-isoindole, and 1H- and 2H-pyrazole. Tautomeric forms can be in equilibrium or sterically locked into one form by appropriate substitution.

    [0090] The compounds described herein can be asymmetric (e.g. having one or more stereocenters). All stereoisomers, such as enantiomers and diastereomers, are intended unless otherwise indicated. Compounds of the present invention that contain asymmetrically substituted carbon atoms can be isolated in optically active or racemic forms. Methods on how to prepare optically active forms from optically active starting materials are known in the art, such as by resolution of racemic mixtures or by stereoselective synthesis. Many geometric isomers of olefins, C?N double bonds, and the like can also be present in the compounds described herein, and all such stable isomers are contemplated in the present invention. Cis- and trans-geometric isomers of the compounds of the present invention are described and may be isolated as a mixture of isomers or as separated isomeric forms.

    [0091] In the case of the compounds which contain an asymmetric carbon atom, the invention relates to the D form, the L form, and D, L mixtures and also, where more than one asymmetric carbon atom is present, to the diastereomeric forms. Those compounds of the invention which contain asymmetric carbon atoms, and which as a rule accrue as racemates, can be separated into the optically active isomers in a known manner, for example using an optically active acid. However, it is also possible to use an optically active starting substance from the outset, with a corresponding optically active or diastereomeric compound then being obtained as the end product.

    [0092] The term prodrugs refers to compounds that may be converted under physiological conditions or by solvolysis to a biologically active compound of the invention. A prodrug may be inactive when administered to a subject in need thereof, but is converted in vivo to an active compound of the invention. Prodrugs are typically rapidly transformed in vivo to yield the parent compound of the invention, e.g. by hydrolysis in the blood. The prodrug compound usually offers advantages of solubility, tissue compatibility or delayed release in a mammalian organism (see Silverman, R. B., The Organic Chemistry of Drug Design and Drug Action, 2nd Ed., Elsevier Academic Press (2004), page 498 to 549). Prodrugs of a compound of the invention may be prepared by modifying functional groups, such as a hydroxy, amino or mercapto groups, present in a compound of the invention in such a way that the modifications are cleaved, either in routine manipulation or in vivo, to the parent compound of the invention. Examples of prodrugs include, but are not limited to, acetate, formate and succinate derivatives of hydroxy functional groups or phenyl carbamate derivatives of amino functional groups.

    [0093] The term treatment as used herein may include prophylaxis of the named disorder or condition, or amelioration or elimination of the disorder once it has been established. The term prevention refers to prophylaxis of the named disorder or condition.

    [0094] Methods delineated herein include those wherein the subject is identified as in need of a particular stated treatment. Identifying a subject in need of such treatment can be in the judgment of a subject or a health care professional and can be subjective (e.g. opinion) or objective (e.g. measurable by a test or diagnostic method).

    [0095] In other aspects, the methods herein include those further comprising monitoring subject response to the treatment administrations. Such monitoring may include periodic imaging or sampling of subject tissue, fluids, specimens, cells, proteins, chemical markers, genetic materials, Etc. as markers or indicators of the treatment regimen. In other methods, the subject is pre-screened or identified as in need of such treatment by assessment for a relevant marker or indicator of suitability for such treatment.

    [0096] The invention provides a method of monitoring treatment progress. The method includes the step of determining a level of diagnostic marker (Marker) (e.g. any target or cell type delineated herein modulated by a compound herein) or diagnostic measurement (e.g., screen, assay) in a subject suffering from or susceptible to a disorder or symptoms thereof delineated herein, in which the subject has been administered a therapeutic amount of a compound herein sufficient to treat the disease or symptoms thereof. The level of Marker determined in the method can be compared to known levels of Marker in either healthy normal controls or in other afflicted patients to establish the subject's disease status. In preferred embodiments, a second level of Marker in the subject is determined at a time point later than the determination of the first level, and the two levels are compared to monitor the course of disease or the efficacy of the therapy. In certain preferred embodiments, a pre-treatment level of Marker in the subject is determined prior to beginning treatment according to this invention; this pre-treatment level of Marker can then be compared to the level of Marker in the subject after the treatment commences, to determine the efficacy of the treatment.

    [0097] A level of Marker or Marker activity in a subject may be determined at least once. Comparison of Marker levels, e.g., to another measurement of Marker level obtained previously or subsequently from the same patient, another patient, or a normal subject, may be useful in determining whether therapy according to the invention is having the desired effect, and thereby permitting adjustment of dosage levels as appropriate. Determination of Marker levels may be performed using any suitable sampling/expression assay method known in the art or described herein. Preferably, a tissue or fluid sample is first removed from a subject. Examples of suitable samples include blood, urine, tissue, mouth or cheek cells, and hair samples containing roots. Other suitable samples would be known to the person skilled in the art. Determination of protein levels and/or mRNA levels (e.g., Marker levels) in the sample can be performed using any suitable technique known in the art, including, but not limited to, enzyme immunoassay, ELISA, radiolabeling/assay techniques, blotting/chemiluminescence methods, real-time PCR, and the like.

    [0098] For clinical use, the compounds disclosed herein are formulated into pharmaceutical compositions (or formulations) for various modes of administration. It will be appreciated that compounds of the invention may be administered together with a physiologically acceptable carrier, excipient, and/or diluent (i.e. one, two, or all three of these). The pharmaceutical compositions disclosed herein may be administered by any suitable route, preferably by oral, rectal, nasal, topical (including ophthalmic, buccal and sublingual), sublingual, transdermal, intrathecal, transmucosal or parenteral (including subcutaneous, intramuscular, intravenous and intradermal) administration. Other formulations may conveniently be presented in unit dosage form, e.g., tablets and sustained release capsules, and in liposomes, and may be prepared by any methods well known in the art of pharmacy. Pharmaceutical formulations are usually prepared by mixing the active substance, or a pharmaceutically acceptable salt thereof, with conventional pharmaceutically acceptable carriers, diluents or excipients. Examples of excipients are water, gelatin, gum arabicum, lactose, microcrystalline cellulose, starch, sodium starch glycolate, calcium hydrogen phosphate, magnesium stearate, talcum, colloidal silicon dioxide, and the like. Such formulations may also contain other pharmacologically active agents, and conventional additives, such as stabilizers, wetting agents, emulsifiers, flavouring agents, buffers, and the like. Usually, the amount of active compounds is between 0.1-95% by weight of the preparation, preferably between 0.2-20% by weight in preparations for parenteral use and more preferably between 1-50% by weight in preparations for oral administration. The formulations can be further prepared by known methods such as granulation, compression, microencapsulation, spray coating, Etc. The formulations may be prepared by conventional methods in the dosage form of tablets, capsules, granules, powders, syrups, suspensions, suppositories or injections. Liquid formulations may be prepared by dissolving or suspending the active substance in water or other suitable vehicles. Tablets and granules may be coated in a conventional manner. To maintain therapeutically effective plasma concentrations for extended periods of time, compounds disclosed herein may be incorporated into slow release formulations.

    [0099] The dose level and frequency of dosage of the specific compound will vary depending on a variety of factors including the potency of the specific compound employed, the metabolic stability and length of action of that compound, the patient's age, body weight, general health, sex, diet, mode and time of administration, rate of excretion, drug combination, the severity of the condition to be treated, and the patient undergoing therapy. The daily dosage may, for example, range from about 0.001 mg to about 100 mg per kilo of body weight, administered singly or multiply in doses, e.g. from about 0.01 mg to about 25 mg each. Normally, such a dosage is given orally but parenteral administration may also be chosen.

    Definitions

    [0100] Optional or optionally means that the subsequently described event or circumstance may, but need not, occur, and that the description includes instances where the event or circumstance occurs and instances in which it does not.

    [0101] The term heteroatom means O, N, or S.

    [0102] The term (C.sub.1-C.sub.n)alkyl denotes a straight, branched or cyclic or partially cyclic alkyl group having from 1 to n carbon atoms, i.e. 1, 2, 3 . . . or n carbon atoms. For the (C.sub.1-C.sub.n)alkyl group to comprise a cyclic portion it should be formed of at least three carbon atoms. For parts of the range (C.sub.1-C.sub.n)alkyl all subgroups thereof are contemplated. For example, in the range (C.sub.1-C.sub.6)alkyl, all subgroups such as (C.sub.1-C.sub.5)alkyl, (C.sub.1-C.sub.4)alkyl, (C.sub.1-C.sub.3)alkyl, (C.sub.1-C.sub.2)alkyl, (C.sub.1)alkyl, (C.sub.2-C.sub.6)alkyl, (C.sub.2-C.sub.5)alkyl, (C.sub.2-C.sub.4)alkyl, (C.sub.2-C.sub.3)alkyl, (C.sub.2)alkyl, (C.sub.3-C.sub.6)alkyl, (C.sub.3-C.sub.8)alkyl, (C.sub.3-C.sub.4)alkyl, (C.sub.3)alkyl, (C.sub.4-C.sub.6)alkyl, (C.sub.4-C.sub.5)alkyl, (C.sub.4)alkyl, (C.sub.5-C.sub.6)alkyl, (C.sub.6)alkyl. Examples of C.sub.1-C.sub.6 alkyl include methyl, ethyl, n-propyl, isopropyl, cyclopropyl, n-butyl, isobutyl, sec-butyl, t-butyl, cyclobutyl, cyclopropylmethyl, branched or cyclic or partially cyclic pentyl and hexyl Etc.

    [0103] The term halo-(C.sub.1-C.sub.n)alkyl denotes a C.sub.1-C.sub.n alkyl as described above substituted with at least one halogen atom, which is preferably, F, Cl, Br and I, more preferably F and Cl, and most preferably F.

    [0104] When a term denotes a range, for instance 1 to 6 carbon atoms in the definition of (C.sub.1-C.sub.6)alkyl, each integer is considered to be disclosed, i.e. 1, 2, 3, 4, 5 and 6.

    [0105] The term (C.sub.2-C.sub.n)alkenyl denotes a straight, branched or cyclic or partially cyclic alkyl group having at least one carbon-carbon double bond, and having from 2 to 6 carbon atoms. The alkenyl group may comprise a ring formed of 3 to 6 carbon atoms. For parts of the range (C.sub.2-C.sub.n)alkenyl all subgroups thereof are contemplated. For example, the range (C.sub.2-C.sub.4)alkenyl covers (C.sub.2-C.sub.4)alkenyl, (C.sub.2-C.sub.3)alkenyl, (C.sub.2)alkenyl. Examples of (C.sub.2-C.sub.4)alkenyl include 2-propenyl, 2-butenyl, 3-butenyl, 2-methyl-2-propenyl Etc.

    [0106] The term (C.sub.1-C.sub.4)alkoxy denotes O((C.sub.1-C.sub.4)alkyl) in which a (C.sub.1-C.sub.4)alkyl group is as defined above and is attached to the remainder of the compound through an oxygen atom. Examples of (C.sub.1-C.sub.4)alkoxy include methoxy, ethoxy, n-propoxy, isopropoxy, n-butoxy, isobutoxy, sec-butoxy and t-butoxy.

    [0107] The term halo(C.sub.1-C.sub.4)alkoxy denotes a (C.sub.1-C.sub.4)alkoxy as described above substituted with a halogen atom, which is preferably, F, Cl, Br and I, more preferably F and Cl, and most preferably F.

    [0108] The term halo means a halogen atom, and is preferably, F, Cl, Br and I, more preferably F and Cl, and most preferably F.

    [0109] The term 3- to 10-membered heterocyclic ring denotes a non-aromatic ring system having 3 to 10 ring atoms, in which at least one ring atoms is a heteroatom.

    [0110] An effective amount refers to an amount of a compound of the invention that confers a therapeutic effect on the treated subject. The therapeutic effect may be objective (i.e. measurable by some test or marker) or subjective (i.e. subject gives an indication of or feels an effect).

    [0111] As used herein, the terms administration or administering mean a route of administration for a compound disclosed herein. Exemplary routes of administration include, but are not limited to, oral, intraocular, intravenous, intraperitoneal, intraarterial, and intramuscular. The preferred route of administration can vary depending on various factors, e.g. the components of the pharmaceutical composition comprising a compound disclosed herein, site of the potential or actual disease and severity of disease.

    [0112] The terms subject and patient are used herein interchangeably. They refer to a human or another mammal (e.g., mouse, rat, rabbit, dog, cat, cattle, swine, sheep, horse or primate) that can be afflicted with or is susceptible to a disease or disorder but may or may not have the disease or disorder. It is preferred that the subject is human.

    [0113] Compounds of the invention may be disclosed by the name or chemical structure. If a discrepancy exists between the name of a compound and its associated chemical structure, then the chemical structure prevails.

    [0114] The invention will now be further illustrated by the following non-limiting examples. The specific examples below are to be construed as merely illustrative, and not limitative of the remainder of the disclosure in any way whatsoever. Without further elaboration, it is believed that one skilled in the art can, based on the description herein, utilise the present invention to its fullest extent. All references and publications cited herein are hereby incorporated by reference in their entirety.

    Preparation of Compounds of the Invention

    [0115] The compounds of the invention can be prepared according to the following General Synthetic Scheme by methods well known and appreciated in the art. Suitable reaction conditions, for the steps of the General Synthetic Procedure, Scheme 1, are well known in the art and appropriate substitutions of solvents and co-reagents are within the common general knowledge of the person skilled in the art. Likewise, it will be appreciated by those skilled in the art that synthetic intermediates may be isolated and/or purified by various well-known techniques as needed or desired, and that frequently, it will be possible to use various intermediates directly in subsequent synthetic steps with little or no purification. Furthermore, the skilled person will appreciate that in some circumstance, the orders in which moieties are introduced is not critical. The particular order of steps required to produce the compounds of formula (I) is dependent upon the particular compound being synthesized, the starting compound, and the relative liability of the substituted moieties as is well appreciated by those of ordinary skill in the art. All substituents, unless otherwise indicated, are as previously defined, and all reagents are well known and appreciated in the art.

    [0116] The compounds of general formula (I) may be prepared by a variety of procedures, some of which are described below. One of the methods particularly suitable for the preparation of small to medium-sized peptides, as is well known and appreciated by those of ordinary skill in the art, is solid phase peptide synthesis (SPPS).

    [0117] Suitable starting materials and protected amino acids of general formula AA-1 Int-1, Int-2 or Int-3 are either commercially available or may be prepared by a variety of methods. For example, as illustrated in the General Synthetic Procedure, Scheme 1, the carboxylic acid functionality of appropriately substituted amino acids of general formula AA-1, can be chemoselectively protected as a suitable derivative, for example as a methyl ester, using well established procedures and reagents like a mixture of methanol and thionyl chloride to yield a compound of general formula Int-1. In a subsequent step, protection of the free amine functionality in Int-1 as, for example, an amide or a carbamate, like Fmoc, affords and intermediate of general structure Int-2. The intermediate of general formula Int-3 can be obtained by selective deprotection of the masked acid functionality present in Int-2, using for example an acidic hydrolysis. When using SPPS, Int-3 can be attached to a suitably functionalised resin, for example Wang resin, using ester formation reagents like, for exemplification, a mixture of diisopropylmethanediimine, 4-methylmorpholine and N,N-dimethylpyridin-4-amine in dichloromethane, to afford solid supported intermediate of general formula Int-4.

    General Synthetic Procedure

    [0118] ##STR00007##

    [0119] When required the resin bound intermediates Int-4 to Int-9 can be analysed after cleavage from resin. Alternatively, the corresponding steps on solid support can be performed without analysis. The protecting group of the amine in Int-4 can be removed by treatment with a base like piperidine, when, for example, the Fmoc protecting group is used, to yield Int-5. The free acid functionality present in the second N-protected-amino-acid, represented here by the compound of general formula AA-2, can be coupled with the free amine present in intermediate of general formula Int-5 to afford Int-6, using a classical amide coupling procedure, for example a mixture of HATU and a base, like N-methyl morpholine in a suitable solvent system, like a mixture of DCM-DMF.

    [0120] Similarly, suitably, amine moiety protected, AA-2 can be coupled with Int-5 to afford Int-6. The temporary amine protecting group, can then be removed in the subsequent step, to give Int-7, using a base like piperidine, when, for example, the Fmoc protecting group is used. The free basic amine functionality present in Int-7 can be, once again and as previously described, extended by introduction, as exemplified in the General Synthetic Procedure, of another suitably protected amino acid derivative of general formula AA-3 to give Int-8. Equally, after selective removal of the protecting group of the amine in Int-8, obtained Int-9 can be readily functionalized as an acyl derivative using a classical amide coupling procedure, for example a mixture of HATU and a base, such as N-methyl morpholine in a suitable solvent system, like a mixture of DCM-DMF, to yield intermediate of general formula Int-10. The final compound of general formula (I) is obtained, by cleavage, for example, using acidic hydrolysis with a reagent like trifluoroacetic acid, of the ester bond between the resin solid support and the compound of general structure shown in Int-10.

    [0121] Resin bound intermediates were analysed after cleavage from resin. All the analysis of intermediate are of free acids.

    [0122] The products of each step can then be recovered by conventional methods including extraction, evaporation, precipitation, chromatography, filtration, trituration, crystallisation and the like.

    [0123] The skilled artisan will also appreciate that not all of the substituents in the compounds of formula (I) will tolerate certain reaction conditions employed to synthesise the compounds. These moieties may be introduced at a convenient point in the synthesis, or may be protected and then deprotected as necessary or desired, as is well known in the art. The skilled artisan will appreciate that the protecting groups may be removed at any convenient point in the synthesis of the compounds of the present invention. Methods for introducing or removing protecting groups used in this invention are well known in the art; see, for example, Greene and Wuts, Protective Groups in Organic Synthesis, 4th Ed., John Wiley and Sons, New York (2006)..sup.18

    EXAMPLES

    Abbreviations

    [0124] approx: approximately; aq: aqueous; br: broad; ca.: circa; CDI: 1,1-Carbonyldiimidazole; d: doublet; DCM: dichloromethane; DIC: N,N-Diisopropylcarbodiimide; dioxane: 1,4-dioxane; DIPEA: diisopropylethylamine; DMF: dimethylformamide; eq.: equivalent; Et.sub.3N: triethylamine; EtOAc: ethyl acetate; EtOH: ethanol; Fmoc: fluorenylmethoxycarbonyl; Boc: tert-butoxycarbonyl; h: hours; min: minutes: HATU: 2-(3H-[1,2,3]triazolo[4,5-b]pyridin-3-yl)-1,1,3,3-tetramethyl isouronium hexafluorophosphate(V); HPLC: high performance liquid chromatography; IPA, isopropanol; LC: liquid chromatography; m: multiplet; M: molar, molecular ion; MeCN: acetonitrile; MeOH: methanol; MS: mass spectrometry; NMR: nuclear magnetic resonance; PDA: photodiode array; q: quartet; rt: room temperature (ca. 20? C.); R.sub.T: retention time; s: singlet, solid; SPPS: solid phase peptide synthesis. t: triplet; TBAF: tetrabutylammonium fluoride; TBME: tert-butyl methyl ether; TFA: trifluoroacetic acid; THF: tetrahydrofuran; UPLC: ultra-performance liquid chromatography; UV: ultraviolet.

    [0125] Other abbreviations are intended to convey their generally accepted meaning.

    General Experimental Conditions

    [0126] All starting materials and solvents were obtained either from commercial sources or prepared according to the literature citation. Reaction mixtures were magnetically stirred and reactions performed at room temperature (ca. 20? C.) unless otherwise indicated.

    [0127] Column chromatography was performed on an automated flash chromatography system, such as a CombiFlash Rf system, using pre-packed silica (40 ?m) cartridges, unless otherwise indicated.

    [0128] .sup.1H NMR spectra were recorded at 500 MHz on a Bruker Avance III-500 HD spectrometer, equipped with a Bruker 5 mm SmartProbe?. Chemical shifts are expressed in parts per million (ppm) using either the central peaks of the residual protic solvent as references or relative to tetramethylsilane, as internal standard.

    [0129] The spectra were recorded at 298 K unless otherwise indicated. The following abbreviations or their combinations are used for multiplicity of NMR signals: br=broad, d=doublet, m=multiplet, q=quartet, quint=quintet, s=singlet and t=triplet.

    [0130] Analytical UPLC-MS experiments to determine retention times and associated mass ions were performed using a Waters ACQUITY UPLC? H-Class system, equipped with ACQUITY PDA Detector and ACQUITY QDa Mass Detector, running one of the analytical methods described below.

    [0131] Analytical LC-MS experiments to determine retention times and associated mass ions were performed using an Agilent 1200 series HPLC system coupled to an Agilent 1956, 6100 or 6120 series single quadrupole mass spectrometer running one of the analytical methods described below.

    [0132] Preparative HPLC purifications were performed either using a Waters X-Select CSH C18, 5 ?m, 19?50 mm column using a gradient of MeCN and water, both modified with 0.1% v/v formic acid, or on a Waters X-Bridge BEH C18, 5 ?m 19?50 mm column using a gradient of MeCN and 10 mM ammonium bicarbonate (aq). Fractions were collected following detection by UV at a single wavelength measured by a variable wavelength detector.

    Analytical Methods

    Method 1Acidic 3 Min Method

    [0133] Column: Waters ACQUITY UPLCO CSH C18, 1.7 ?m, 2.1?30 mm at 40? C. [0134] Detection: UV at 254 nm unless otherwise indicated, MS by electrospray ionisation [0135] Solvents: A: 0.1% v/v Formic acid in water, B: 0.1% v/v Formic acid in MeCN [0136] Gradient:

    TABLE-US-00001 Flow rate Time % A % B (ml/min) 0.00 95 5 0.77 0.11 95 5 0.77 2.15 5 95 0.77 2.56 5 95 0.77 2.83 95 5 0.77 3.00 95 5 0.77

    Method 2Basic 4 Min Method

    [0137] Column: Waters X-Bridge BEH C18, 2.5 ?m, 4.6?30 mm at 40? C. [0138] Solvents: A: 10 mM ammonium bicarbonate (aq), B: MeCN [0139] Gradient:

    TABLE-US-00002 Flow rate Time % A % B (ml/min) 0.0 95.0 5.0 2.5 3.0 5.0 95.0 2.5 3.01 5.0 95.0 4.5 3.6 5.0 95.0 4.5 3.7 95.0 5.0 2.5 4.0 95.0 5.0 2.5

    Intermediates

    (S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-5,5,5-trifluoropentanoic acid (Int-11)

    [0140] ##STR00008##

    [0141] Intermediate Int-11 was prepared following the procedure described in WO 2010/132601, to prepare methyl 5,5,5-trifluoropentanoate, followed by Fmoc protection and methyl ester hydrolysis, as described in WO 2015/131100.

    4-Acetyl-(2R)-2-morpholine carboxylic acid (Int-15)

    [0142] ##STR00009##

    (R)-2-(Methoxycarbonyl)morpholin-4-ium chloride (Int-13)

    [0143] To acetyl chloride (7.60 mL, 107 mmol), cooled to 0? C., was added dropwise MeOH (40 mL) and the mixture was stirred for 15 minutes. To the cooled mixture was added portion-wise (R)-4-(tert-butoxycarbonyl)morpholine-2-carboxylic acid (Int-12, 4.50 g, 19.5 mmol). The reaction mixture was warmed to room temperature over 2 hours and then heated to 70? C. overnight. The reaction mixture was concentrated in vacuo, triturated with TBME (5?30 mL) and concentrated in vacuo again to afford (R)-2-(methoxycarbonyl)morpholin-4-ium chloride (Int-13, 3.64 g, 19.0 mmol, 98% yield, 95% purity) as an off white solid. .sup.1H NMR (500 MHz, DMSO-d6) ? 9.76 (s, 2H), 4.56 (dd, J=9.9, 3.1 Hz, 1H), 4.00 (dt, J=12.7, 3.3 Hz, 1H), 3.88-3.80 (m, 1H), 3.70 (s, 3H), 3.39-3.30 (m, 1H), 3.13-3.19 (m, 1H), 3.11-3.05 (m, 1H), 3.04-3.96 (m, 1H).

    Methyl (R)-4-acetylmorpholine-2-carboxylate (Int-14)

    [0144] To a solution of (R)-2-(methoxycarbonyl)morpholin-4-ium chloride (Int-13, 998 mg, 5.49 mmol) and N-methylmorpholine (1.69 mL, 15.4 mmol) in DCM (18 mL) at 0? C. was added dropwise, acetyl chloride (469 ?L, 6.59 mmol) and the reaction mixture was warmed to room temperature overnight. The reaction mixture was filtered, and the filtrate was diluted with water (20 mL), then basified to pH 8 by adding saturated aqueous NaHCO.sub.3 (approx. 10 mL). The layers were separated and the aqueous further extracted with DCM (2?20 mL). The combined organics were washed with brine, dried over MgSO.sub.4 and concentrated to a dark orange oil. The crude product was purified by column chromatography on silica gel (40 g column, 0-5% MeOH in DCM) to afford methyl (R)-4-acetylmorpholine-2-carboxylate (Int-14, 350 mg, 1.87 mmol, 34% yield, 95% purity) as a brown oil. The .sup.1H NMR spectrum depicts rotamers.

    [0145] .sup.1H NMR (500 MHz, at 25? C., DMSO-d6, rotamer) b 4.30 (dd, J=7.5, 3.4 Hz, 0.5H), 4.20-4.09 (m, 1H), 3.88 (dt, J=11.5, 3.4 Hz, 0.5H), 3.79-3.70 (m, 1H), 3.68 (d, J=14.8 Hz, 3.5H), 3.65-3.56 (m, 0.5H), 3.56-3.46 (m, 1.5H), 3.23 (dddd, J=28.2, 12.5, 8.9, 3.5 Hz, 1H), 3.01 (dd, J=13.0, 8.8 Hz, 0.5H), 2.01 (d, J=8.1 Hz, 3H).

    [0146] .sup.1H NMR (500 MHz, at 90? C., DMSO-d6) ? 4.21-4.18 (m, 1H), 3.87-3.84 (m, 1H), 3.71 (s, 3H), 3.66-3.59 (m, 1H), 3.55 (ddd, J=11.6, 8.6, 3.0 Hz, 1H), 3.29 (td, J=10.3, 9.6, 5.1 Hz, 1H), 3.01-2.99 (m, 2H), 2.01 (s, 3H).

    (R)-4-Acetylmorpholine-2-carboxylic acid (Int-15)

    [0147] To a solution of methyl (R)-4-acetylmorpholine-2-carboxylate (Int-14, 350 mg, 1 1.87 mmol) in water (2.5 mL) and THF (2.5 mL), cooled to 0? C. was added portion-wise LiOH (42.5 mg, 1.78 mmol). The reaction mixture was stirred for 3 hours then diluted with 1 M HCl (10 mL) and extracted with EtOAc (20 mL?3). The organic phases were combined, dried over MgSO.sub.4 and concentrated in vacuo to afford a brown oil (40.0 mg). The aqueous phase was further extracted with 4:1=CHCl.sub.3/IPA (30 mL?3). The organic phases were combined, dried over MgSO.sub.4 and concentrated in vacuo to afford (R)-4-acetylmorpholine-2-carboxylic acid as an off-white solid (Int-15, 202 mg, 1.10 mmol, 59% yield, 95% purity). The .sup.1H NMR spectrum depicts rotamers.

    [0148] .sup.1H NMR (500 MHz, at 25? C., DMSO-d6, rotamer) b 13.01 (br s, 1H), 4.17 (dt, J=10.7, 3.3 Hz, 1H), 3.98 (dd, J=9.2, 3.4 Hz, 0.5H), 3.88 (dt, J=11.5, 3.4 Hz, 0.5H), 3.83-3.75 (m, 0.5H), 3.70 (dd, J=13.3, 3.4 Hz, 0.5H), 3.68-3.61 (m, 0.5H), 3.58 (d, J=13.6 Hz, 0.5H), 3.49 (qd, J=11.8, 11.2, 2.8 Hz, 1.5H), 3.27-3.15 (m, 1H), 2.97 (dd, J=13.3, 9.2 Hz, 0.5H), 2.01 (d, J=10.0 Hz, 3H).

    [0149] .sup.1H NMR (500 MHz, at 90? C., DMSO-d6) ? 4.15-3.93 (m, 1H), 3.93-3.76 (m, 1H), 3.65-3.46 (m, 2H), 3.32-3.17 (m, 1H), 3.13-2.82 (m, 2H), 2.01 (s, 3H). CO.sub.2H peak not seen.

    Example 1

    (S)-5,5,5-Trifluoro-2-((2S,3S)-2-((S)-3-(4-hydroxyphenyl)-2-((S)-tetrahydrofuran-2-carboxamido)propanamido)-3-methylpentanamido)pentanoic acid

    [0150] ##STR00010## ##STR00011##

    Synthesis of (S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-5,5,5-trifluoropentanoic acid (Int-16)

    [0151] Wang Resin (Loading: 1.0 mmol/g, 90.0 mg, 0.09 mmol) was swollen in DCM (1 mL) for 10 minutes and filtered, washing with DCM (3?5 mL). (S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-5,5,5-trifluoropentanoic acid (Int-11, 177 mg, 0.450 mmol), 1H-benzo[d][1,2,3]triazol-1-ol hydrate (69.0 mg, 0.45 mmol), diisopropylmethanediimine (70.0 ?L, 0.45 mmol), 4-methylmorpholine (49.0 ?L, 0.45 mmol) and N,N-dimethylpyridin-4-amine (11.0 mg, 0.09 mmol) and DCM (5 mL) were added and the mixture was stirred at room temperature for 18 hours. The reaction mixture was filtered and washed with DMF (5 mL?3), DCM (5 mL?3), water (5 mL?2) and DMF (5 mL?3). DCM (5 mL), (S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-5,5,5-trifluoropentanoic acid (Int-11, 177 mg, 0.45 mmol), 1H-benzo[d][1,2,3]triazol-1-ol hydrate (69.0 mg, 0.45 mmol), 4-methylmorpholine (49.0 ?L, 0.45 mmol), diisopropylmethanediimine (69.7 ?L, 0.45 mmol) and N,N-dimethylpyridin-4-amine (11.0 mg, 0.09 mmol) were added to the resin and the suspension was gently stirred for a further 12 hours at room temperature. The mixture was filtered and washed with DMF (5 mL?3), DCM (5 mL?3), water (5 mL?2) and DMF (5 mL?3) to afford Int-16. No analysis was undertaken at this stage and resin was used directly in the next step.

    Synthesis of (S)-2-((2S,3S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-methylpentanamido)-5,5,5-trifluoropentanoic acid [Resin bound on C-terminal] (Int-18)

    [0152] (S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-5,5,5-trifluoropentanoic acid, resin bound (Int-16, 90.0 mg, 0.09 mmol) was swollen in DMF (1 mL) for 10 min and filtered. 20% piperidine in DMF (5 mL) was added to the swollen resin and the suspension was agitated with nitrogen gas at room temperature for 20 minutes. The suspension was filtered, 20% piperidine in DMF (5 mL) was added and the suspension was agitated with nitrogen gas at room temperature for 20 minutes. The suspension was filtered and washed with DMF (5 mL?3), DCM (5 mL?3), water (5 mL?2) and DMF (5 mL?3). The obtained solid was used without further purification.

    [0153] A mixture of DMF/DCM (1:1, 3 mL) was added followed by (((9H-fluoren-9-yl)methoxy)carbonyl)-L-isoleucine (Int-17, 127 mg, 0.36 mmol), HATU (137 mg, 0.36 mmol) and 4-methylmorpholine (40.0 ?L, 0.36 mmol). The suspension was agitated with nitrogen gas at room temperature for 2 h then filtered and washed with DMF (5 mL?3), DCM (5 mL?3), water (5 mL?2) and DMF (5 mL?3). DMF (3 mL) was added followed by (((9H-fluoren-9-yl)methoxy)carbonyl)-L-isoleucine (Int-17, 127 mg, 0.36 mmol), HATU (137 mg, 0.36 mmol) and 4-methylmorpholine (40.0 ?L, 0.36 mmol). The suspension was agitated with nitrogen gas at room temperature for 15 h then filtered and washed with DMF (5 mL?3), DCM (5 mL?3), water (5 mL?2) and DMF (5 mL?3) to afford Int-18. A small portion of resin was added to 0.5 mL of TFA and the suspension was left at ROOM TEMPERATURE for 1 hour. The suspension was concentrated in vacuo afford (S)-2-((2S,3S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-3-methylpentanamido)-5,5,5-trifluoropentanoic acid (77% purity), which was analysed by UPLC. LCMS (Method 1, 1.67 min, M+H=507.4).

    Synthesis of (5S,8S,11S)-5-(4-(tert-Butoxy)benzyl)-8-((S)-sec-butyl)-1-(9H-fluoren-9-yl)-3,6,9-trioxo-11-(3,3,3-trifluoropropyl)-2-oxa-4,7,10-triazadodecan-12-oic acid (Int-20)

    [0154] (S)-2-((2S,3S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-methylpentanamido)-5,5,5-trifluoropentanoic acid, resin bound (Int-18, 90.0 mg, 0.09 mmol) was swollen in DMF (1 mL) for 10 minutes and filtered. 20% piperidine in DMF (5 mL) was added to the swollen resin and the suspension was agitated with nitrogen gas at room temperature for 20 minutes. The suspension was filtered, 20% piperidine in DMF (5 mL) was added and the suspension was agitated with nitrogen gas at room temperature for 20 minutes. The suspension was filtered and washed with DMF (5 mL?3), DCM (5 mL?3), water (5 mL?2) and DMF (5 mL?3). The obtained solid was used without further purification.

    [0155] A mixture of DMF/DCM (1:1, 3 mL) was added followed by (S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-3-(4-(tert-butoxy)phenyl)propanoic acid (Int-19, 165 mg, 0.36 mmol), HATU (137 mg, 0.36 mmol) and 4-methylmorpholine (40.0 ?L, 0.36 mmol). The suspension was agitated with nitrogen gas at room temperature for 2 hours then filtered and washed with DMF (5 mL?3), DCM (5 mL?3), water (5 mL?2) and DMF (5 mL?3). DMF (3 mL) was added followed by (S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-3-(4-(tert-butoxy)phenyl)propanoic acid (Int-19, 165 mg, 0.36 mmol), 4-methylmorpholine (40.0 ?L, 0.36 mmol) and HATU (137 mg, 0.36 mmol). The suspension was agitated with nitrogen gas at room temperature for 16 hours, then filtered and washed with DMF (5 mL?3), DCM (5 mL?3), water (5 mL?2) and DMF (5 mL?3) to afford Int-20. A small portion of resin was added to 0.5 mL of TFA and the suspension was left at room temperature for 1 hour. The suspension was filtered, and concentrated in vacuo afford (5S,8S,11S)-8-((S)-sec-butyl)-1-(9H-fluoren-9-yl)-5-(4-hydroxybenzyl)-3,6,9-trioxo-11-(3,3,3-trifluoropropyl)-2-oxa-4,7,10-triazadodecan-12-oic acid (69% purity) which was analysed by UPLC. LCMS (Method 1, 1.58 min, M+H=670.5).

    Synthesis of (S)-2-((2S,3S)-2-((S)-3-(4-(tert-Butoxy)phenyl)-2-((S)-tetrahydrofuran-2-carboxamido)propanamido)-3-methylpentanamido)-5,5,5-trifluoropentanoic acid [Resin bound on C-terminal] (Int-22)

    [0156] (5S,8S,11 S)-5-(4-(tert-Butoxy)benzyl)-8-((S)-sec-butyl)-1-(9H-fluoren-9-yl)-3,6,9-trioxo-11-(3,3,3-trifluoropropyl)-2-oxa-4,7,10-triazadodecan-12-oic acid, resin bound (Int-20, 90.0 mg, 0.09 mmol) was swollen in DMF (1 mL) for 10 minutes and filtered. 20% piperidine in DMF (5 mL) was added to the swollen resin and the suspension was agitated with nitrogen gas at room temperature for 20 minutes. The suspension was filtered, 20% piperidine in DMF (5 mL) was added and the suspension was agitated with nitrogen gas at room temperature for 20 minutes. The suspension was filtered and washed with DMF (5 mL?3), DCM (5 mL?3), water (5 mL?2) and DMF (5 mL?3). The obtained solid was used without further purification.

    [0157] A mixture of DMF/DCM (1:1, 3 mL) was added followed by 4-methylmorpholine (33.0 ?L, 0.30 mmol), HATU (114 mg, 0.30 mmol) and (S)-tetrahydrofuran-2-carboxylic acid (Int-21, 29.0 ?L, 0.30 mmol). The suspension was agitated with nitrogen gas at room temperature for 2 hours then filtered and washed with DMF (5 mL?3), DCM (5 mL?3), water (5 mL?2) and DMF (5 mL?3). DMF (3 mL) was added followed by 4-methylmorpholine (33.0 ?L, 0.30 mmol), HATU (114 mg, 0.30 mmol) and (S)-tetrahydrofuran-2-carboxylic acid (Int-21, 29.0 ?L, 0.30 mmol) and the suspension was gently stirred at room temperature for 12 hours. The suspension was filtered and washed with DMF (5 mL?3), DCM (5 mL?3), water (5 mL?2) and DMF (5 mL?3) to afford Int-22. No analysis was undertaken at this stage and resin was used directly in the next step.

    Synthesis of (S)-5,5,5-Trifluoro-2-((2S,3S)-2-((S)-3-(4-hydroxyphenyl)-2-((S)-tetrahydrofuran-2-carboxamido)propanamido)-3-methylpentanamido)pentanoic acid (Example 1)

    [0158] A mixture of TFA/water (95:5, 1 mL) was added to (S)-2-((2S,3S)-2-((S)-3-(4-(tert-butoxy)phenyl)-2-((S)-tetrahydrofuran-2-carboxamido)propanamido)-3-methylpentanamido)-5,5,5-trifluoropentanoic acid, resin bound (Int-22, 80.0 mg, 0.08 mmol) and stirred at room temperature for 3 hours. The reaction mixture was filtered, and resin washed with DCM (20 mL?3). The combined filtrates were concentrated in vacuo and azeotroped with toluene (15 mL?3). The crude product was purified by preparative HPLC to afford (S)-5,5,5-trifluoro-2-((2S,3S)-2-((S)-3-(4-hydroxyphenyl)-2-((S)-tetrahydrofuran-2-carboxamido)propanamido)-3-methylpentanamido)pentanoic acid (Example 1, 2.70 mg, 4.90 ?mol, 6.5%, 95% purity by .sup.1H NMR) as a white solid. LCMS 95% purity (Method 1, 1.11 min, M+H=546.7). .sup.1H NMR (500 MHz, DMSO-d6) ? 12.83 (s, 1H), 9.14 (s, 1H), 8.28 (s, 1H), 7.93 (d, J=8.6 Hz, 1H), 7.62 (d, J=8.6 Hz, 1H), 6.99-6.88 (m, 2H), 6.66-6.56 (m, 2H), 4.49 (td, J=8.8, 4.4 Hz, 1H), 4.26-4.23 (m, 1H), 4.18 (t, J=8.0 Hz, 1H), 4.13 (dd, J=8.1, 4.6 Hz, 1H), 3.84 (q, J=6.9 Hz, 1H), 3.72 (dt, J=8.1, 6.5 Hz, 1H), 2.90 (dd, J=14.0, 4.4 Hz, 1H), 2.76 (dd, J=14.0, 9.1 Hz, 1H), 2.29 (ddd, J=50.1, 23.9, 9.6 Hz, 2H), 2.07-1.90 (m, 2H), 1.86-1.77 (m, 1H), 1.77-1.64 (m, 4H), 1.52-1.35 (m, 1H), 1.09 (dt, J=14.9, 7.9 Hz, 1H), 0.94-0.76 (m, 6H).

    TABLE-US-00003 TABLE 1 The following Examples were prepared in an analogous manner to Example 1, starting from (Int-11). Example Purity No. Structure Name Yield (%) (LCMS) Purity [NMR] 2 [00012]embedded image (2S)-5,5,5-trifluoro-2- [(2S,3S)- 2-[(S)-3-(4- hydroxyphenyl)-2- {[(2R)-oxolan-2- yl]formamido} propanamido]-3- methylpentanamido] pentoic acid 6.5 99% (Method 1, 1.11 min; M + H = 546.7) 95% [.sup.1H NMR (500 MHz, DMSO-d6) ? 12.78 (br s, 1H), 9.13 (s, 1H), 8.37- 8.34 (m, 1H), 8.07 (d, J = 8.7 Hz, 1H), 7.53 (d, J = 8.7 Hz, 1H), 6.95 (d, J = 8.4 Hz, 2H), 6.64-6.57 (m, 2H), 4.53 (td, J = 9.0, 4.3 Hz, 1H), 4.29-4.26 (m, 1H), 4.20 (t, J = 8.2 Hz, 1H), 4.14 (dd, J = 8.5, 5.0 Hz, 1H), 3.77-3.65 (m, 2H), 2.89 (dd, J = 14.0, 4.3 Hz, 1H), 2.74 (dd, J = 13.8, 9.3 Hz, 1H), 2.35-2.14 (m, 2H), 2.05-1.90 (m, 2H), 1.88-1.64 (m, 3H), 1.64-1.54 (m, 1H), 1.54- 1.41 (m, 2H), 1.17-1.02 (m, 1H), 0.91-0.75 (m, 6H).] 3 [00013]embedded image (S)-2-((2S,3S)-2-((S)-2- Acetamido-3-(4- hydroxyphenyl) propanamido)- 3-methylpentanamido)- 5,5,5- trifluoropentanoic acid 13 99% (Method 1, 1.00 min; M + H = 490.2) 95% [.sup.1H NMR (500 MHz, DMSO-d6) ? 12.77 (br s, 1H), 9.13 (s, 1H), 8.27 (d, J = 7.8 Hz, 1H), 7.99 (d, J = 8.4 Hz 1H), 7.90 (d, J = 8.7 Hz, 1H), 7.05-6.97 (m, 2H), 6.67-6.58 (m, 2H), 4.46 (td, J = 9.4, 8.9, 3.9 Hz, 1H), 4.30-4.26 (m, 1H), 4.16 (t, J = 8.1 Hz, 1H), 2.84 (dd, J = 14.0, 4.0 Hz, 1H), 2.58 (dd, J = 14.0, 10.1 Hz, 1H), 2.35-2.16 (m, 2H), 2.02- 1.92 (m, 1H), 1.86-1.78 (m, 1H), 1.76- 1.72 (m, 4H), 1.52-1.38 (m, 1H), 1.13- 1.01 (m, 1H), 0.88-0.79 (m, 6H).] 4 [00014]embedded image (S)-2-((2S,3S)-2- ((S)-2-((R)-4- Acetylmorpholine-2- carboxamido)-3-(4- hydroxyphenyl) propanamido)- 3-methylpentanamido)- 5,5,5- trifluoropentanoic acid 18 99% (Method 1, 1.02 min; M + H = 603.9 95% [.sup.1H NMR (500 MHz, DMSO-d6) ? 12.78 (br s, 1H), 9.14 (d, J = 2.4 Hz, 1H), 8.36 (d, J = 7.7 Hz, 1H), 8.09 (dd, J = 17.2, 8.6 Hz, 1H), 7.73 (d, J = 8.5 Hz, 0.5H), 7.59 (d, J = 8.2 Hz, 0.5H), 6.94 (dd, J = 14.8, 8.2 Hz, 2H), 6.60 (dd, J = 8.3, 3.9 Hz, 2H), 4.62-4.49 (m, 1H), 4.35 (d, J = 13.5 Hz, 0.5H), 4.32-4.29 (m, 1H), 4.18 (t, J = 8.1 Hz, 1H), 3.98- 3.88 (m, 1.5H), 3.85 (d, J = 12.0 Hz, 0.5H), 3.75 (dd, J = 10.7, 3.2 Hz, 0.5H), 3.65 (t, J = 15.6 Hz, 1H), 3.50 (d, J = 8.9 Hz, 0.5H), 3.42 (t, J = 9.8 Hz, 0.5H), 3.16- 3.14 (m, 0.5H), 3.03 (dd, J = 13.4, 9.6 Hz, 0.5H), 2.90 (d, J = 13.8 Hz, 1H), 2.85- 3.65 (m, 0.5H), 2.79-2.69 (m, 1H), 2.35-3.65 (m, 1H), 2.46-2.43 (m, 0.5H), 2.29-2.12 (m, 1H), 1.99-1.95 (m, 4H), 1.86-1.78 (m, 1H), 1.74-1.72 (m, 1H), 1.47-1.45 (m, 1H), 1.11-1.09 (m, 1H), 0.95-0.77 (m, 6H).]

    Example 5

    (S)-2-((S)-2-((S)-3-(4-Hydroxyphenyl)-2-((S)-pyrrolidine-2-carboxamido)propanamido)-3-(pyridin-2-yl)propanamido)-5,5-dimethylhexanoic acid

    [0159] ##STR00015## ##STR00016##

    Synthesis of (S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-5,5-dimethylhexanoic acid (Int-24)

    [0160] Wang resin (Loading: 1.0 mmol/g, 650 mg, 0.65 mmol) was swollen in DCM (30 mL) at room temperature for 10 minutes and filtered. DCM (30 mL) was added followed by (S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-5,5-dimethylhexanoic acid (Int-23, 0.25 g, 0.65 mmol), DIC (0.31 mL, 2.00 mmol), 1H-benzo[d][1,2,3]triazol-1-ol hydrate (0.30 g, 2.0 mmol), 4-methylmorpholine (0.21 mL, 2.00 mmol) and DMAP (79.0 mg, 0.65 mmol) and the suspension was gently stirred at room temperature for 16 hours. The suspension was filtered and washed with DMF (20 mL?3), DCM (20 mL?3), water (20 mL?2), DMF (20 mL?2) and DCM (20 mL?2). A mixture of DCM/DMF (1:1, 30 mL) was added followed by (S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-5,5-dimethylhexanoic acid (Int-23, 0.25 g, 0.65 mmol), DIC (0.31 mL, 2.00 mmol), 1H-benzo[d][1,2,3]triazol-1-ol hydrate (0.30 g, 2.00 mmol), 4-methylmorpholine (0.21 mL, 2.00 mmol) and DMAP (79.0 mg, 0.65 mmol). The suspension was stirred at room temperature for 24 hours then filtered and washed with DMF (5 mL?2), DCM (5 mL?2), water (5 mL?2), DMF (5 mL?2), DMF (20 mL?2) and DCM (20 mL?2) to afford Int-24. A small portion of the resin was added to TFA (0.05 mL) and the suspension was left at room temperature for 1 hour. The suspension was filtered, and concentrated in vacuo to afford (S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-5,5-dimethylhexanoic acid (100% purity), which was analysed by LCMS. LCMS (Method 2, 1.53 min, M+Na=404.1).

    Synthesis of (S)-2-((S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-(pyridin-2-yl)propanamido)-5,5-dimethylhexanoic acid (Int-26)

    [0161] (S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-5,5-dimethylhexanoic acid, resin bound (Int-24, 100 mg, 100 ?mol) was swollen in DMF (1 mL) for 10 minutes then filtered. 20% Piperidine in DMF (5 mL) was added to the swollen resin and the suspension was agitated with nitrogen gas at room temperature for 20 minutes. The suspension was filtered and washed with DMF (5 mL?2), DCM (5 mL?2), water (5 mL?2), DCM (5 mL?2) and DMF (5 mL?3). The obtained solid was used without further purification.

    [0162] DCM (2.6 mL) and DMF (0.4 mL) were added followed by (S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-3-(pyridin-2-yl)propanoic acid (Int-25, 155 mg, 0.40 mmol), HATU (152 mg, 0.40 mmol) and 4-methylmorpholine (44.0 ?L, 0.40 mmol). The reaction was stirred gently at room temperature for 20 h under an atmosphere of nitrogen then filtered and washed with DMF (5 mL?2), DCM (5 mL?2), water (5 mL?2), DCM (5 mL?2) and DMF (5 mL?3) to afford Int-26. A small portion of the resin was added to TFA (0.05 mL) and stirred at room temperature for 30 minutes. The suspension was filtered, washing with DCM (5 mL) and the combined filtrates were concentrated in vacuo to afford (S)-2-((S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-3-(pyridin-2-yl)propanamido)-5,5-dimethylhexanoic acid (85% purity) which was analysed by LCMS. (Method 2, 1.60 min; M+H=530.2).

    Synthesis of (5S,8S,11S)-5-(4-(tert-Butoxy)benzyl)-11-(3,3-dimethylbutyl)-1-(9H-fluoren-9-yl)-3,6,9-trioxo-8-(pyridin-2-ylmethyl)-2-oxa-4,7,10-triazadodecan-12-oic acid (Int-27)

    [0163] (S)-2-((S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-(pyridin-2-yl)propanamido)-5,5-dimethylhexanoic acid, resin bound (Int-26, 50.0 mg, 50.0 ?mol) was swollen in DMF (1 mL) for 10 minutes and then filtered. 20% piperidine in DMF (5 mL) was added to the swollen resin and the suspension was agitated with nitrogen gas at room temperature for 20 minutes. The suspension was filtered and washed with DMF (5 mL?2), DCM (5 mL?2), water (5 mL?2), DCM (5 mL?2) and DMF (5 mL?3). The obtained solid was used without further purification.

    [0164] DCM (2.6 mL) and DMF (0.4 mL) were added followed by (S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-3-(4-(tert-butoxy)phenyl)propanoic acid (Int-19, 92.0 mg, 0.20 mmol), HATU (76.0 mg, 0.20 mmol) and 4-methylmorpholine (22.0 ?L, 0.20 mmol). The reaction was stirred gently at room temperature for 3 days under an atmosphere of nitrogen then filtered and washed with DMF (5 mL?2), DCM (5 mL?2), water (5 mL?2), DCM (5 mL?2) and DMF (5 mL?3) to afford Int-27. A small portion of the resin was added to TFA (0.05 mL) and stirred at room temperature for 30 minutes. The suspension was diluted with DCM (5 mL), filtered and the filtrate was concentrated in vacuo to obtain (5S,8S,11S)-11-(3,3-dimethylbutyl)-1-(9H-fluoren-9-yl)-5-(4-hydroxybenzyl)-3,6,9-trioxo-8-(pyridin-2-ylmethyl)-2-oxa-4,7,10-triazadodecan-12-oic acid (86% purity) which was analysed by LCMS. LCMS (Method 2, 1.56 min; M+H=693.3).

    Synthesis of (S)-2-((S)-2-((S)-3-(4-(tert-Butoxy)phenyl)-2-((S)-1-(tert-butoxycarbonyl)pyrrolidine-2-carboxamido)propanamido)-3-(pyridin-2-yl)propanamido)-5,5-dimethylhexanoic acid (Int-29)

    [0165] (5S,8S,11 S)-5-(4-(tert-Butoxy)benzyl)-11-(3,3-dimethylbutyl)-1-(9H-fluoren-9-yl)-3,6,9-trioxo-8-(pyridin-2-ylmethyl)-2-oxa-4,7,10-triazadodecan-12-oic acid, resin bound (Int-27, 50.0 mg, 0.05 mmol) was swollen in DMF (5 mL) for 10 minutes and then filtered. 20% piperidine in DMF (5 mL) was added to the swollen resin and the suspension was agitated with nitrogen gas at room temperature for 20 minutes. The suspension was filtered and washed with DMF (5 mL?2), DCM (5 mL?2), water (5 mL?2), DCM (5 mL?2) and DMF (5 mL?3). The obtained solid was used without further purification.

    [0166] DCM (2.6 mL) and DMF (0.4 mL) were added followed by (tert-butoxycarbonyl)-L-proline (Int-28, 43.0 mg, 0.20 mmol), HATU (76.0 mg, 0.20 mmol) and 4-methylmorpholine (22.0 ?L, 0.20 mmol). The reaction was stirred gently for 20 hours under an atmosphere of nitrogen. The suspension was filtered and washed with DMF (5 mL?2), DCM (5 mL?2), water (5 mL?2), DCM (5 mL?2) and DMF (5 mL?3) to afford Int-29. No analysis was undertaken at this stage and resin was used directly in the next step.

    Synthesis of (S)-2-((S)-2-((S)-3-(4-Hydroxyphenyl)-2-((S)-pyrrolidine-2-carboxamido)propanamido)-3-(pyridin-2-yl)propanamido)-5,5-dimethylhexanoic acid (Example 5)

    [0167] TFA (0.38 mL, 5.00 mmol) was added to (S)-2-((S)-2-((S)-3-(4-(tert-butoxy)phenyl)-2-((S)-1-(tert-butoxycarbonyl)pyrrolidine-2-carboxamido)propanamido)-3-(pyridin-2-yl)propanamido)-5,5-dimethylhexanoic acid, resin bound (Int-29, 50.0 mg, 50.0 ?mol) and stirred at room temperature for 3 hours. The suspension was filtered, washing with DCM (5 mL?3) and the filtrate was concentrated in vacuo and azeotroped with toluene (5 mL?3). The crude product was purified by preparative HPLC to obtain (S)-2-((S)-2-((S)-3-(4-hydroxyphenyl)-2-((S)-pyrrolidine-2-carboxamido)propanamido)-3-(pyridin-2-yl)propanamido)-5,5-dimethylhexanoic acid (Example 5, 2.00 mg, 3.00 ?mol, 7.0% yield, 97% purity by .sup.1H NMR) as a colourless solid. LCMS purity not confirmed due to weak chromophore. (Method 2, 1.18 min; M+H=568.3). H NMR (500 MHz, DMSO-d6) ? 12.70 (s, 1H), 9.21 (s, 1H), 9.13 (s, 1H), 8.57 (d, J=8.5 Hz, 1H), 8.46-8.43 (m, 2H), 8.41-8.38 (m, 1H), 8.36 (d, J=8.4 Hz, 1H), 8.30 (d, J=7.7 Hz, 1H), 7.29 (d, J=5.9 Hz, 1H), 7.01 (d, J=8.5 Hz, 2H), 6.64-6.61 (m, 2H), 4.73-4.65 (m, 1H), 4.50-4.43 (m, 1H), 4.21-4.13 (m, 1H), 4.07-4.01 (m, 1H), 3.24-3.10 (m, 3H), 3.07 (dd, J=14.0, 4.4 Hz, 1H), 2.88 (dd, J=14.1, 4.0 Hz, 1H), 2.82 (dd, J=14.0, 9.5 Hz, 1H), 2.64-2.54 (m, 1H), 2.26-2.16 (m, 1H), 1.91-1.65 (m, 3H), 1.64-1.54 (m, 1H), 1.27-1.17 (m, 2H), 0.86 (s, 9H).

    TABLE-US-00004 TABLE 2 Intermediates Int-30 to Int-39 were prepared from the corresponding starting material by a manner analogous to Intermediate Int-26. LC-MS Inter- Structure (after removal mediate Structure (after removal from resin) from resin) Int-30 [00017]embedded image [00018]embedded image Method 2, 1.67 min; M + H = 530.2 Int-31 [00019]embedded image [00020]embedded image Method 2, 1.65 min; M + H = 530.3 Int-32 [00021]embedded image The resin bound intermediate was used in the next reaction without analysis n/a Int-33 [00022]embedded image The resin bound intermediate was used in the next reaction without analysis n/a Int-34 [00023]embedded image [00024]embedded image Method 2, 1.64 min; M + H = 538.3 Int-35 [00025]embedded image The resin bound intermediate was used in the next reaction without analysis n/a Int-36 [00026]embedded image The resin bound intermediate was used in the next reaction without analysis n/a Int-37 [00027]embedded image [00028]embedded image Method 2, 1.17 min; M + H = 495.5 Int-38 [00029]embedded image [00030]embedded image Method 2, 1.53 min; M + H = 533.3 Int-39 [00031]embedded image The resin bound intermediate was used in the next reaction without analysis n/a

    TABLE-US-00005 TABLE 3 Intermediates Int-40 to Int-53 was prepared from the corresponding starting material by a manner analogous to Intermediate Int-27. LC-MS Inter- (after medi- Structure removal ate Structure (after removal from resin) from resin) Int-40 [00032]embedded image [00033]embedded image Method 2, 1.64 min; M + H = 693.3 Int-41 [00034]embedded image [00035]embedded image Method 2, 1.63 min; M + H = 693.3 Int-42 [00036]embedded image [00037]embedded image Method 2, 1.68 min; M + H = 698.3 Int-43 [00038]embedded image [00039]embedded image Method 2, 1.56 min; M + H = 650.3 Int-44 [00040]embedded image [00041]embedded image Method 2, 1.54 min; M + H = 664.3 Int-45 [00042]embedded image [00043]embedded image Method 2, 1.60 min; M + H = 699.3 Int-46 [00044]embedded image [00045]embedded image Method 2, 1.57 min; M + H = 701.3 Int-47 [00046]embedded image The resin bound intermediate was used in the next reaction without analysis n/a Int-48 [00047]embedded image [00048]embedded image Method 2, 1.77 min; M + H = 594.3 Int-49 [00049]embedded image [00050]embedded image Method 2, 1.69 min; M + H = 552.3 Int-50 [00051]embedded image [00052]embedded image Method 2, 1.71 min; M + H = 566.3 Int-51 [00053]embedded image The resin bound intermediate was used in the next reaction without analysis n/a Int-52 [00054]embedded image [00055]embedded image Method 2, 1.52 min; M + H = 696.3 Int-53 [00056]embedded image The resin bound intermediate was used in the next reaction without analysis n/a

    TABLE-US-00006 TABLE 4 The following examples, were prepared from the corresponding starting material by a manner analogous to Example 5. Ex- am- ple Yield Purity No. Structure Name (%) (LC-MS) Purity [NMR] 6 [00057]embedded image (S)-2-((S)-2-((S)-3-(4- Hydroxyphenyl)-2- ((S)-pyrrolidine-2- carboxamido)propan amido)-3-(pyridin-3- yl)propanamido)-5,5- dimethylhexanoic acid 6.0 97% (Method 2, 1.10 min; M + H = 568.3) 97% [.sup.1H NMR (500 MHz, DMSO-d6) ? 9.17 (s, 1H), 8.46- 8.41 (m, 2H), 8.39 (dd, J = 4.8, 1.7 Hz, 1H), 8.32-8.26 (m, 2H), 7.68-7.64 (m, 1H), 7.26 (dd, J = 7.8, 4.7 Hz, 1H), 6.99 -6.96 (m, 2H), 6.63- 6.59 (m, 2H), 6.53 (s, 1H), 4.68-4.61 (m, 1H), 4.51-4.44 (m, 1H), 4.20-4.12 (m, 1H), 3.94-3.87 (m, 1H), 3.08-3.01 (m, 3H), 2.91-2.77 (m, 2H), 2.65-2.52 (m, 1H), 2.19-2.07 (m, 1H), 1.81-1.54 (m, 5H), 1.25-1.18 (m, 2H), 0.87 (s, 9H), CO.sub.2H peak not observed.] 7 [00058]embedded image (S)-2-((S)-2-((S)-3-(4- Hydroxyphenyl)-2- ((S)-pyrrolidine-2- carboxamido)propan amido)-3-(1-methyl- 1H-imidazol-4- yl)propanamido)-5,5- dimethylhexanoic acid 8.0 95% (Method 2, 1.11 min; M + H = 571.3) 80% [.sup.1H NMR (400 MHz, DMSO-d6) ? 9.17 (s, 1H), 8.44 (d, J = 8.3 Hz, 1H), 8.31 (d, J = 7.9 Hz, 1H), 8.16 (s, 1H), 8.10 (d, J = 7.5 Hz, 1H), 7.53 (s, 1H), 7.02-6.97 (m, 2H), 6.86 (s, 1H), 6.65-6.60 (m, 2H), 4.55-4.39 (m, 2H), 4.13-4.03 (m, 1H), 3.90-3.83 (m, 1H), 3.58 (s, 3H), 3.06- 2.92 (m, 3H), 2.90- 2.76 (m, 2H), 2.73- 2.60 (m, 1H), 2.18- 2.05 (m, 1H), 1.77- 1.63 (m, 5H), 1.61- 1.48 (m, 1H), 1.26- 1.03 (m, 2H), 0.84 (s, 9H), CO.sub.2H peak not observed] 8 [00059]embedded image (S)-2-((S)-2-((S)-3-(4- Hydroxyphenyl)-2- ((S)-pyrrolidine-2- carboxamido)propan amido)-3-(pyridin-4- yl)propanamido)-5,5- dimethylhexanoic acid 5.0 Purity unconfirmed due to weak chromophore (Method 2, 1.09 min; M + H = 568.3) 90% [.sup.1H NMR (500 MHz, DMSO-d6) ? 12.70 (br s, 1H), 9.21 (s, 1H), 9.13 (br s, 1H), 8.57 (d, J = 8.5 Hz, 1H), 8.46-8.43 (m, 2H), 8.41-8.38 (m, 1H), 8.36 (d, J = 8.4 Hz, 1H), 8.30 (d, J = 7.7 Hz, 1H), 7.29 (d, J = 5.9 Hz, 1H), 7.01 (d, J = 8.5 Hz, 2H), 6.64-6.61 (m, 2H), 4.73-4.65 (m, 1H), 4.50-4.43 (m, 1H), 4.21-4.13 (m, 1H), 4.07-4.01 (m, 1H), 3.24-3.10 (m, 3H), 3.07 (dd, J = 14.0, 4.4 Hz, 1H), 2.88 (dd, J = 14.1, 4.0 Hz, 1H), 2.82 (dd, J = 14.0, 9.5 Hz, 1H), 2.64-2.54 (m, 1H), 2.26-2.16 (m, 1H), 1.91-1.65 (m, 3H), 1.64-1.54 (m, 1H), 1.27-1.17 (m, 2H), 0.86 (s, 9H), containing 8.4% NH.sub.4Cl.] 9 [00060]embedded image (S)-2-((S)-2-((S)-3-(4- Hydroxyphenyl)-2- ((S)-pyrrolidine-2- carboxamido)propan amido)-3-(thiophen- 3-yl)propanamido)- 5,5-dimethylhexanoic acid 3.0 Purity unconfirmed due to weak chromophore (Method 2, 1.31 min; M + H = 573.2) 97% [.sup.1H NMR (500 MHz, DMSO-d6) ? 8.32 (d, J = 8.4 Hz, 1H), 8.24 (s, 1H), 8.02- 7.97 (m, 2H), 7.42- 7.38 (m, 1H), 7.19 (d, J = 2.6 Hz, 1H), 7.01 (d, J = 5.1 Hz, 1H), 6.89 (d, J = 8.4 Hz, 2H), 6.58 (d, J = 8.3 Hz, 2H), 4.52- 4.48 (m, 2H), 4.47- 4.40 (m, 1H), 4.03- 3.94 (m, 1H), 3.48- 3.43 (m, 2H), 3.08- 3.00 (m, 1H), 2.91- 2.76 (m, 2H), 2.69- 2.60 (m, 1H), 1.88- 1.75 (m, 1H), 1.75- 1.62 (m, 1H), 1.61- 1.52 (m, 1H), 1.51- 1.43 (m, 2H), 1.42- 1.33 (m, 1H), 1.20- 1.12 (m, 3H), 0.84 (s, 9H). CO.sub.2H peak not observed.] 10 [00061]embedded image (S)-2-((S)-2-((S)-4- Amino-4-oxo-2-((S)- pyrrolidine-2- carboxamido)butan- amido)-3-(thiazol-4- yl)propanamido)-5,5- dimethylhexanoic acid 7.0 93% (Method 2, 1.01 min; M + H = 525.2) 97% [.sup.1H NMR (500 MHz, DMSO-d6) ? 9.02-8.98 (m, 1H), 8.39-8.35 (m, 1H), 8.28-8.23 (m, 1H), 7.90 (d, J = 7.2 Hz, 1H), 7.44 (s, 1H), 7.34-7.30 (m, 1H), 6.89 (s, 1H), 4.59- 4.53 (m, 1H), 4.47- 4.40 (m, 1H), 4.12- 4.09 (m, 1H), 3.98- 3.90 (m, 1H), 3.66- 3.59 (m, 1H), 3.28- 3.22 (m, 1H), 3.18- 3.15 (m, 2H), 3.10- 3.01 (m, 1H), 2.94- 2.86 (m, 1H), 2.84- 2.76 (m, 1H), 2.48- 2.44 (m, 2H), 2.00- 1.90 (m, 1H), 1.74- 1.51 (m, 2H), 1.17- 1.05 (m, 3H), 0.83 (d, J = 3.0 Hz, 9H), containing 0.5% MeCN, CO.sub.2H peak not observed.] 11 [00062]embedded image (S)-2-((S)-2-((S)-5- Amino-5-oxo-2-((S)- pyrrolidine-2- carboxamido)pentan amido)-3-(thiazol-4- yl)propanamido)-5,5- dimethylhexanoic acid 7.0 Purity unconfirmed due to weak chromophore (Method 2, 0.99 min; M + H = 539.2) 97% [.sup.1H NMR (500 MHz, DMSO-d6) ? 9.00 (d, J = 2.0 Hz, 1H), 8.45 (d, J = 8.0 Hz, 1H), 8.29 (d, J = 8.2 Hz, 1H), 8.16 (s, 1H), 8.08 (d, J = 7.4 Hz, 1H), 7.37-7.33 (m, 1H), 7.32 (d, J = 2.0 Hz, 1H), 6.77- 6.74 (m, 1H), 4.70- 4.63 (m, 1H), 4.27- 4.21 (m, 1H), 4.09- 4.02 (m, 1H), 3.97- 3.90 (m, 1H), 3.22 (dd, J = 14.9, 4.4 Hz, 1H), 3.09-2.96 (m, 3H), 2.17-2.02 (m, 3H), 1.91-1.81 (m, 1H), 1.80-1.71 (m, 4H), 1.71-1.64 (m, 1H), 1.60-1.51 (m, 1H), 1.20-1.10 (m, 2H), 0.84 (s, 9H). CO.sub.2H peak not observed.] 12 [00063]embedded image (S)-2-((S)-2-((S)-3-(4- Hydroxyphenyl)-2- ((S)-pyrrolidine-2- carboxamido)propan amido)-3-(thiazol-4- yl)propanamido)-5,5- dimethylhexanoic acid 10 91%, weak chromophore (Method 2, 1.17 min; M + H = 574.3) 98% [.sup.1H NMR (500 MHz, DMSO-d6) ? 9.14 (s, 1H), 9.01 (d, J = 2.0 Hz, 1H), 8.39 (d, J = 8.4 Hz, 1H), 8.19 (s, 1H), 8.09 (d, J = 8.6 Hz, 1H), 8.03 (d, J = 7.3 Hz, 1H), 7.33 (d, J = 2.0 Hz, 1H), 6.94-6.87 (m, 2H), 6.62-6.56 (m, 2H), 4.72-4.65 (m, 1H), 4.44-4.36 (m, 1H), 4.08-4.00 (m, 1H), 3.54 (dd, J = 8.9, 4.8 Hz, 1H), 3.22 (dd, J = 14.9, 4.7 Hz, 1H), 3.08-3.00 (m, 1H), 2.92-2.80 (m, 2H), 2.70-2.61 (m, 1H), 1.92-1.84 (m, 1H), 1.76-1.65 (m, 1H), 1.63-1.49 (m, 4H), 1.47-1.38 (m, 1H), 1.20-1.09 (m, 2H), 0.84 (s, 9H). CO.sub.2H peak not observed.] 13 [00064]embedded image (S)-2-((S)-2-((S)-3-(4- Hydroxyphenyl)-2- ((S)-pyrrolidine-2- carboxamido)propan amido)-3- morpholinopropan- amido)-5,5- dimethylhexanoic acid 8.0 84%, weak chromophore (Method 2, 1.09 min; M + H = 576.4) 95% [.sup.1H NMR (500 MHz, Methanol-d4) ? 8.28-8.15 (m, 3H), 7.14-7.10 (m, 2H), 6.75-6.71 (m, 2H), 4.70-4.64 (m, 1H), 4.62-4.56 (m, 1H), 4.38 (dd, J = 7.5, 4.9 Hz, 1H), 4.25-4.17 (m, 1H), 3.82-3.70 (m, 4H), 3.44-3.36 (m, 1H), 3.33-3.26 (m, 1H), 3.17 (dd, J = 14.3, 5.0 Hz, 1H), 2.91-2.80 (m, 2H), 2.79-2.62 (m, 5H), 2.48-2.39 (m, 1H), 2.14-1.99 (m, 3H), 1.96-1.84 (m, 1H), 1.81-1.70 (m, 1H), 1.37-1.30 (m, 2H), 0.94 (s, 9H). CO.sub.2H, OH and NH peaks not observed.] 14 [00065]embedded image (S)-2-((S)-2-((S)-3-(4- Hydroxyphenyl)-2- ((S)-pyrrolidine-2- carboxamido)propan amido)-3-(1H-indol-3- yl)propanamido)-5,5- dimethylhexanoic acid 2.5 99% (Method 1, 0.92 min; M + H = 606.1) 95% [.sup.1H NMR (500 MHz, DMSO-d6) ? 10.82-10.78 (m, 1H), 9.16-9.08 (m, 1H), 8.24 (d, J = 8.3 Hz, 1H), 8.18 (s, 1H), 8.09 (d, J = 7.4 Hz, 1H), 7.98 (d, J = 8.6 Hz, 1H), 7.60 (d, J = 7.9 Hz, 1H), 7.32- 7.29 (m, 1H), 7.14- 7.13 (m, 1H), 7.07- 7.03 (m, 1H), 6.99- 6.95 (m, 1H), 6.89- 6.84 (m, 2H), 6.59- 6.55 (m, 2H), 4.62- 4.56 (m, 1H), 4.46- 4.39 (m, 1H), 4.12- 4.05 (m, 1H), 3.46- 3.43 (m, 1H), 3.17- 3.14 (m, 1H), 2.96- 2.93 (m, 1H), 2.87 (dd, J = 14.0, 4.4 Hz, 1H), 2.80 (dt, J = 10.2, 6.5 Hz, 1H), 2.65-2.57 (m, 2H), 2.37-2.34 (m, 1H), 1.88-1.79 (m, 1H), 1.76-1.65 (m, 1H), 1.63-1.53 (m, 1H), 1.52-1.36 (m, 2H), 1.22-1.16 (m, 2H), 1.16-1.14 (m, 1H), 0.85 (s, 9H), containing 5% DCM, CO.sub.2H peak not observed] 15 [00066]embedded image (2S)-5,5-Dimethyl-2- ((3S)-3-methyl-2- ((S)-3-methyl-2-((S)- pyrrolidine-2- carboxamido)butan- amido)pentanamido) hexanoic acid 10 Purity unconfirmed due to weak chromophore (Method 2, 1.28 min; M + H = 469.3) 92% [.sup.1H NMR (500 MHz, DMSO-d6) ? 8.66 (s, 1H), 8.15 (d, J = 9.6 Hz, 1H), 8.13- 8.04 (m, 1H), 4.28 (dd, J = 9.5, 5.8 Hz, 1H), 4.16-4.08 (m, 1H), 3.94-3.85 (m, 1H), 3.59-3.54 (m, 1H), 2.95-2.86 (m, 1H), 2.80-2.72 (m, 1H), 2.03-1.91 (m, 2H), 1.77-1.64 (m, 1H), 1.63-1.57 (m, 1H), 1.55-1.48 (m, 1H), 1.43-1.39 (m, 1H), 1.14-1.02 (m, 4H), 0.84-0.78 (m, 20H), 0.74 (d, J = 6.8 Hz, 3H), containing 4.8% DCM and 2.6% MeCN, NH and CO.sub.2H peaks not observed.] 16 [00067]embedded image (2S)-5,5-Dimethyl-2- ((3S)-3-methyl-2-(2- ((S)-pyrrolidine-2- carboxamido) acetamido) pentanamido) hexanoic acid 26 Purity unconfirmed due to weak chromophore (Method 2, 1.18 min; M + H = 427.3) 97% [.sup.1H NMR (500 MHz, DMSO-d6) ? 8.34 (t, J = 5.7 Hz, 1H), 7.96-7.87 (m, 2H), 4.19 (dd, J = 8.8, 6.7 Hz, 1H), 4.01- 3.94 (m, 1H), 3.82 (dd, J = 16.5, 5.9 Hz, 1H), 3.75-3.69 (m, 1H), 3.68-3.62 (m, 1H), 2.94-2.89 (m, 1H), 2.88-2.81 (m, 1H), 2.02-1.92 (m, 1H), 1.79-1.68 (m, 2H), 1.67-1.59 (m, 3H), 1.58-1.50 (m, 1H), 1.46-1.37 (m, 1H), 1.19-1.12 (m, 2H), 1.12-1.01 (m, 1H), 0.86-0.82 (m, 12H), 0.80 (t, J = 7.4 Hz, 3H), containing 1.1% DCM and 1.1% MeCN. NH and CO.sub.2H peaks not observed.] 17 [00068]embedded image (2S)-5,5-Dimethyl-2- ((3S)-3-methyl-2- ((S)-2-((S)- pyrrolidine-2- carboxamido)propan amido)pentanamido) hexanoic acid 10 Purity unconfirmed due to weak chromophore (Method 2, 1.18 min; M + H = 441.3) 95% [.sup.1H NMR (500 MHz, DMSO-d6) ? 8.34-8.28 (m, 1H), 8.16 (s, 1H), 8.00- 7.95 (m, 1H), 7.92 (d, J = 8.9 Hz, 1H), 4.41-4.33 (m, 1H), 4.24-4.18 (m, 1H), 4.12-4.03 (m, 1H), 3.74-3.67 (m, 1H), 2.97-2.85 (m, 3H), 2.06-1.99 (m, 1H), 1.77-1.62 (m, 6H), 1.59-1.50 (m, 1H), 1.48-1.38 (m, 1H), 1.19 (d, J = 7.0 Hz, 3H), 1.17-1.12 (m, 2H), 1.10-1.02 (m, 1H), 0.85-0.83 (m, 11H), 0.80 (t, J = 7.4 Hz, 3H), containing 3.3% DCM and 1.1% MeCN. CO.sub.2H peak not observed] 18 [00069]embedded image (S)-2-((2S,3S)-2-((S)- 3-(4-Hydroxyphenyl)- 2-((R)-piperazine-2- carboxamido)propan amido)-3- methylpentanamido)- 5,5-dimethylhexanoic acid 45 100% (Method 1, 0.78 min; M + H = 548.4) 95% [.sup.1H NMR (500 MHz, DMSO-d6) ? 9.23 (br s, 1H), 8.35 (d, J = 8.9 Hz, 1H), 8.15 (d, J = 7.6 Hz, 1H), 7.06-6.98 (m, 2H), 6.68-6.61 (m, 2H), 4.73-4.66 (m, 1H), 4.31-4.24 (m, 1H), 4.18-4.08 (m, 1H), 3.74-3.64 (m, 1H), 3.57-3.55 (m, 1H), 3.53-3.40 (m, 3H), 3.04-2.95 (m, 1H), 2.95-2.89 (m, 1H), 2.65-2.53 (m, 2H), 1.80-1.65 (m, 2H), 1.63-1.53 (m, 1H), 1.52-1.42 (m, 1H), 1.26-1.13 (m, 2H), 1.10-1.02 (m, 1H), 0.89-0.86 (m, 3H), 0.85 (s, 9H), 0.84-0.81 (m, 3H), containing 3% TBME, 2xNH, OH and CO.sub.2H peaks not observed] 19 [00070]embedded image (S)-2-((2S,3S)-2-((S)- 3-(4-Hydroxyphenyl)- 2-((S)-piperazine-2- carboxamido)propan amido)-3- methylpentanamido)- 5,5-dimethylhexanoic acid 36 100% (Method 1, 0.77 min; M + H = 548.4) 95% [.sup.1H NMR (500 MHz, DMSO-d6) ? 9.22 (br s, 1H), 8.17- 8.11 (m, 2H), 7.10- 7.04 (m, 2H), 6.69- 6.63 (m, 2H), 4.61- 4.54 (m, 1H), 4.28- 4.22 (m, 1H), 4.16- 4.08 (m, 1H), 3.74- 3.64 (m, 1H), 3.59- 3.54 (m, 1H), 3.53- 3.40 (m, 4H), 2.97- 2.88 (m, 2H), 2.65- 2.62 (m, 1H), 1.77- 1.64 (m, 2H), 1.62- 1.53 (m, 1H), 1.45 (dd, J = 12.8, 6.6 Hz, 1H), 1.26-1.14 (m, 2H), 1.10-1.02 (m, 1H), 0.88-0.84 (m, 12H), 0.84-0.80 (m, 3H), containing 2% TBME, 2xNH, OH and CO.sub.2H peaks not observed] 20 [00071]embedded image (S)-2-((2S,3S)-2-((S)- 3-(4-Hydroxyphenyl)- 2-((S)-pyrrolidine-3- carboxamido)propan amido)-3- methylpentanamido)- 5,5-dimethylhexanoic acid 65 95% (Method 2, 1.07 min; M + H = 533.3) 98% [.sup.1H NMR (500 MHz, DMSO-d6) ? 9.16 (s, 1H), 8.66 (br s, 1H), 8.31 (d, J = 8.7 Hz, 1H), 8.11 (d, J = 7.5 Hz, 1H), 7.97 (d, J = 9.0 Hz, 1H), 7.04-7.00 (m, 2H), 6.63-6.60 (m, 2H), 4.62-4.55 (m, 1H), 4.28-4.21 (m, 1H), 4.16-4.09 (m, 1H), 3.21-3.16 (m, 2H), 3.10-3.03 (m, 2H), 3.00-2.89 (m, 2H), 2.66-2.55 (m, 1H), 2.04-1.95 (m, 1H), 1.79-1.65 (m, 2H), 1.63-1.51 (m, 2H), 1.49-1.40 (m, 1H), 1.26-1.13 (m, 2H), 1.12-1.01 (m, 1H), 0.88-0.84 (m, 12H), 0.84-0.80 (m, 3H). CO.sub.2H peak not observed] 21 [00072]embedded image (S)-2-((2S,3S)-2-((S)- 3-(4-Hydroxyphenyl)- 2-((R)-pyrrolidine-3- carboxamido)propan amido)-3- methylpentanamido)- 5,5-dimethylhexanoic acid 47 97% (Method 2, 1.06 min; M + H = 533.3) 97% [.sup.1H NMR (500 MHz, DMSO-d6) ? 9.17 (s, 1H), 8.69 (br s, 1H), 8.34 (d, J = 8.5 Hz, 1H), 8.11 (d, J = 7.5 Hz, 1H), 7.89 (d, J = 8.9 Hz, 1H), 7.05-7.01 (m, 2H), 6.66-6.60 (m, 2H), 4.54-4.45 (m, 1H), 4.30-4.22 (m, 1H), 4.14-4.08 (m, 1H), 3.21-3.03 (m, 4H), 2.99-2.95 (m, 1H), 2.92-2.87 (m, 1H), 2.65-2.58 (m, 1H), 2.13-2.05 (m, 1H), 1.95-1.87 (m, 1H), 1.77-1.64 (m, 2H), 1.62-1.52 (m, 1H), 1.49-1.40 (m, 1H), 1.26-1.13 (m, 2H), 1.12-1.02 (m, 1H), 0.87-0.81 (m, 15H). CO.sub.2H peak not observed] 22 [00073]embedded image (S)-2-((2S,3S)-2-((S)- 3-(4-Hydroxyphenyl)- 2-((S)-morpholine-2- carboxamido)propan amido)-3- methylpentanamido)- 5,5-dimethylhexanoic acid 32 100% (Method 1, 0.85 min; M ? H = 547.4) 95% [.sup.1H NMR (500 MHz, DMSO-d6) ? 9.15 (s, 1H), 8.15 (d, J = 8.9 Hz, 1H), 7.91 (br s, 1H), 7.34 (d, J = 8.4 Hz, 1H), 6.94- 6.89 (m, 2H), 6.63- 6.57 (m, 2H), 4.56 (td, J = 8.4, 4.4 Hz, 1H), 4.19 (t, J = 8.1 Hz, 1H), 4.00-3.92 (m, 1H), 3.78-3.74 (m, 1H), 3.72 (dd, J = 10.1, 2.8 Hz, 1H), 2.93 (dd, J = 14.0, 4.3 Hz, 1H), 2.85 (dd, J = 12.4, 2.9 Hz, 1H), 2.74 (dd, J = 14.0, 8.5 Hz, 1H), 2.68- 2.66 (m, 1H), 2.65- 2.62 (m, 1H), 2.59- 2.53 (m, 1H), 2.36 (p, J = 1.9 Hz, 1H), 2.26 (dd, J = 12.4, 10.1 Hz, 1H), 1.79-1.64 (m, 2H), 1.60-1.51 (m, 1H), 1.47-1.38 (m, 1H), 1.20-1.13 (m, 2H), 1.11-1.04 (m, 1H), 0.88-0.76 (m, 15H), containing 1% MeCN, CO.sub.2H peak not observed.] 23 [00074]embedded image (S)-2-((2S,3S)-2-((S)- 3-(4-Hydroxyphenyl)- 2-((R)-morpholine-3- carboxamido)propan amido)-3- methylpentanamido)- 5,5-dimethylhexanoic acid 18 100% (Method 1, 0.84 min; M + H = 549.4) 95% [.sup.1H NMR (500 MHz, DMSO-d6) ? 9.14 (s, 1H), 7.92 (br s, 3H), 6.99-6.93 (m, 2H), 6.63-6.57 (m, 2H), 4.52-4.48 (m, 1H), 4.16 (t, J = 8.3 Hz, 1H), 4.00- 3.91 (m, 1H), 3.58- 3.46 (m, 3H), 3.24 (dd, J = 8.6, 3.3 Hz, 1H), 3.17 (t, J = 9.7 Hz, 1H), 2.93 (dd, J = 13.4, 4.2 Hz, 1H), 2.76-2.70 (m, 1H), 2.69-2.58 (m, 2H), 2.36 (p, J = 1.8 Hz, 1H), 1.81-1.73 (m, 1H), 1.73-1.65 (m, 1H), 1.61-1.50 (m, 1H), 1.48-1.37 (m, 1H), 1.20-1.12 (m, 2H), 1.12-1.05 (m, 1H), 0.86-0.83 (m, 3H), 0.83 (s, 9H), 0.82-0.78 (m, 3H), containing 1% MeCN, CO.sub.2H peak not observed.] 24 [00075]embedded image (S)-2-((2S,3S)-2-((S)- 3-(4-Hydroxyphenyl)- 2-((S)-morpholine-3- carboxamido)propan amido)-3- methylpentanamido)- 5,5-dimethylhexanoic acid 7.7 100% (Method 1, 0.82 min; M + H = 549.4) 95% [.sup.1H NMR (500 MHz, DMSO-d6) ? 9.14 (s, 1H), 8.09- 7.99 (m, 2H), 7.80 (d, J = 8.2 Hz, 1H), 6.98- 6.92 (m, 2H), 6.64- 6.58 (m, 2H), 4.52 (td, J = 8.4, 4.5 Hz, 1H), 4.24-4.19 (m, 1H), 4.09-4.00 (m, 1H), 3.58 (dd, J = 10.9, 3.6 Hz, 2H), 3.53 (dt, J = 11.0, 3.6 Hz, 2H), 3.17 (dd, J = 7.9, 3.6 Hz, 1H), 2.92 (dd, J = 14.0, 4.5 Hz, 1H), 2.72 (dd, J = 14.0, 8.5 Hz, 1H), 2.66-2.56 (m, 2H), 2.36 (p, J = 1.9 Hz, 1H), 1.78-1.63 (m, 2H), 1.63-1.51 (m, 1H), 1.49-1.38 (m, 1H), 1.25-1.14 (m, 2H), 1.11-1.00 (m, 1H), 0.86-0.83 (m, 12H), 0.81 (t, J = 7.4 Hz, 3H), containing 1% MeCN. CO.sub.2H peak not observed.] 25 [00076]embedded image (S)-2-((2S,3S)-2-((S)- 2-((R)-4- Acetylmorpholine-2- carboxamido)-3-(4- hydroxyphenyl) propanamido)-3- methylpentanamido)- 5,5-dimethylhexanoic acid 19 100% (Method 1, 1.17 min; M + H = 591.7) 100% [.sup.1H NMR (500 MHz, DMSO-d6, VT = 90? C.) ? 8.79 (s, 1H), 7.75 (d, J = 7.6 Hz, 1H), 7.67 (d, J = 8.9 Hz, 1H), 7.53- 7.44 (m, 1H), 7.00- 6.94 (m, 2H), 6.66- 6.61 (m, 2H), 4.59 (td, J = 8.3, 4.9 Hz, 1H), 4.30-4.24 (m, 1H), 4.23-4.17 (m, 1H), 3.89 (d, J = 12.0 Hz, 4H), 3.55-3.46 (m, 1H), 2.97-2.94 (m, 3H), 2.81 (dd, J = 14.1, 8.4 Hz, 1H), 2.00 (s, 3H), 1.82- 1.69 (m, 2H), 1.65- 1.57 (m, 1H), 1.53- 1.46 (m, 1H), 1.24 (dt, J = 10.7, 4.9 Hz, 2H), 1.12 (dt, J = 14.8, 8.2 Hz, 1H), 0.91- 0.84 (m, 15H), CO.sub.2H proton not observed.] 26 [00077]embedded image (S)-2-((2S,3S)-2-((S)- 3-(4-Hydroxyphenyl)- 2-((S)- tetrahydrofuran-2- carboxamido)propan amido)-3- methylpentanamido)- 5,5-dimethylhexanoic acid 23 100% (Method 1, 1.26 min; M + H 534.5) 100% [.sup.1H NMR (500 MHz, DMSO-d6) ? 12.50 (br s, 1H), 9.13 (s, 1H), 8.19-8.10 (m, 1H), 8.00 (d, J = 9.0 Hz, 1H), 7.56 (d, J = 8.7 Hz, 1H), 6.99- 6.91 (m, 2H), 6.64- 6.58 (m, 2H), 4.53 (td, J = 8.9, 4.2 Hz, 1H), 4.27 (dd, J = 9.1, 7.5 Hz, 1H), 4.18- 4.07 (m, 2H), 3.78- 3.65 (m, 2H), 2.89 (dd, J = 13.7, 4.3 Hz, 1H), 2.76 (dd, J = 13.7, 9.3 Hz, 1H), 2.05-1.94 (m, 1H), 1.79-1.64 (m, 3H), 1.64-1.54 (m, 2H), 1.55-1.40 (m, 2H), 1.26-1.14 (m, 2H), 1.12-1.02 (m, 1H), 0.89-0.79 (m, 15H).] 27 [00078]embedded image (S)-2-((2S,3S)-2-((S)- 3-(4-Hydroxyphenyl)- 2-((R)- tetrahydrofuran-2- carboxamido)propan amido)-3- methylpentanamido)- 5,5-dimethylhexanoic acid 15 100% (Method 1, 1.26 min; M + H = 534.5) 100% [.sup.1H NMR (500 MHz, DMSO-d6) ? 9.14 (s, 1H), 8.11- 7.95 (m, 1H), 7.92- 7.86 (m, 1H), 7.63 (d, J = 8.4 Hz, 1H), 6.98-6.92 (m, 2H), 6.63-6.58 (m, 2H), 4.53-4.45 (m, 1H), 4.25-4.19 (m, 1H), 4.13 (dd, J = 8.2, 4.6 Hz, 1H), 4.07-3.98 (m, 1H), 3.88-3.80 (m, 1H), 3.75-3.68 (m, 1H), 2.96-2.87 (m, 1H), 2.81-2.73 (m, 1H), 2.06-1.95 (m, 1H), 1.78-1.62 (m, 5H), 1.62-1.50 (m, 1H), 1.48-1.40 (m, 1H), 1.23-1.13 (m, 2H), 1.12-1.00 (m, 1H), 0.87-0.78 (m, 15H), no CO.sub.2H proton observed.] 28 [00079]embedded image (S)-2-((2S,3S)-2-((S)- 2-Acetamido-3-(4- hydroxyphenyl) propanamido)-3- methylpentanamido)- 5,5-dimethylhexanoic acid 21 100% (Method 1, 1.16 min; M + H = 478.6) 100% [.sup.1H NMR (500 MHz, DMSO-d6) ? 12.51 (br s, 1H), 9.12 (s, 1H), 8.08-8.03 (m, 1H), 7.99 (d, J = 8.4 Hz, 1H), 7.83 (d, J = 9.0 Hz, 1H), 7.05- 6.99 (m, 2H), 6.65- 6.59 (m, 2H), 4.49- 4.43 (m, 1H), 4.27- 4.20 (m, 1H), 4.13- 4.06 (m, 1H), 2.88- 2.81 (m, 1H), 2.65- 2.58 (m, 1H), 1.74 (s, 3H), 1.73-1.64 (m, 2H), 1.61-1.53 (m, 1H), 1.47-1.39 (m, 1H), 1.23-1.13 (m, 2H), 1.08-1.01 (m, 1H), 0.88-0.79 (m, 15H).] 29 [00080]embedded image (S)-2-((2S,3S)-2-((S)- 3-(4-Hydroxyphenyl)- 2-((R)-pyrrolidine-2- carboxamido) propanamido)-3- methylpentanamido)- 5,5-dimethylhexanoic acid 39 98% (Method 2, 1.12 min; M + H = 533.3) 97% [.sup.1H NMR (400 MHz, DMSO-d6) ? 9.16 (s, 1H), 8.57- 8.50 (m, 1H), 8.21- 8.15 (m, 1H), 8.13- 8.07 (m, 1H), 7.00 (d, J = 8.2 Hz, 2H), 6.62 (d, J = 8.2 Hz, 2H), 4.72-4.62 (m, 1H), 4.30-4.21 (m, 1H), 4.18-4.07 (m, 1H), 4.05-3.96 (m, 1H), 3.11-3.03 (m, 2H), 2.97-2.89 (m, 1H), 2.63-2.54 (m, 1H), 2.11-2.02 (m, 1H), 1.78-1.65 (m, 3H), 1.64-1.53 (m, 1H), 1.52-1.34 (m, 1H), 1.28-1.14 (m, 3H), 1.13-1.02 (m, 1H), 0.91-0.79 (m, 17H). CO.sub.2H peak not observed] 30 [00081]embedded image (S)-2-((2S,3S)-2-((S)- 3-(4-Hydroxyphenyl)- 2-((R)-morpholine-2- carboxamido)propan amido)-3- methylpentanamido)- 5,5-dimethylhexanoic acid 41 98% (Method 2, 1.03 min; M + H = 549.3) 97% [.sup.1H NMR (500 MHz, DMSO-d6) ? 9.16 (s, 1H), 8.18 (d, J = 7.4 Hz, 1H), 8.05 (d, J = 9.0 Hz, 1H) 7.73 (d, J = 8.2 Hz, 1H), 6.96-6.91 (m, 2H), 6.63-6.59 (m, 2H), 4.59-4.52 (m, 1H), 4.28-4.23 (m, 1H), 4.15-4.07 (m, 1H), 4.05-3.94 (m, 2H), 3.71-3.63 (m, 1H), 3.24-3.17 (m, 1H), 3.09-3.02 (m, 1H), 2.95-2.87 (m, 1H), 2.80-2.72 (m, 2H), 1.77-1.64 (m, 3H), 1.63-1.54 (m, 1H), 1.49-1.42 (m, 1H), 1.28-1.13 (m, 2H), 1.11-1.02 (m, 1H), 0.90-0.85 (m, 12H), 0.85-0.78 (m, 4H). CO.sub.2H proton not observed] 31 [00082]embedded image (S)-2-((2S,3S)-2-((S)- 3-(4-Hydroxyphenyl)- 2-((S)-pyrrolidine-2- carboxamido)propan amido)-3- methylpentanamido)- 5,5-dimethylhexanoic acid 9.3 93% (Method 1, 0.66 min; M + H = 533.4) 93% [.sup.1H NMR (500 MHz, DMSO-d6) ? 12.51 (br s, 1H), 9.19 (s, 1H), 8.65 (d, J = 8.4 Hz, 1H), 8.47- 8.40 (m, 1H), 8.13 (d, J = 7.5 Hz, 1H), 8.04 (d, J = 8.9 Hz, 1H), 7.10-7.02 (m, 2H), 6.70-6.59 (m, 2H), 4.62-4.53 (m, 1H), 4.26 (t, J = 8.2 Hz, 1H), 4.14-4.03 (m, 2H), 3.22-3.08 (m, 2H), 2.94-2.89 (m, 1H), 2.65-2.58 (m, 1H), 2.29-2.23 (m, 1H), 1.89-1.65 (m, 5H), 1.60-1.55 (m, 1H), 1.48-1.39 (m, 1H), 1.23-1.14 (m, 2H), 1.10-1.03 (m, 1H), 0.88-0.79 (m, 15H), containing 1% TBME] 32 [00083]embedded image (S)-2-((S)-2-((S)-3-(4- Hydroxyphenyl)-2- ((S)-pyrrolidine-2- carboxamido)propan amido)-3-(1-methyl- 1H-imidazol-5- yl)propanamido)-5,5- dimethylhexanoic acid.di-formic acid 4.8 90% (Method 1, 0.58 min; M ? H = 569.3) 90% [.sup.1H NMR (500 MHz, DMSO-d6) ? 8.40 (dd, J = 14.6, 8.2 Hz, 1H), 8.22 (d, J = 28.0 Hz, 1H), 8.15 (s, 2H), 8.09-8.04 (m, 1H), 7.95 (d, J = 7.7 Hz, 1H), 7.05- 7.03 (m, 1H), 7.02- 6.98 (m, 2H), 6.68- 6.64 (m, 2H), 4.75- 4.66 (m, 1H), 4.61- 4.50 (m, 1H), 4.24- 4.19 (m, 1H), 4.13- 4.08 (m, 1H), 3.72- 3.68 (m, 3H), 3.29- 3.14 (m, 2H), 3.08 (dd, J = 15.6, 5.7 Hz, 1H), 2.97-2.81 (m, 2H), 2.71 (dd, J = 14.2, 9.5 Hz, 1H), 2.63 (dd, J = 13.9, 9.6 Hz, 1H), 2.31-2.23 (m, 1H), 1.94-1.79 (m, 3H), 1.79-1.51 (m, 2H), 1.26-1.20 (m, 1H), 1.19-1.11 (m, 1H), 0.89-0.84 (m, 9H), OH and CO.sub.2H peaks not observed]

    Biological Data

    Neurotensin Scintillation Proximity Assay

    [0168] The data of exemplified compounds of the invention tested in a Neurotensin (NTS) scintillation proximity assay (SPA). The IC.sub.50 data is shown in Table 6 below. NTS, which is a 13 amino acid neuropeptide, is a sortilin ligand. The IC.sub.50 is a measure of the amount of the compound required to inhibit the binding of NTS to sortilin by 50%. The skilled person will recognise that the lower the IC.sub.50 value, the less of the compound needed to achieve the desired effect, and as a result, the chances of undesirable off-target effects are reduced.

    [0169] Compound affinity was determined by measuring the displacement of [.sup.3H]-neurotensin binding to hSortilin in SPA format. Total volume of 40 ?l in 50 mM HEPES pH 7.4 assay buffer containing 100 mM NaCl, 2.0 mM CaCl2, 0.1% BSA and 0.1% Tween-20. Compound pre-incubation for 30 minutes at room temperature with 150 nM of 6his-Sortilin before 5 nM [3H]-Neurotensin and Ni chelate imaging beads (Perkin Elmer) were added, after 6 hours the plate was read on a ViewLux with 360 s exposure time. Dose-response evaluation of compounds was performed with 8 concentrations of drugs (covering 3 decades). IC.sub.50 values were calculated by nonlinear regression using the sigmoid concentration-response (variable slope) using CDD Vault software. All values reported are average of at least 2 determinations.

    [0170] The data in Table 6 below shows that the compounds disclosed herein are sortilin inhibitors.

    TABLE-US-00007 TABLE 6 Representative Examples IC.sub.50 [3H]Neurotensin SPA Example 1 3170 nM Example 2 2860 nM Example 3 1110 nM Example 4 1690 nM Example 5 270 nM Example 6 90 nM Example 7 370 nM Example 8 200 nM Example 9 140 nM Example 10 90 nM Example 11 60 nM Example 12 70 nM Example 13 160 nM Example 14 60 nM Example 15 250 nM Example 16 80 nM Example 17 70 nM Example 18 110 nM Example 19 100 nM Example 20 150 nM Example 21 180 nM Example 22 70 nM Example 23 100 nM Example 25 140 nM Example 28 190 nM Example 29 110 nM Example 30 90 nM Example 31 90 nM Example 32 100 nM
    X-Ray Derived Pictures of the Compound of Example 12 Bound to h-Sortilin

    Materials and Methods.

    [0171] sSortilin, the luminal domain of sortilin, was obtained as previously described (Andersen et al., Acta Cryst. D, 2017).sup.19. Prior to crystallization 12 ul of 4 mg/ml sSortilin in 50 mM Tris-HCl pH 8.0, 150 mM NaCl was mixed with 1.2 ul of the two compounds INS1767 and INS1783 dissolved in DMSO at concentrations of 16.7 mM and 13.2 mM respectively.

    [0172] Sitting drops were set up by adding 2 ul of the sortilin ligand mixture to 2 ul of reservoir solution composed of 100 mM Hepes pH 7.3, 400 mM malonate pH 7.3, 8% v/v glycerol, 22.5% w/v PEG3350. The sitting drops were left to equilibrate by vapor diffusion with 500 ul reservoir solution.

    [0173] Crystals were mounted in litho-loops without further cryoprotection and were flash cooled in liquid nitrogen.

    [0174] Diffraction data were collected at beamline P13 EMBL/DESY, Hamburg, and processed using the XDS package (Kabsch, W., Acta Cryst. D, 2010).sup.20 (Table 1)

    [0175] Phases for the structure factors were obtained by molecular replacement using the known structure of sortilin (PDB entry: 3F6K) as search model and the program Phaser implemented in the Phenix software package (Afonine et al., Acta Cryst. D, 2012).sup.21. The refined model was obtained by several cycles of model building in Coot (Emsley P. et al., Acta Cryst. D, 2010).sup.22 and maximum likelihood refinement using Phenix. The resulting X-ray derived picture of the compound of Example 12 bound to h-sortilin is shown in FIGS. 1a) and 1b). Refinement statistics and agreement of the models with standard geometry are shown in Table 7 below.

    TABLE-US-00008 TABLE 7 Refinement statistics and agreement of the models with standard geometry (Statistics for the highest resolution shell are shown in parentheses) Example 12 Wavelength Resolution range 36.8-2.8 (2.9-2.8) Space group C 1 2 1 Unit cell (a, b, c) ? 161.64 79.19 112.06 (?, ?, ?) ? 90 126.99 90 Total reflections 190622 (18607) Unique reflections 27873 (2741) Multiplicity 6.8 (6.8) Completeness (%) 99.31 (98.91) Mean I/sigma(I) 14.25 (0.92) Wilson B-factor 94.39 R-merge 0.09358 (2.049) R-meas 0.1014 (2.218) R-pim 0.03868 (0.8429) CC1/2 0.999 (0.447) CC* 1 (0.786) Reflections in refinement 27843 (2732) Reflections used for R-free 1113 (108) R-work 0.2095 (0.5768) R-free 0.2348 (0.6251) CC(work) 0.947 (0.628) CC(free) 0.952 (0.442) Number of non-hydrogen 5350 atoms macromolecules Protein residues 655 RMS(bonds) ? 0.002 RMS(angles) ? 0.43 Ramachandran favored (%) 95.50 Ramachandran allowed (%) 4.34 Ramachandran outliers (%) 0.16 Rotamer outliers (%) 3.51 Clashscore 4.40 Average B-factor 116.47 macromolecules Number of TLS groups 6

    REFERENCES

    [0176] 1. Tauris, J., et al., Proneurotrophin-3 May Induce Sortilin-Dependent Death In Inner Ear Neurons. Eur J Neuroscience (2020), 33(4), pp. 622-31. [0177] 2. Goettsch, C., et al., Sortilin and Its Multiple Roles in Cardiovascular and Metabolic Diseases. Atherosclerosis, Thrombosis and Vascular Biology (2017), 38(1), pp. 19-25. [0178] 3. Willnow, T. E., et al., Sortilins: new players in lipoprotein metabolism. Current Opinion in Lipidology (2011), 22(2), pp. 79-85. [0179] 4. Kjolby, M., et al., Sort1, encoded by the cardiovascular risk locus 1p13.3, is a regulator of hepatic lipoprotein export. Cell Metabolism (2010), 12(3), pp. 213-223. [0180] 5. Jansen, P., et al., Roles for the pro-neurotrophin receptor sortilin in neuronal development, aging and brain injury. Nature Neuroscience (2007), 10(11), pp. 1449-1457. [0181] 6. Tenk, H. K., et al., ProBDNF induces neuronal apoptosis via activation of a receptor complex of p75NTR and sortilin. J Neuroscience (2005), 10(11), pp. 1449-1457. [0182] 7. Nykjaer, A., et al., Sortilin is essential for proNGF-induced neuronal cell death. Nature (2004), 427(6977), pp. 843-848. [0183] 8. Huang, G. et al., Insulin responsiveness of glucose transporter 4 in 3T3-L1 cells depends on the presence of sortilin. Mol Biol Cell (2013), 24(19), pp. 3115-3122. [0184] 9. Pan, X. et al., Sortilin and retromer mediate retrograde transport of Glut4 in 3T3-L1 adipocytes. Mol Biol Cell (2017), 28(12), pp. 1667-1675. [0185] 10. Kaddai, V. et al. Involvement of TNF-? in abnormal adipocyte and muscle sortilin expression in obese mice and humans. Diabetologia (2009) 52, pp. 932-940. [0186] 11. Mortensen, M. B. et al., Targeting sortilin in immune cells reduces proinflammatory cytokines and atherosclerosis. J Clin Invest (2014), 124(12), pp. 5317-5322. [0187] 12. Shi, J. & Kandror, K. V., Sortilin Is Essential and Sufficient for the Formation of Glut4 Storage Vesicles in 3T3-L1 Adipocytes. Developmental Cell (2005), 9, pp. 99-108. [0188] 13. Gao, A. et al., Implications of Sortilin in Lipid Metabolism and Lipid Disorder Diseases. DNA and Cell Biology (2017), 36(12), pp. 1050-1061. [0189] 14. Oh, T. J. et al., Circulating sortilin level as a potential biomarker for coronary atherosclerosis and diabetes mellitus. Cardiovascular Diabetology (2017), 16(92). [0190] 15. Santos, A. M. et al., Sortilin Participates in Light-dependent Photoreceptor Degeneration in Vivo. PLoS ONE (2012), 7(4), pp. e36243-e36243.16. Kuruvilla, R. et al., A neurotrophin signaling cascade coordinates sympathetic neuron development through differential control of TrkA trafficking and retrograde signalling. Cell (2004), 118(2), pp. 243-255. [0191] 17. Skeldal, S. et al., Mapping of the Interaction Site between Sortilin and the p75 Neurotrophin Receptor Reveals a Regulatory Role for the Sortilin Intracellular Domain in p75 Neurotrophin Receptor Shedding and Apoptosis. J Biol Chem (2012), 21(287), pp. 43798-43809. [0192] 18. Wuts, P. G. M. and Greene, T. W, Greene's Protective Groups in Organic Synthesis, 4th Edition, John Wiley and Sons, New York (2006). [0193] 19. Andersen, K R et al., Introducing site-specific cysteines into nanobodies for mercury labelling allows de novo phasing of their crystal structures. Acta Crystallographia Section. D (2017), 73(1), pp. 804-813. [0194] 20. Kabsch, W, XDS. Acta Crystallographia Section. D (2010), 66(2), pp. 125-132. [0195] 21. Afonine, P V et al., Acta Crystallographia Section. D (2012), 68(4), pp. 352-367. [0196] 22. Emsley, P. et al., Acta Crystallographia Section. D (2010), 66(4), pp. 486-501.

    TABLE-US-00009 Sequencesreferencedthroughoutthespecificationandforming partofthedescription SEQIDNO:1(fulllengthsortilin-isoform1) 1 MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRW 51 SGPIGVSWGLRAAAAGGAFPRGGRWRRSAPGEDEECGRVRDFVAKLANNT 101 HQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDY 151 GKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRS 201 SDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWE 251 EIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIG 301 VKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQF 351 YSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGG 401 ETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDA 451 TAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISV 501 MVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFS 551 TDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSY 601 TIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSM 651 CQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLE 701 FCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQ 751 NSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAE 801 ANGVDGVDALDTASHTNKSGYHDDSDEDLLE SEQIDNO:2(fulllengthsortilin-isoform2) 1 MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRW 51 SGPIGVSWGLRAAAAGGAFPRGGRWRRSAPGEDEECGRVRDFVAKLANNT 101 HQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDY 151 GKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRS 201 SDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWE 251 EIHKAVCLAKWGSDNTIFFTTYANGSCTDLGALELWRTSDLGKSFKTIGV 301 KIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFY 351 SILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGE 401 TDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDAT 451 AKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVM 501 VPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFST 551 DEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYT 601 IDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVC 651 QNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEF 701 CLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQN 751 SKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEA 801 NGVDGVDALDTASHTNKSGYHDDSDEDLLE SEQIDNO:3(maturesortilin) 1 MTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTA 51 EVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTE 101 NGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCTDLGALELW 151 RTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTW 201 SMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYS 251 KSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRW 301 THLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGI 361 VIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAI 401 EHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWG 451 FTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILG 501 YKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSK 551 CVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLK 601 KKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRF 651 LVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE