CROSS-NEUTRALIZING SARS-COV2 ANTIBODIES

20240294613 · 2024-09-05

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention provides for cross-neutralizing SARS-COV2 antibodies. The antibodies can be used to treat SARS-CoV2 and variants thereof.

    Claims

    1. An antibody or antigen binding fragment thereof that binds to the SARS-COV-2 receptor-binding domain (RBD) and/or SARS-COV-2 spike trimer comprising: a complementarity-determining region 3 (CDR3) heavy chain and light chain pair that shares at least 90% identity with the heavy chain and/or light chain of a pair selected from the group consisting of: BG1-1, BG1-3 to BG1-28, BG4-1 to BG4-27, BG7-1 to BG7-7, BG7-9 to BG7-20, and BG10-1 to BG10-19 (SEQ ID NOS: 1-184); or a heavy chain and light chain pair that shares at least 90% identity with the heavy chain and/or light chain of a pair selected from the group consisting of: BG1-1, BG1-3 to BG1-28, BG4-1 to BG4-27, BG7-1 to BG7-7, BG7-9 to BG7-20, and BG10-1 to BG10-19 (SEQ ID NOS: 185-368).

    2. The antibody or antigen binding fragment thereof of claim 1, wherein said antibody or antigen binding fragment is an IgG antibody or antigen binding fragment.

    3. The antibody or antigen binding fragment thereof of claim 1, wherein said antibody or antigen binding fragment is a monoclonal antibody.

    4. The antibody or antigen binding fragment thereof of claim 1, wherein said CDR3 heavy chain and light chain pair or heavy chain and light chain pair is selected from the group consisting of: BG1-6, BG1-12, BG1-14, BG1-17, BG1-22, BG1-23, BG1-24, BG1-25, BG1-26, BG1-28, BG4-10, BG4-11, BG4-14, BG4-16, BG4-17, BG4-24, BG4-25, BG4-26, BG7-14, BG7-15, BG7-16, BG7-18, BG7-19, BG7-20, BG10-10, BG1014, and BG10-19.

    5. The antibody or antigen binding fragment thereof of claim 1, wherein said CDR3 heavy chain and light chain pair or heavy chain and light chain pair is selected from the group consisting of: BG1-22, BG1-24, BG4-25, BG7-15, BG7-20, and BG10-19.

    6. The antibody or antigen binding fragment thereof of claim 1, wherein said heavy chain and light chain pair is BG7-15.

    7. The antibody or antigen binding fragment thereof of claim 6, wherein said antibody or antigen binding fragment thereof binds the two down/one up RBD conformation on the SARS COV2 spike trimer with no glycan or interprotomer contacts.

    8. The antibody or antigen binding fragment thereof of claim 6, wherein said antibody or antigen binding fragment recognizes an epitope in proximity to RBD residues 439-450.

    9. The antibody or antigen binding fragment thereof of claim 6, wherein said antibody or antigen binding fragment blocks RBD-ACE2 interactions.

    10. The antibody or antigen binding fragment thereof of claim 1, wherein said heavy chain and light chain pair is BG7-20.

    11. The antibody or antigen binding fragment thereof of claim 10, wherein said antibody or antigen binding fragment thereof binds a 2d/1u or 1d/2u binding state in the SARS CoV2 spike trimer.

    12. The antibody or antigen binding fragment thereof of claim 1, wherein said heavy chain and light chain pair is BG10-19.

    13. The antibody or antigen binding fragment thereof of claim 12, wherein said antibody or antigen binding fragment thereof binds to an all down RBD conformation in the SARS CoV2 spike trimer.

    14. The antibody or antigen binding fragment thereof of claim 12, wherein said antibody or antigen binding fragment recognizes an epitope in proximity to the N343-glycan.

    15. The antibody or antigen binding fragment thereof of claim 12, wherein said antibody or antigen binding fragment light chain makes secondary contacts with an adjacent RBD.

    16. The antibody or antigen binding fragment thereof of claim 12, wherein said antibody or antigen binding fragment heavy chain makes contacts with an epitope in proximity to the N343-glycan and the light chain contacts adjacent down RBDs and interacts with residues that overlap with the ACE2 receptor binding motif.

    17. The antibody or antigen binding fragment thereof of claim 1, wherein said heavy chain and light chain pair is BG1-24.

    18. The antibody or antigen binding fragment thereof of claim 17, wherein said antibody or antigen binding fragment thereof binds both the up/down RBD conformation on the SARS COV2 spike trimer.

    19. The antibody or antigen binding fragment thereof of claim 1, wherein said heavy chain and light chain pair is BG1-22.

    20. The antibody or antigen binding fragment thereof of claim 19, wherein said antibody or antigen binding fragment thereof binds only the up RBD conformation on the SARS CoV2 spike trimer.

    21. The antibody or antigen binding fragment thereof of claim 1, wherein said antibody or antigen binding fragment is a VH3-53/3-66 antibody.

    22. The antibody or antigen binding fragment thereof of claim 21, wherein said antibody or antigen binding fragment comprises a CDR3 having a consensus sequence according to FIG. 29.

    23. The antibody or antigen binding fragment thereof of claim 21, wherein said heavy chain and light chain pair is BG4-25.

    24. An antibody or antigen binding fragment thereof that binds to the SARS, MERS and CoV2 spike trimers outside of the receptor-binding domain (RBD) comprising a complementarity-determining region 3 (CDR3) heavy chain and light chain pair that shares at least 90% identity with the heavy chain and/or light chain of a pair selected from the group consisting of LKA-1-17 (Table 7).

    25. The antibody or antigen binding fragment of claim 1, wherein the antibody or antigen binding fragment is modified to enhance stabilization, in vivo half-life, neutralizing activity and/or dimerization.

    26. The antibody or antigen binding fragment of claim 25, wherein the antibody or antigen binding fragment is a fusion protein.

    27. The antibody or antigen binding fragment of claim 26, wherein the antibody or antigen binding fragment is fused to another antibody or antibody fragment, Fc domain, antigen binding domain, glutathione S-transferase (GST), and/or serum albumin.

    28. The antibody or antigen binding fragment of claim 25, wherein the antibody or antigen binding fragment comprises amino acid substitutions that increase antibody binding and/or viral neutralization activity.

    29. A method of treating a coronavirus infection comprising administering to a subject in need thereof one or more antibodies or antigen binding fragments of claim 1.

    30. The method of claim 29, wherein the coronavirus is selected from the group consisting of SARS-COV-2, SARS and MERS.

    31. The method of claim 30, wherein the SARS-COV-2 is a SARS-COV-2 variant.

    32. The method of claim 31, wherein the SARS-COV-2 variant is selected from the group consisting of B.1.1.7 and B.1.351.

    33. The method of claim 29, wherein BG10-19 is administered.

    34. The method of claim 29, wherein BG10-19 and BG4-25 are administered.

    35. A method of identifying neutralizing antibodies from a subject infected with a virus comprising selecting antibodies expressed in B cells further expressing a transcriptional program, wherein the transcriptional program comprises one or more genes selected from the group consisting of: a. GRAMD1C, TMEM156, PDE4D, NFKBIA, S100A10, TKT, CAPG, CXCR3, CFLAR, HMGA1, MARCKSL1, PIM3, RHOF, MIF, ZFP36L1, NME2, MGAT4A, COCH, HOPX, ITGB2-AS1, BASP1, CD80, PAPSS1, CD70, LYPLAL1, LMNA, and FAS; or b. TKT, ARHGDIB, CFL1, CNN2, S100A10, HSPA8, HMGA1, PPIA, RAC2, CLIC1, SLC25A5, ARPC1B, SELL, PPP1CA, CAPZB, PPP1R18, CAPG, LDHB, S100A4, VIM, LTB, ANXA2, LCP1, TUBB, ACTG1, GAPDH, ACTB, PFN1, CORO1A, and TMSB10; or c. CD27, CD80, CD46 and CD86.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0021] An understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention may be utilized, and the accompanying drawings of which:

    [0022] FIGS. 1A-1ESARS-COV-2 binding B cell populations in 14 recovered subjects; Representative FACS plots with the gating strategy for sorting of SARS-COV-2 S (FIG. 1A) and RBD binding (FIG. 1B) B cells. Pre-enriched CD20 cells were gated on live cells based on their appearance in side scatter (SSC) and forward scatter (FSC). Of these, CD19-FITC and SARS-CoV-2 S-APC or SARS-COV-2 RBD-APC double-positive cells were selected for sorting and sequencing. (FIG. 1C) Bar diagram showing the number of cells for which transcriptional profile and matching VDJ sequences were obtained in each subject against SARS-COV-2 S (turquoise) and SARS-COV-2 RBD (yellow). (FIG. 1D) Pie charts showing the total number of B cells sorted from each subject in the center of each pie and expanded B cell clones represented by differently colored pie slices. The white areas in each pie chart represent singlets. (FIG. 1E) Bar diagram showing the fraction (in %) of VH3-53 and VH3-66 genes combined among SARS-COV-2 S trimer (left), RBD binding cells (center) and all cells combined (right) in each donor compared to historic control memory B cells (Rubelt et al., 2012). Red stars indicate fractions with statistically significant difference (P value<0.005) to historic control memory B cells (Rubelt et al., 2012).

    [0023] FIGS. 2A-2GAntibody neutralization, cross-binding and cross-neutralization. (FIG. 2A) Dot plots showing ELISA binding of all expressed antibodies against SARS-COV-2 S (y-axis) and RBD (x-axis) (Table 3) expressed as area under the curve (AUC) for subjects BG1, BG4, BG7 and BG10, respectively. Red dots represent neutralizers and black dots non-neutralizers in a SARS-COV-2 pseudovirus assay (Tables 2 and 3). Green dots represent negative control antibody mGO53 (Wardemann et al., 2003). Two tailed P values were generated by calculating Spearman correlation coefficient. As in Table 3 high binding was defined as AUC>1, intermediate binding as an AUC 0.25-1 and low binding as an AUC<0.25. (FIG. 2B) Bar diagram showing the IC.sub.50 values in ?g/ml (y-axis) against SARS-COV-2 pseudovirus in red and authentic SARS-COV-2 virus in black for all antibodies that showed neutralizing activity against SARS-COV-2 pseudovirus (Table 2). Pearson correlation coefficient (r) and P value were calculated comparing results from both assays. (FIG. 2C) Bar diagram showing the ELISA AUC for all antibodies that showed neutralizing activity in a SARS-COV-2 pseudovirus assay (Table 2) against SARS-COV-2 S (black), SARS-COV-2 RBD (red), SARS-COV S (orange), SARS-COV RBD (magenta), MERS-COV S (dark grey) and MERS-COV RBD (light grey). The two antibodies showing cross reactivity, BG1-28 and BG10-19, are indicated with red stars. (FIG. 2D) In vitro pseudovirus neutralization assay comparing the potencies of antibodies BG1-28, BG10-19 and S309 against SARS-COV (Pinto et al., 2020a). Data points represent the average of duplicates, with error bars representing the standard deviation. (FIG. 2E) Normalized relative luminescence values in cell lysates after infection with SARS-COV-2 pseudoviruses harboring WT-D614G (black), B.1.1.7 (hot pink), or B.1.351 (green) sequences in the presence of indicated antibodies. (FIG. 2F) Bar diagram showing the ELISA AUC for all antibodies that showed neutralizing activity in a SARS-CoV-2 pseudovirus assay (Table 2) against SARS-COV-2 S (red), SARS-COV-2 RBD (brown), SARS-COV S (dark blue), SARS-COV RBD (light blue), MERS-COV S (dark grey) and MERS-CoV RBD (light grey). The three antibodies showing strong cross reactivity, BG1-28, BG10-14 and BG10-19, are indicated with red stars. (FIG. 2G) In vitro pseudovirus neutralization assay comparing the potencies of antibodies BG1-28, BG10-19 and S309 (left panel) or several SARS-CoV reactive antibodies and CR3022 (right panel) against SARS-COV. Data points for neutralization assays represent the average of duplicates, with error bars representing the standard deviation.

    [0024] FIGS. 3A-3HCryo-EM structure of the BG10-19-S complex illustrates a distinct binding mode. (FIG. 3A) 3.3 ? cryo-EM density for the BG10-19-S trimer complex revealing three BG10-19 Fabs bound to a closed spike conformation. Side view (left panel) illustrates orientation with respect to the viral membrane (dashed line). Red circle (right panel) highlights quaternary epitope of BG10-19. (FIG. 3B) Close-up view of quaternary epitope highlighted in panel A (red circle) of BG10-19 (blue) involving bridging interactions that span neighboring protomers. (FIG. 3C) BG10-19 CDR loops (cartoon) mapped on the RBD surface. (FIG. 3D) Surface representation of BG10-19 quaternary epitope colored for BG10-19 heavy chain (steel blue) and light chain (light steel blue) interactions. (FIG. 3E) BG10-19 CDRH3 (sticks) buries into a concave pocket formed by core RBD residues near the N343-glycan (teal spheres). (FIG. 3F) BG10-19 CDRH2 (steel blue) interactions with RBD residue (light gray) R346. Potential cation-pi and hydrogen bond interactions are illustrated by dashed black lines. (FIG. 3G) Cryo-EM density map contoured at 5? around the N343.sub.RBD-glycan (teal sticks), which interfaces with the BG10-19 CDRH3 (steel blue) and CDRL2 (light steel blue) loops. Inset shows schematic of N343.sub.RBD-glycan (Blue square: N-acetylglucosamine (GlcNAc), Green circle: Mannose (Man), Red triangle: Fucose (Fuc)). (FIG. 3H) SPR experiment to assess whether BG10-19 Fab blocks ACE2 binding on S trimer through inducing the closed prefusion state. SARS-COV-2 S trimer or RBD (black curves, Fab-S, or Fab-RBD complexes (colored curves) were injected over immobilized ACE2-CH3 (Tada et al., 2020).

    [0025] FIGS. 4A-4EB cell transcriptome analysis. (FIG. 4A) Heatmap displaying the relative expression levels of the top 15 marker genes of the 6 clusters (rows) across cells (columns) (Z-score normalization, row normalized). Marker genes that are known to be differentially expressed in particular B cell developmental stages are indicated (Table 4 for a full list of marker genes). (FIG. 4B) Uniform Manifold Approximation and Projection (UMAP) plot displaying the cells defined by their single-cell transcriptome measurements. The cells are colored based on their cluster assignments by the Louvain clustering algorithm. (FIG. 4C) Same UMAP plot as in (B) but with cells colored based on their heavy chain isotypes: IGHD in blue, IGHM in yellow, IGHA in red and IGHG in green. (FIG. 4D) Same UMAP plot as in (B) but cells colored based on antibody binding and neutralization: cells with non-tested antibodies in grey, highly potent SARS-COV-2 neutralizers (IC50<0.1 mg/ml in pseudovirus neutralization assay as either IgG1 or IgA monomer) in red, low neutralizers (IC.sub.50?0.1 mg/ml) in yellow, non-neutralizing high binders in green and non-neutralizing low binders in blue (FIG. 9L, Tables 2 and 3). (FIG. 4E) Same UMAP plot as in (B) but cells with antibody CDRH3 shorter than 14 amino acids based on the IMGT definition (Lefranc et al., 2015) and VH3-53 or VH3-66 are shown in red and blue respectively. All other sorted and sequenced cells are shown in grey.

    [0026] FIGS. 5A-5ECryo-EM structure of BG1-22-S provides insight into the VH3-53/VH3-66/long CDRH3 antibody binding mode. (FIG. 5A) Cryo-EM density for the BG1-22-S trimer complex. (FIG. 5B) Left panel: Close-up view of BG1-22 (orange) recognition of RBD epitope (gray surface). Right panels: Overlay of VH3-53 antibodies BG4-25 (green, this study), COVA2-39 (purple, PDB 7JMP), and C144 (blue, PDB 7K90) with BG1-22 (orange). (FIG. 5C) BG1-22 (orange) and BG4-25 (green) CDR loops mapped on the RBD (gray surface). Disordered residues in the BG1-22 CDRH3 are denoted by a black dashed line. (FIG. 5D) Flattened surface representation of BG1-22 (orange) and BG4-25 (green) with CDRH3 loops highlighted. The CDRH3 of BG1-22 is displaced from the canonical binding pocket along the RBD surface adopted by C102-like antibodies. (FIG. 5E) Surface representation of the BG1-22 RBD epitope (orange). Underlying residues are shown as sticks.

    [0027] FIGS. 6A-6GCryo-EM structures of BG7-15, BG7-20, and BG1-24-S trimer complexes. (FIG. 6A) Cryo-EM density for the BG7-15-S trimer complex. (FIG. 6B) BG7-15 (HC: dark red, LC: salmon) targeting of its RBD (gray surface) epitope. Glycans are depicted as teal spheres. Color coding will be the same throughout the remaining panels. (FIG. 6C) BG7-15 CDR loops mapped on the RBD. (FIG. 6D) Surface representation of BG7-15 epitope. (FIG. 6E) Overlay of BG7-15 (red), REGN-10987 (gold, PDB 6XDG), and hACE2 (green, PDB 6M0J) on the RBD (gray surface). Despite non-overlapping epitopes, BG7-15 and REGN-10987 binding would sterically-hinder hACE2 interactions with the RBD. (FIG. 6F) Top down view of BG7-20 (HC: magenta, LC; pink) bound to S trimer. Inset: cryo-EM density of BG7-20-S trimer complex. (FIG. 6G) Close-up view of BG1-24 (HC: burnt orange, LC: wheat) bound to RBD. Interactions with the adjacent up RBD and N165.sub.NTD-glycan are shown. Inset: cryo-EM density of BG1-24-S trimer complex.

    [0028] FIGS. 7A-7R-Effects of RBD substitutions on monoclonal antibody binding and neutralization. (FIG. 7A) Heat map showing the log fold change in ELISA AUC of antibody Fabs binding to indicated SARS-COV-2 RBD mutants relative to wild-type SARS-COV-2 RBD binding. Mutations that lead to non-binding or decreases >20-fold relative to wild-type are shown as dark red. (FIG. 7B) Surface representation of the SARS-COV-2 RBD with monoclonal antibody footprints (BG1-22, orange; BG7-15, red; BG1-24, magenta; and BG10-19, blue) shown as dashed lines. Sites of individual RBD substitutions are shown as red spheres. (FIGS. 7C-7H) Normalized relative luminescence values in cell lysates after infection with SARS-COV-2 pseudoviruses harboring wild-type or RBD substitutions in the presence of indicated 6 antibodies. (FIG. 71) Summary table of IC.sub.50 and IC.sub.90 values measured for 6 different antibodies against pseudoviruses harboring wild-type or mutant RBDs. (FIG. 7J) Heat map showing the log fold change in ELISA AUC of antibody Fabs binding to indicated SARS-COV-2 RBD mutants relative to wild-type SARS-COV-2 RBD binding. Mutations that lead to non-binding or decreases >20-fold relative to wild-type are shown as dark red. (FIG. 7K-7P) Normalized relative luminescence values in cell lysates after infection with SARS-COV-2 pseudoviruses harboring wild-type or RBD substitutions in the presence of indicated 6 antibodies. (FIG. 7Q) Summary table of IC.sub.50, IC.sub.80 and IC50.sub.eff values measured for 6 different antibodies and antibody combinations against SARS-COV-2 pseudoviruses. IC50eff values were calculated based on synergistic models previously described (West et al., 2010). (FIG. 7R) Infection of 293T/ACE2cl.22 cells by rVSV/SARS-COV-2/GFP encoding the indicated spike mutations in the presence of increasing amounts of BG10-19. Infection was quantified by FACS after 16 h, with mean and SD from two technical replicates shown.

    [0029] FIGS. 8A-8P-Serum Neutralization against SARS-COV-2 pseudovirus and B cell repertoire characteristics (related to FIG. 1). (FIG. 8A) Serum ID.sub.50 titers of all 14 study subjects against SARS-COV-2 pseudovirus. The blue dots represent subjects that were selected for monoclonal antibody isolation. (FIG. 8B) Correlation between ID.sub.50 titers of all 14 study subjects against SARS-COV-2 pseudovirus and days between COVID-19 diagnosis and blood draw. P value was calculated based on the Pearson correlation coefficient (R). (FIG. 8C) Correlation between ID.sub.50 titers of all 14 study subjects against SARS-COV-2 pseudovirus and age of the subjects in years. P value was calculated based on the Pearson correlation coefficient (R). (FIG. 8D) Serum ID.sub.50 titers of all 14 study subjects against SARS-COV-2 pseudovirus grouped based on subject gender. P value was calculated using an unpaired two-tailed t-test. (FIG. 8E) Pie charts show the total number of B cells sorted from each subject in the center of each pie and differentially expanded pie slices represent the fraction of IgM/IgD (black), IgG (white) and IgA (grey) cells among all sorted cells. (FIG. 8F) Box plots showing absolute numbers of inferred nucleotide mutations per heavy chain V segment for all sorted cells (red bar), S-binding B cells (blue bar), RBD-binding B cells (green bar) and historic control memory B cells (brown bar) (Rubelt et al., 2012). The box limits are at the lower and upper quartiles and the center line indicates the median. (FIG. 8G) Box plots showing absolute numbers of inferred nucleotide mutations per heavy chain V segment for all sorted cells grouped by immunoglobulin isotypes IgD (pink), IgM (purple), IgA (green) and IgG (blue). The box limits are at the lower and upper quartiles, the center line indicates the median, the whiskers indicate 1.5? interquartile range and the dots represent outliers. P values were calculated using two tailed t-test and red brackets indicate statistical significance of the difference between samples with *P<=0.05, **P<=0.01, ***P<=0.001, ****P<=0.0001 and n/s indicating no statistical significance. P values were calculated using a two-tailed t-test. (FIG. 8H) Bar diagram showing the frequency of kappa and lambda light chains among all sorted cells (red), S-binding B cells (blue), RBD-binding B cells (green), historic control memory B cells (brown) (Rubelt et al., 2012). (FIG. 8I) Box plots showing the CDRH3 length in amino acids for all sorted cells (red), S-binding B cells (blue), RBD-binding B cells (green), historic control memory B cells (brown) (Rubelt et al., 2012). (FIG. 8J) Box plots showing the CDRH3 amino acid charges for all sorted cells (red), S-binding B cells (blue), RBD-binding B cells (green), historic control memory B cells (brown) (Rubelt et al., 2012). (FIG. 8K) Box plots showing the CDRH3 amino acid hydrophobicity scores for all sorted cells (red), S-binding B cells (blue), RBD-binding B cells (green), historic control memory B cells (brown) (Rubelt et al., 2012). (FIG. 8L) Box plots showing the CDRH3 length in amino acids for historic control memory B cells (brown) (Rubelt et al., 2012), IgD.sup.+ SARS COV2-binding B cells (pink), IgM.sup.+ SARS COV2-binding B cells (purple), IgA.sup.+ SARS CoV2-binding B cells (green), IgG.sup.+ SARS COV2-binding B cells (blue). (FIG. 8M) Box plots showing the CDRH3 amino acid charges for historic control memory B cells (brown) (Rubelt et al., 2012), IgD.sup.+ SARS COV2-binding B cells (pink), IgM.sup.+ SARS COV2-binding B cells (purple), IgA.sup.+ SARS COV2-binding B cells (green), IgG.sup.+ SARS COV2-binding B cells (blue). CDRH3 amino acid charges were calculated as in (FIG. 8J). (FIG. 8N) Box plots showing the CDRH3 amino acid hydrophobicity scores for historic control memory B cells (brown) (Rubelt et al., 2012), IgD.sup.+ SARS COV2-binding B cells (pink), IgM.sup.+ SARS COV2-binding B cells (purple), IgA.sup.+ SARS CoV2-binding B cells (green), IgG.sup.+ SARS COV2-binding B cells (blue). Hydrophobicity scores were calculated as in (FIG. 8K). For all box plots the box limits are at the lower and upper quartiles, the center line indicates the median, the whiskers indicate 1.5? interquartile range and the dots represent outliers. P values were calculated using two tailed t-test and red brackets indicate statistical significance of the difference between samples with stars indicating P values as in (FIG. 8G). (FIG. 8O) Distribution of clone sizes for each donor stratified by the clone isotype. Clones that contain cells from multiple isotypes are included as a data point in each of the respective groups. Numbers at the top of the violin plots display the percentage of cells from each isotype. Red brackets indicate statistical significance of the difference between isotypes with *P<=0.05, **P<=0.01, ***P<=0.001, ****P<=0.0001 and n/s indicating no statistical significance. P values were calculated using a two-tailed t-test. (FIG. 8P) Scatterplot displaying the relationship between clone size (number of cells, x-axis) and number of inferred mutations in the heavy chain V segment (y-axis). Each dot represents a cell or a group of cells within a clone with the same heavy chain isotype and number of inferred heavy chain mutations. Clonally related cells with different number of inferred heavy chain mutations are shown with the same color and grouped with violin plots. Pearson correlation coefficients and the p-values of each sub-plot are shown on separately.

    [0030] FIGS. 9A-9MSelection and testing of representative antibodies (related to FIG. 2). Venn diagrams summarizing all expanded clones, their immunoglobulin isotypes and selection of representative antibodies for donors BG1 (FIG. 9A), BG4 (FIG. 9B), BG7 (FIG. 9C) and BG10 (FIG. 9D). Colored circles show expanded B cell clones with the diameter of the circle corresponding to the size of the clone except for the largest clone in BG10 with 36 members. The numbers in the circles indicate the number of clonal members for all clones with more than 2 members. Red circles show expanded clones of which one representative antibody was produced and tested and blue circles show expanded clones of which no representative antibodies were tested. Red triangles represent singlets that were produced and tested. (FIG. 9E) Heatmap summarizing the polyreactivity ELISA results for all antibodies produced as IgG1 isolated from BG1, BG4, BG7 and BG10 against double strand DNA (dsDNA), single strand DNA (ssDNA), lipopolysaccharide (LPS), insulin (Ins) and streptavidin-APC (SA-APC) (Methods). OD.sup.415 values less than 0.5 at an antibody concentration of 1 ?g/ml are considered non-reactive and are indicated in white, OD.sup.415 values between 0.5 and 1.9 at an antibody concentration of 1 ?g/ml are considered moderately reactive and are indicated in orange, and OD.sup.415 values of 2 and above at an antibody concentration of 1 ?g/ml are considered strongly reactive and are indicated in red (Tiller et al., 2007). Results for highly-, moderately- and non-polyreactive control antibodies ED38, JB40 and mGO53 are included as indicated (Wardemann et al., 2003). (FIG. 9F) Dot plots summarizing IC.sub.80 values from SARS-COV-2 pseudovirus neutralization assay in ?g/ml (y-axis) for all antibodies isolated from subjects BG1, BG4, BG7 and BG10 and produced as IgG1 (Table 2). Pink dots represent antibodies isolated from IgG.sup.+ B cells, bright blue dots represent antibodies isolated from IgA.sup.+ B cells and black dots show antibodies isolated from IgM.sup.+ B cells. (FIG. 9G) Bar diagram showing the percent of neutralizing antibodies in a SARS-COV-2 pseudovirus neutralization assay among antibodies derived from IgM/IgD+ B cells (black), IgG.sup.+ B cells (white) and IgA.sup.+ B cells (grey) (Table 2). (FIG. 9H) Bar diagram showing the IC.sub.80 values in ?g/ml (y-axis) against SARS-CoV-2 pseudovirus in red and authentic SARS-COV-2 virus in black for all antibodies that showed neutralizing activity against SARS-COV-2 pseudovirus (Table 2). Pearson correlation coefficient (R) and P value were calculated comparing results from both assays. (FIG. 9I) Table summarizing neutralizing activity of antibodies BG10-19, BG1-22, BG4-25 and BG7-15 against SARS-COV-2 D614G, B.1.1.7 and B.1.351. Shown are IC50 and IC80 values in mg/ml as indicated. (FIG. 9J) Representative image from size exclusion chromatography for purification of IgA dimers for antibody BG1-20 (Tables 2 and 3). Y-axis displays absorption at 280 nm (mAU) and x-axis displays elution volume (in ml). (FIG. 9K) Representative Criterion? TGX? precast gel under non-reducing conditions after Coomassie Blue staining. Ladders with bands at indicated molecular weights are shown on the left and right end of the gel and adjacent to these are the pre-SEC sample and a monomeric IgA as indicated. The 22 lanes in the middle show consecutive elution fractions from SEC covering the multimer, dimer and monomer peaks as indicated and seen in (J). (FIG. 9L) Summary table for IgA neutralization of SARS-COV-2 pseudovirus. Shown are the IC50 and IC80 values in mg/ml (left two columns) followed by IC50 and IC80 values in nmol and IC50 and IC80 values in nmol corrected for the number of binding sites (Corr.) and the molar neutralization ratio (MNR) as defined by the IC50 of monomeric IgA divided by the IC50 for the dimeric version (Klein and Bjorkman, 2010). G-IgG1, mIgA=monomeric IgA, dIgA=dimeric IgA. (FIG. 9M) Bar graph summarizing the data from (L). Shown are all IgA antibodies which showed some level of neutralization in SARS-COV-2 pseudovirus neutralization assay in monomeric or dimeric form. Y-axis depicts IC50 (in nmol) corrected for the number of binding sites, x-axis indicates the different antibodies as indicated. Black bars show neutralization in IgG1 form (IgG), red bars in monomeric IgA (mIgA) and orange bars in dimeric IgA (dIgA) form.

    [0031] FIGS. 10A-10HBG10-19 cryo-EM validation, epitope mapping, and cross-reactive ELISA binding data (related to FIG. 3). (FIG. 10A) Representative micrograph and 2D class averages for BG10-19-S cryo-EM data collection. (FIG. 10B) Gold-standard FSC plot showing an overall resolution of 3.3 ? at FSC-0.143. (FIG. 10C) cryo-EM. (FIG. 10D) Local resolution estimation for the final cryo-EM reconstruction. (FIG. 10E) Structure of ACE2, RBD and BG10-19. (FIG. 10F) Sequence alignment of SARS-COV-2, SARS-COV, WIV1-COV, and SCH014-COV. RBD residues on the primary BG10-19 epitope are shaded blue. Residues contacted on the adjacent RBD are shaded orange. S309 epitope residues are also shown. (FIGS. 10G-10J) ELISA binding data for BG10-19, BG1-28, S309 (Pinto et al., 2020a), CR3022 (Tian et al., 2020), and the HIV-1 antibody IOMA (Gristick et al., 2016) against several sarbecoviruses.

    [0032] FIGS. 11A-11HTranscriptional Characteristics (related to FIG. 4). (FIG. 11A) Bar diagram showing the percentage of cells from individual donors contributing to all cells within each cluster as indicated. (FIG. 11B) Uniform Manifold Approximation and Projection (UMAP) plot displaying the cells defined by their single-cell transcriptome measurements. The cells are colored based on whether they were isolated with SARS-COV-2 S trimer (red) or RBD (turquoise) during cell sorting. (FIG. 11C) Same UMAP as in (FIG. 11B), but cells are colored based on their cell cycle phase G1 (red), G2M (green) or S (blue) as predicted by the Seurat cell cycle scoring function (Butler et al., 2018; Stuart et al., 2019). (FIG. 11D) Violin plots displaying the distribution of the expression levels of CD44, CXCR4 and CD38 (log 2) within each single-cell transcriptome cluster. (FIG. 11E) Bar plot displaying the percentage of each heavy chain isotype usage within each transcriptome cluster. (FIG. 11F) Box plots displaying the distribution of the number of inferred mutations in the heavy chains within each of the 6 transcriptome clusters. Mean values are displayed above each box. Significance of the difference between the mean values of each cluster with the mean of cluster 1 was calculated using one-tailed t-test. (FIG. 11G) Box plots displaying the distribution of the percentage of donor clonal cells within each transcriptome cluster (i.e. fraction of cells that are part of a B cell clone with 2 or more members across the entire donor). Significance of the difference between the mean values of clusters 3 and 4 with the mean of cluster 1 was calculated with one-tailed t-test. (FIG. 11H) Shannon entropy values calculated based on the general form of the diversity index proposed by (Hill, 1973), improved by resampling strategies in (Chao et al., 2014; Chao et al., 2015) and implemented in the Alakazam R package (Gupta et al., 2015). Each dot represents the Shannon entropy value of a specific donor among the 14 donors in the specified cluster. Shannon entropy values are reversely related with the clonal expansion within the clusters. Thus, according to the displayed comparisons TC1 contains the smallest clonal expansion. Significance values of pairwise comparisons are computed with two-tailed t-test. For (FIG. 11F), (FIG. 11G) and (FIG. 11H) red brackets indicate statistical significance of the difference between samples. *P<=0.05, ***P<=0.001, ****P<=0.0001 and n/s indicates no statistical significance.

    [0033] FIGS. 12A-12DTC3 and TC4 characterization (related to FIG. 4). (FIG. 12A) Violin plots displaying the distribution of the expression levels of various genes across single-cell transcriptome clusters. The significance of the mean value comparisons between different clusters was calculated using a two-tailed t-test. (FIG. 12B) Box plots displaying the percentage of VH3-53 or VH3-66 (with CDRH3 length smaller than 14 aa by IMGT definition (Lefranc et al., 2015)) cells of the 14 donors within each transcriptome cluster. Mean values of cluster 3 and 4 were compared with the mean values of other clusters using a two-tailed t-test. For (FIG. 12A) and (FIG. 12B) red brackets indicate statistical significance of the difference between samples. *P<=0.05, ***P<=0.001, ****P<=0.0001, and n/s indicates no statistical significance. (FIG. 12C) Scatter plots displaying the relationship between the percent of cells within each donor coming from TC0-5 with the neutralization titer values measured for each donor. Spearman correlation values with corresponding P values are shown on each subplot. Dots are colored based on the donor ID, as indicated. (FIG. 12D) Distribution of the percent of B-cell clones across 6 transcriptome clusters, stratified by neutralizing activity of the tested antibody. Each dot displays the percentage of cells from a specific clone (y-axis) that belongs to the specified transcriptome cluster (x-axis). Numbers on top of each violin plot show the median value of the distribution.

    [0034] FIGS. 13A-13HBG4-25-RBD structure and BG1-22-S trimer cryoEM validation (related to FIG. 5). (FIG. 13A) X-ray structure overview of BG4-25 (green) in complex with the SARS-COV-2 RBD (gray surface) and antibody CR3022 (yellow) (Tian et al., 2020). (FIG. 13B) BG4-25 CDR loops mapped on the surface of the RBD. Epitope residues are colored green and the ACE2 footprint shown (orange dotted line). (FIG. 13C) Bar diagram showing the mutation frequency of all inferred mutations that occurred in 10% or more of 93 isolated IgG VH3-53/VH3-66 antibodies with CDRH3 less than 14 amino acids (IMGT definition; (Lefranc et al., 2015)) from the collection of 6,113 SARS-COV-2 binding B cells and a reference group of 13,900 VH3-53/VH3-66 sequences from a human Ig gene repertoire set (see Methods and (Rubelt et al., 2012)). The frequencies of mutations in the antibodies from the SARS-COV-2 binding B cells are shown above the dotted line and the frequencies of mutations in the reference group are shown below the dotted line. (FIG. 13D, FIG. 13E) Residue level contacts between BG4-25 (green) and RBD (light gray). Potential H-bonds are shown as dashed lines. (FIG. 13F) Representative micrograph and 2D class averages for BG1-22-S cryo-EM data collection. (FIG. 13G) Gold-standard FSC plot showing an overall resolution of 3.7 ? at FSC-0.143. (FIG. 13H) Local resolution estimation for the final cryo-EM reconstruction.

    [0035] FIGS. 14A-14ICryo-EM validation of BG7-15, BG7-20, and BG1-24-S trimer complexes (related to FIG. 6). Representative micrograph (scale bar=100 nm) selected from total dataset, 2D class averages, gold-standard FSC plots, and local resolution estimations for (FIGS. 14A-14C) BG7-15-S complex, (FIGS. 14D-14F) BG7-20-S complex, and (FIGS. 14G-14I) BG1-24-S complex.

    [0036] FIG. 15Schematic and results illustrating sorting of the receptor-binding domain and -trimer specific B cells from 24 individuals with likely SARS-COV-2 infection.

    [0037] FIG. 16There is a positive correlation between plasma neutralization titers and the fraction of IgG+ B cells in the SARS-COV-2-specific repertoire in 14 donors, consistent with the finding that most neutralizers stem from IgG+ B cells.

    [0038] FIG. 17Data showing that neutralization does not correlate with mutation levels but correlates with binding to SARS-COV-2 trimer in ELISA.

    [0039] FIG. 18Graphs showing that almost all neutralizing antibodies bind to the SARS-CoV-2 receptor-binding domain (RBD).

    [0040] FIG. 19Graphs showing that almost all neutralizing antibodies bind to the SARS-CoV-2 RBD.

    [0041] FIG. 20Graph showing that BG10-19 and BG1-28 show equal binding to SARS-CoV-2 and trimer/RBD.

    [0042] FIG. 21Table showing selected antibodies for structural characterization.

    [0043] FIG. 22Shows a 4.0 ? cryoEM structure of BG7-20-SARS-COV-2-S 6P complex. Dataset has preferential orientation issues, which will limit the ability to push the resolution much higher without collecting more data.

    [0044] FIG. 23Shows a 4.0 ? cryoEM structure of BG7-20-SARS-COV-2-S 6P complex. Data show two binding states: 2d/1u and 1d/2u bound by Fabs. The data look very similar to previously described C121-S structure (C121 is VH1-2/VL2-23).

    [0045] FIG. 24Shows a 3.5 ? cryoEM structure of BG10-19-SARS-COV-2-S 6P complex. Shows one main class that is symmetrical.

    [0046] FIG. 25Shows a 3.5 ? cryoEM structure of BG10-19-SARS-COV-2-S 6P complex. BG10-19 binds to an all down RBD conformation, with a main epitope focused near the N343-glycan. Interestingly, BG10-19 LC seems to make secondary contacts with adjacent RBD.

    [0047] FIG. 26Shows a 3.5 ? cryoEM structure of BG10-19-SARS-COV-2-S 6P complex . . . bridging RBDs on S trimers. BG10-19 HC makes contacts with primary epitope near N343-glycan, while the LC bridges adjacent down RBDs and interacts with residues that overlap with ACE2 receptor binding motif.

    [0048] FIG. 27Shows cryoEM reconstructions of BG1-22 and BG1-24-S complexes.

    [0049] FIG. 28Pie charts showing the total number of B cells sorted from each subject in the center of each pie and expanded B cell clones represented by pie slices. The white areas in each pie chart represent singlets. SARS-COV-2 surface trimer specific repertoire includes expanded B cell clones.

    [0050] FIG. 29Illustrates that SARS-COV-2 surface trimer-specific repertoire from 14 donors includes heavily expanded class of VH3-53/VH3-66 antibodies. These show a highly conserved sequence.

    [0051] FIG. 30UMAP plots showing that SARS-COV-2 surface trimer-specific repertoire from 14 donors falls into 5 distinct transcriptional clusters.

    [0052] FIG. 31Heat map showing that SARS-COV-2 surface trimer-specific repertoire from 14 donors falls into 5 distinct transcriptional clusters.

    [0053] FIG. 32Graphs showing that clusters 3 and 4 have higher levels of B cell activation markers such as CD80, CD40, and CD86.

    [0054] FIG. 33Graphs showing that VH3-53/VH3-66 with HC CDR3<14 amino acids are enriched in clusters 3 and 4.

    [0055] FIG. 34Pie chart and schematic illustrating the search for SARS/CoV-2/MERS cross-binding antibodies.

    [0056] FIG. 35Pie charts showing the total number of B cells sorted from each subject in the center of each pie and expanded B cell clones represented by pie slices. The white areas in each pie chart represent singlets. When used as sorting bait all 6 proteins yield differently expanded B cell clones.

    [0057] FIG. 36Pie charts showing that there is considerable clonal overlap between B cells sorted with the 6 different proteins.

    [0058] FIG. 37Venn diagrams summarizing all expanded clones and their immunoglobulin isotypes. The majority of expanded clones are IgM+ but some expanded clones include class-switched B cells.

    [0059] FIG. 38Graph illustrating that sorting with SARS/MERS/COV-2 trimers selects for antibodies that bind outside of the RBD (see, also, Table 7).

    [0060] FIG. 39Flow cytometry charts showing a pilot experiment for simultaneous staining with multiple coronavirus trimer single stains.

    [0061] The figures herein are for illustrative purposes only and are not necessarily drawn to scale.

    DETAILED DESCRIPTION OF THE EXAMPLE EMBODIMENTS

    General Definitions

    [0062] Unless defined otherwise, technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure pertains. Definitions of common terms and techniques in molecular biology may be found in Molecular Cloning: A Laboratory Manual, 2.sup.nd edition (1989) (Sambrook, Fritsch, and Maniatis); Molecular Cloning: A Laboratory Manual, 4.sup.th edition (2012) (Green and Sambrook); Current Protocols in Molecular Biology (1987) (F. M. Ausubel et al. eds.); the series Methods in Enzymology (Academic Press, Inc.): PCR 2: A Practical Approach (1995) (M. J. MacPherson, B. D. Hames, and G. R. Taylor eds.): Antibodies, A Laboratory Manual (1988) (Harlow and Lane, eds.): Antibodies A Laboratory Manual, 2.sup.nd edition 2013 (E. A. Greenfield ed.); Animal Cell Culture (1987) (R. I. Freshney, ed.); Benjamin Lewin, Genes IX, published by Jones and Bartlet, 2008 (ISBN 0763752223); Kendrew et al. (eds.), The Encyclopedia of Molecular Biology, published by Blackwell Science Ltd., 1994 (ISBN 0632021829); Robert A. Meyers (ed.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 9780471185710); Singleton et al., Dictionary of Microbiology and Molecular Biology 2nd ed., J. Wiley & Sons (New York, N.Y. 1994), March, Advanced Organic Chemistry Reactions, Mechanisms and Structure 4th ed., John Wiley & Sons (New York, N.Y. 1992); and Marten H. Hofker and Jan van Deursen, Transgenic Mouse Methods and Protocols, 2.sup.nd edition (2011).

    [0063] As used herein, the singular forms a, an, and the include both singular and plural referents unless the context clearly dictates otherwise.

    [0064] The term optional or optionally means that the subsequent described event, circumstance or substituent may or may not occur, and that the description includes instances where the event or circumstance occurs and instances where it does not.

    [0065] The recitation of numerical ranges by endpoints includes all numbers and fractions subsumed within the respective ranges, as well as the recited endpoints.

    [0066] The terms about or approximately as used herein when referring to a measurable value such as a parameter, an amount, a temporal duration, and the like, are meant to encompass variations of and from the specified value, such as variations of +/?10% or less, +/?5% or less, +/?1% or less, and +/?0.1% or less of and from the specified value, insofar such variations are appropriate to perform in the disclosed invention. It is to be understood that the value to which the modifier about or approximately refers is itself also specifically, and preferably, disclosed.

    [0067] As used herein, a biological sample may contain whole cells and/or live cells and/or cell debris. The biological sample may contain (or be derived from) a bodily fluid. The present invention encompasses embodiments wherein the bodily fluid is selected from amniotic fluid, aqueous humour, vitreous humour, bile, blood serum, breast milk, cerebrospinal fluid, cerumen (earwax), chyle, chyme, endolymph, perilymph, exudates, feces, female ejaculate, gastric acid, gastric juice, lymph, mucus (including nasal drainage and phlegm), pericardial fluid, peritoneal fluid, pleural fluid, pus, rheum, saliva, sebum (skin oil), semen, sputum, synovial fluid, sweat, tears, urine, vaginal secretion, vomit and mixtures of one or more thereof. Biological samples include cell cultures, bodily fluids, cell cultures from bodily fluids. Bodily fluids may be obtained from a mammal organism, for example by puncture, or other collecting or sampling procedures.

    [0068] The terms subject, individual, and patient are used interchangeably herein to refer to a vertebrate, preferably a mammal, more preferably a human. Mammals include, but are not limited to, murines, simians, humans, farm animals, sport animals, and pets. Tissues, cells and their progeny of a biological entity obtained in vivo or cultured in vitro are also encompassed.

    [0069] Various embodiments are described hereinafter. It should be noted that the specific embodiments are not intended as an exhaustive description or as a limitation to the broader aspects discussed herein. One aspect described in conjunction with a particular embodiment is not necessarily limited to that embodiment and can be practiced with any other embodiment(s). Reference throughout this specification to one embodiment, an embodiment, an example embodiment, means that a particular feature, structure or characteristic described in connection with the embodiment is included in at least one embodiment of the present invention. Thus, appearances of the phrases in one embodiment, in an embodiment, or an example embodiment in various places throughout this specification are not necessarily all referring to the same embodiment, but may. Furthermore, the particular features, structures or characteristics may be combined in any suitable manner, as would be apparent to a person skilled in the art from this disclosure, in one or more embodiments. Furthermore, while some embodiments described herein include some but not other features included in other embodiments, combinations of features of different embodiments are meant to be within the scope of the invention. For example, in the appended claims, any of the claimed embodiments can be used in any combination.

    [0070] All publications, published patent documents, and patent applications cited herein are hereby incorporated by reference to the same extent as though each individual publication, published patent document, or patent application was specifically and individually indicated as being incorporated by reference.

    Overview

    [0071] Embodiments disclosed herein provide cross-neutralizing coronavirus antibodies, in particular, cross-neutralizing SARS-COV2 antibodies capable of neutralizing a broad range of SARS-COV2 variants (e.g., BG10-19). SARS-COV2 poses a significant threat worldwide and monoclonal antibodies have been a focus in vaccine and therapeutic design to counteract the threat of SARS-COV-2. Here, Applicants combined SARS-COV-2-specific B cell sorting with single-cell VDJ and RNA-seq and structures of monoclonal antibodies to characterize B cell responses against SARS-COV-2. Applicants show that the SARS-COV-2-specific B cell repertoire consists of transcriptionally distinct B cell populations with potently neutralizing antibodies localized in two clusters that resemble memory and activated B cells. Of 92 isolated antibodies, 27 neutralize SARS-COV-2 with IC.sub.80 values as low as 7 ng/ml Cryo-electron microscopy structures of potently-neutralizing antibody Fabs complexed with SARS-COV-2 spike trimers show recognition of various receptor-binding domain (RBD) epitopes, including one antibody (BG10-19) that locks the spike trimer in a completely closed conformation to potently neutralize SARS-COV-2, including lineages B.1.1.7 and B.1.351, SARS-COV and cross-reacts with heterologous RBDs. In certain embodiments, due to the epitopes targeted, the antibodies neutralize variants harboring mutations in the spike protein and RBD domains. Together, the results characterize transcriptional differences among SARS-COV-2-specific B cells and can inform vaccine and therapeutic development of cross-reactive antibodies, as well as, inform design of immunogens to elicit cross-reactive protection.

    Therapeutic Antibodies or Binding Fragments of an Antibody

    Antibodies

    [0072] In certain embodiments, the present invention provides antibodies, antibody fragments, binding fragments of an antibody, or antigen binding fragments capable of binding to an antigen of interest (e.g., the receptor binding domain of SARS-COV-2 or the spike protein of SARS-COV-2). Applicants have identified antibodies from B cells that bound to specific bait proteins, i.e., trimers and RBD proteins from SARS-COV-2, SARS and MERS (see, Tables 2, 7 and 8). Table 8 provides a list of all nucleotide sequences identified in isolated B cells from 14 donors. The antibodies are not limited to the nucleotide sequences. The invention also includes antibodies comprising the amino acid sequences encoded for by the nucleotide sequences. One skilled in the art routinely converts nucleotide sequences to amino acid sequences. The disclosed antibodies may be cross-reactive to any coronavirus, thus providing for cross-reactive therapeutic antibodies. In certain embodiments, the antibodies provide epitopes for generating cross-reactive antibodies. In certain embodiments, the antibodies can be administered to treat a coronavirus infection, in particular SARS-COV-2 and variants thereof. In certain embodiments, the therapeutic antibodies described herein can be used as an initial treatment upon diagnosis or suspicion of a coronavirus infection, in particular a novel coronavirus infection. As used herein, coronavirus refers to enveloped viruses with a positive-sense single-stranded RNA genome and a nucleocapsid of helical symmetry that constitute the subfamily Orthocoronavirinae, in the family Coronaviridae (see, e.g., Woo P C, Huang Y, Lau S K, Yuen K Y. Coronavirus genomics and bioinformatics analysis. Viruses. 2010; 2(8):1804-1820).

    [0073] In certain embodiments, the antibodies disclosed herein are cross-reactive to SARS-CoV-2 variants. As used herein, the term variant refers to any virus having one or more mutations as compared to a known virus. A strain is a genetic variant or subtype of a virus. The terms strain, variant, and isolate may be used interchangeably. In certain embodiments, a variant has developed a specific group of mutations that causes the variant to behave differently than that of the strain it originated from.

    [0074] While there are many thousands of variants of SARS-COV-2, (Koyama, Takahiko Koyama; Platt, Daniela; Parida, Laxmi (June 2020). Variant analysis of SARS-COV-2 genomes. Bulletin of the World Health Organization. 98: 495-504) there are also much larger groupings called clades. Several different clade nomenclatures for SARS-COV-2 have been proposed. As of December 2020, GISAID, referring to SARS-COV-2 as hCoV-19 identified seven clades (O, S, L, V, G, GH, and GR) (Alm E, Broberg E K, Connor T, et al. Geographical and temporal distribution of SARS-COV-2 clades in the WHO European Region, January to June 2020 [published correction appears in Euro Surveill. 2020 August; 25(33):]. Euro Surveill. 2020; 25(32):2001410). Also as of December 2020, Nextstrain identified five (19A, 19B, 20A, 20B, and 20C) (Cited in Alm et al. 2020). Guan et al. identified five global clades (G614, S84, V251, I378 and D392) (Guan Q, Sadykov M, Mfarrej S, et al. A genetic barcode of SARS-COV-2 for monitoring global distribution of different clades during the COVID-19 pandemic. Int J Infect Dis. 2020; 100:216-223). Rambaut et al. proposed the term lineage in a 2020 article in Nature Microbiology; as of December 2020, there have been five major lineages (A, B, B.1, B.1.1, and B.1.777) identified (Rambaut, A.; Holmes, E. C.; O'Toole, ?.; et al. A dynamic nomenclature proposal for SARS-COV-2 lineages to assist genomic epidemiology. 5: 1403-1407).

    [0075] Genetic variants of SARS-COV-2 have been emerging and circulating around the world throughout the COVID-19 pandemic (see, e.g., The US Centers for Disease Control and Prevention; www.cdc.gov/coronavirus/2019-ncov/variants/variant-info.html). Exemplary, non-limiting variants applicable to the present disclosure include variants of SARS-COV-2, particularly those having substitutions of therapeutic concern. Table A shows exemplary, non-limiting genetic substitutions in SARS-COV-2 variants.

    TABLE-US-00001 TABLE A Common Pango Lineages with Spike Spike Protein Substitution Protein Substitutions L452R A.2.5, B.1, B.1.429, B.1.427, B.1.617.1, B.1.526.1, B.1.617.2, C.36.3 E484K B.1.1.318, B.1.1.7, B.1.351, B.1.525, B.1.526, B.1.621, B.1.623, P.1, P.1.1, P.1.2, R.1 K417N, E484K, N501Y B.1.351, B.1.351.3 K417T, E484K, N501Y P.1, P.1.1, P.1.2 A67V, del69-70, T95I, del142-144, Y145D, del211, B.1.1.529 and BA lineages L212I, ins214EPE, G339D, S371L, S373P, S375F, K417N, N440K, G446S, S477N, T478K, E484A, Q493R, G496S, Q498R, N501Y, Y505H, T547K, D614G, H655Y, N679K, P681H, N764K, D796Y, N856K, Q954H, N969K, L981F
    Phylogenetic Assignment of Named Global Outbreak (PANGO) Lineages is software tool developed by members of the Rambaut Lab. The associated web application was developed by the Centre for Genomic Pathogen Surveillance in South Cambridgeshire and is intended to implement the dynamic nomenclature of SARS-COV-2 lineages, known as the PANGO nomenclature. It is available at cov-lineages.org.

    [0076] In some embodiments, the SARS-COV-2 variant is and/or includes: B.1.1.7, also known as Alpha (WHO) or UK variant, having the following spike protein substitutions: 69del, 70del, 144del, (E484K*), (S494P*), N501Y, A570D, D614G, P681H, T716I, S982A, and D1118H (K1191N*); B.1.351, also known as Beta (WHO) or South Africa variant, having the following spike protein substitutions: D80A, D215G, 241del, 242del, 243del, K417N, E484K, N501Y, D614G, and A701V; B.1.427, also known as Epsilon (WHO) or US California variant, having the following spike protein substitutions: L452R, and D614G; B.1.429, also known as Epsilon (WHO) or US California variant, having the following spike protein substitutions: S13I, W152C, L452R, and D614G; B.1.617.2, also known as Delta (WHO) or India variant, having the following spike protein substitutions: T19R, (G142D), 156del, 157del, R158G, L452R, T478K, D614G, P681R, and D950N; P.1, also known as Gamma (WHO) or Japan/Brazil variant, having the following spike protein substitutions: L18F, T20N, P26S, D138Y, R190S, K417T, E484K, N501Y, D614G, H655Y, and T1027I; and B.1.1.529 also known as Omicron (WHO), having the following spike protein substitutions: A67V, del69-70, T95I, del142-144, Y145D, del211, L212I, ins214EPE, G339D, S371L, S373P, S375F, K417N, N440K, G446S, S477N, T478K, E484A, Q493R, G496S, Q498R, N501Y, Y505H, T547K, D614G, H655Y, N679K, P681H, N764K, D796Y, N856K, Q954H, N969K, L981F, or any combination thereof.

    [0077] In some embodiments, the SARS-COV-2 variant is classified and/or otherwise identified as a Variant of Concern (VOC) by the World Health Organization and/or the U.S. Centers for Disease Control. A VOC is a variant for which there is evidence of an increase in transmissibility, more severe disease (e.g., increased hospitalizations or deaths), significant reduction in neutralization by antibodies generated during previous infection or vaccination, reduced effectiveness of treatments or vaccines, or diagnostic detection failures.

    [0078] In some embodiments, the SARS-Cov-2 variant is classified and/or otherwise identified as a Variant of High Consequence (VHC) by the World Health Organization and/or the U.S. Centers for Disease Control. A variant of high consequence has clear evidence that prevention measures or medical countermeasures (MCMs) have significantly reduced effectiveness relative to previously circulating variants.

    [0079] In some embodiments, the SARS-Cov-2 variant is classified and/or otherwise identified as a Variant of Interest (VOI) by the World Health Organization and/or the U.S. Centers for Disease Control. A VOI is a variant with specific genetic markers that have been associated with changes to receptor binding, reduced neutralization by antibodies generated against previous infection or vaccination, reduced efficacy of treatments, potential diagnostic impact, or predicted increase in transmissibility or disease severity.

    [0080] In some embodiments, the SARS-Cov-2 variant is classified and/or is otherwise identified as a Variant of Note (VON). As used herein, VON refers to both variants of concern and variants of note as the two phrases are used and defined by Pangolin (cov-lineages.org) and provided in their available VOC reports available at cov-lineages.org.

    [0081] In some embodiments the SARS-Cov-2 variant is a VOC. In some embodiments, the SARS-COV-2 variant is or includes an Alpha variant (e.g., Pango lineage B.1.1.7), a Beta variant (e.g., Pango lineage B.1.351, B.1.351.1, B.1.351.2, and/or B.1.351.3), a Delta variant (e.g., Pango lineage B.1.617.2, AY.1, AY.2, AY.3 and/or AY.3.1); a Gamma variant (e.g., Pango lineage P.1, P.1.1, P.1.2, P.1.4, P.1.6, and/or P.1.7), a Omicon variant (B.1.1.529) or any combination thereof.

    [0082] In some embodiments the SARS-Cov-2 variant is a VOI. In some embodiments, the SARS-COV-2 variant is or includes an Eta variant (e.g., Pango lineage B.1.525 (Spike protein substitutions A67V, 69del, 70del, 144del, E484K, D614G, Q677H, F888L)); an Iota variant (e.g., Pango lineage B.1.526 (Spike protein substitutions L5F, (D80G*), T95I, (Y144-*), (F157S*), D253G, (L452R*), (S477N*), E484K, D614G, A701V, (T859N*), (D950H*), (Q957R*))); a Kappa variant (e.g., Pango lineage B.1.617.1 (Spike protein substitutions (T95I), G142D, E154K, L452R, E484Q, D614G, P681R, Q1071H)); Pango lineage variant B.1.617.2 (Spike protein substitutions T19R, G142D, L452R, E484Q, D614G, P681R, D950N)), Lambda (e.g., Pango lineage C.37); or any combination thereof.

    [0083] In some embodiments SARS-Cov-2 variant is a VON. In some embodiments, the SARS-Cov-2 variant is or includes Pango lineage variant P.1 (alias, B.1.1.28.1.) as described in Rambaut et al. 2020. Nat. Microbiol. 5:1403-1407) (spike protein substitutions: T20N, P26S, D138Y, R190S, K417T, E484K, N501Y, H655Y, TI027I)); an Alpha variant (e.g., Pango lineage B.1.1.7); a Beta variant (e.g., Pango lineage B.1.351, B.1.351.1, B.1.351.2, and/or B.1.351.3); Pango lineage variant B.1.617.2 (Spike protein substitutions T19R, G142D, L452R, E484Q, D614G, P681R, D950N)); an Eta variant (e.g., Pango lineage B.1.525); Pango lineage variant A.23.1 (as described in Bugembe et al. medRxiv. 2021. doi: doi.org/10.1101/2021.02.08.21251393) (spike protein substitutions: F157L, V367F, Q613H, P681R); or any combination thereof.

    [0084] Structures have been determined for SARS-COV-2 variants and provide a structural framework for describing the impact of individual mutations on immune evasion (see, e.g., McCallum, et al., 2021, Molecular basis of immune evasion by the delta and kappa SARS-COV-2 variants, bioRxiv 2021.08.11.455956; doi.org/10.1101/2021.08.11.455956). The antibodies described herein can bind to epitopes on the structures of the variants described herein.

    [0085] The term antibody is used interchangeably with the term immunoglobulin herein, and includes intact antibodies, fragments of antibodies, e.g., Fab, F(ab)2 fragments, and intact antibodies and fragments that have been mutated either in their constant and/or variable region (e.g., mutations to produce chimeric, partially humanized, or fully humanized antibodies, as well as to produce antibodies with a desired trait, e.g., enhanced binding and/or reduced FcR binding). The term fragment refers to a part or portion of an antibody or antibody chain comprising fewer amino acid residues than an intact or complete antibody or antibody chain. Fragments can be obtained via chemical or enzymatic treatment of an intact or complete antibody or antibody chain. Fragments can also be obtained by recombinant means. Exemplary fragments include Fab, Fab, F(ab)2, Fabc, Fd, dAb, VHH and scFv and/or Fv fragments.

    [0086] The term antigen-binding fragment refers to a polypeptide fragment of an immunoglobulin or antibody that binds antigen or competes with intact antibody (i.e., with the intact antibody from which they were derived) for antigen binding (i.e., specific binding). As such these antibodies or fragments thereof are included in the scope of the invention, provided that the antibody or fragment binds specifically to a target molecule.

    [0087] In certain embodiments, the antibody or antibody fragment is a therapeutic antibody. In certain embodiments, the antibody is a neutralizing antibody. As used herein, neutralizing antibody refers to an antibody that is capable of neutralizing a pathogen or reducing infectivity, such as a viral pathogen (e.g., SARS-COV-2).

    [0088] Applicants have identified specific antibodies capable of neutralizing SARS-COV-2, as well as neutralizing antibodies capable of binding SARS, MERS and CoV2 spike protein (Table 2). The antibodies identified specifically bind to the receptor binding domain (RBD) of SARS-CoV-2 spike or a region in the spike protein outside of the RBD. The antibodies neutralize pseudotyped virus expressing the spike protein. The antibodies include complementarity determining regions or CDRs interspersed among frame regions or FRs, as defined herein. As used herein CDRs refer to variable regions in an antibody that provide for antigen specificity. In certain embodiments, specific CDRs identified can be used in any antibody framework described further herein. In certain embodiments, one, two, or all three CDRs are used in a framework. In certain embodiments, CDR3 for the light and heavy chains are used in a framework. As used herein, framework can refer to an entire antibody where one or more variable chains or CDR sequences are substituted. It is common for therapeutic antibodies to use a common antibody constant region substituted with the identified variable chains or CDR sequences. In certain embodiments, frame region (FR) refers to the non-CDR regions or constant regions in the antibody.

    [0089] In certain embodiments, antibodies prepared according to the present invention are substantially free of non-antibody protein. As used herein, a preparation of antibody protein having less than about 50% of non-antibody protein (also referred to herein as a contaminating protein), or of chemical precursors, is considered to be substantially free. 40%, 30%, 20%, 10% and more preferably 5% (by dry weight), of non-antibody protein, or of chemical precursors is considered to be substantially free. When the antibody protein or biologically active portion thereof is recombinantly produced, it is also preferably substantially free of culture medium, i.e., culture medium represents less than about 30%, preferably less than about 20%, more preferably less than about 10%, and most preferably less than about 5% of the volume or mass of the protein preparation.

    [0090] In preferred embodiments, the antibodies of the present invention are monoclonal antibodies. As used herein, the term monoclonal antibody refers to a single antibody produced by any means, such as recombinant DNA technology. As used herein, the term monoclonal antibody also refers to an antibody derived from a clonal population of antibody-producing cells (e.g., B lymphocytes or B cells) which is homogeneous in structure and antigen specificity. The term polyclonal antibody refers to a plurality of antibodies originating from different clonal populations of antibody-producing cells which are heterogeneous in their structure and epitope specificity but which recognize a common antigen. Monoclonal and polyclonal antibodies may exist within bodily fluids, as crude preparations, or may be purified, as described herein.

    [0091] The term binding portion of an antibody (or antibody portion) includes one or more complete domains, e.g., a pair of complete domains, as well as fragments of an antibody that retain the ability to specifically bind to a target molecule. It has been shown that the binding function of an antibody can be performed by fragments of a full-length antibody. Binding fragments are produced by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact immunoglobulins. Binding fragments include Fab, Fab, F(ab)2, Fabc, Fd, dAb, Fv, single chains, VHH, single-chain antibodies, e.g., scFv, and single domain antibodies.

    [0092] In certain embodiments, the antibodies described herein are humanized. In certain embodiments, humanized forms of non-human antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity. In some instances, FR residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.

    [0093] Examples of portions of antibodies or epitope-binding proteins encompassed by the present definition include: (i) the Fab fragment, having VL, CL, VH and CH1 domains; (ii) the Fab fragment, which is a Fab fragment having one or more cysteine residues at the C-terminus of the CH1 domain; (iii) the Fd fragment having VH and CH1 domains; (iv) the Fd fragment having VH and CH1 domains and one or more cysteine residues at the C-terminus of the CH1 domain; (v) the Fv fragment having the VL and VH domains of a single arm of an antibody; (vi) the dAb fragment (Ward et al., 341 Nature 544 (1989)) which consists of a VH domain or a VL domain that binds antigen; (vii) isolated CDR regions or isolated CDR regions presented in a functional framework; (viii) F(ab)2 fragments which are bivalent fragments including two Fab fragments linked by a disulphide bridge at the hinge region; (ix) single chain antibody molecules (e.g., single chain Fv; scFv) (Bird et al., 242 Science 423 (1988); and Huston et al., 85 PNAS 5879 (1988)); (x) diabodies with two antigen binding sites, comprising a heavy chain variable domain (VH) connected to a light chain variable domain (VL) in the same polypeptide chain (see, e.g., EP 404,097; WO 93/11161; Hollinger et al., 90 PNAS 6444 (1993)); (xi) linear antibodies comprising a pair of tandem Fd segments (VH-Ch1-VH-Ch1) which, together with complementary light chain polypeptides, form a pair of antigen binding regions (Zapata et al., Protein Eng. 8(10): 1057-62 (1995); and U.S. Pat. No. 5,641,870).

    [0094] In certain embodiments, the antibodies and CDRs of the present invention can be transferred to another antibody type to generate chimeric antibodies. It is intended that the term antibody type encompass any Ig class or any Ig subclass (e.g. the IgG1, IgG2, IgG3, and IgG4 subclassess of IgG) obtained from any source (e.g., humans and non-human primates, and in rodents, lagomorphs, caprines, bovines, equines, ovines, etc.).

    [0095] The term Ig class or immunoglobulin class, as used herein, refers to the five classes of immunoglobulin that have been identified in humans and higher mammals, IgG, IgM, IgA, IgD, and IgE. The term Ig subclass refers to the two subclasses of IgM (H and L), three subclasses of IgA (IgA1, IgA2, and secretory IgA), and four subclasses of IgG (IgG1, IgG2, IgG3, and IgG4) that have been identified in humans and higher mammals. The antibodies can exist in monomeric or polymeric form; for example, IgM antibodies exist in pentameric form, and IgA antibodies exist in monomeric, dimeric or multimeric form.

    [0096] The term IgG subclass refers to the four subclasses of immunoglobulin class IgG-IgG1, IgG2, IgG3, and IgG4 that have been identified in humans and higher mammals by the heavy chains of the immunoglobulins, V1-?4, respectively. The term single-chain immunoglobulin or single-chain antibody (used interchangeably herein) refers to a protein having a two-polypeptide chain structure consisting of a heavy and a light chain, said chains being stabilized, for example, by interchain peptide linkers, which has the ability to specifically bind antigen. The term domain refers to a globular region of a heavy or light chain polypeptide comprising peptide loops (e.g., comprising 3 to 4 peptide loops) stabilized, for example, by ? pleated sheet and/or intrachain disulfide bond. Domains are further referred to herein as constant or variable, based on the relative lack of sequence variation within the domains of various class members in the case of a constant domain, or the significant variation within the domains of various class members in the case of a variable domain. Antibody or polypeptide domains are often referred to interchangeably in the art as antibody or polypeptide regions. The constant domains of an antibody light chain are referred to interchangeably as light chain constant regions, light chain constant domains, CL regions or CL domains. The constant domains of an antibody heavy chain are referred to interchangeably as heavy chain constant regions, heavy chain constant domains, CH regions or CH domains). The variable domains of an antibody light chain are referred to interchangeably as light chain variable regions, light chain variable domains, VL regions or VL domains). The variable domains of an antibody heavy chain are referred to interchangeably as heavy chain constant regions, heavy chain constant domains, VH regions or VH domains).

    [0097] The term region can also refer to a part or portion of an antibody chain or antibody chain domain (e.g., a part or portion of a heavy or light chain or a part or portion of a constant or variable domain, as defined herein), as well as more discrete parts or portions of said chains or domains. For example, light and heavy chains or light and heavy chain variable domains include complementarity determining regions or CDRs interspersed among frame regions or FRs, as defined herein.

    [0098] The term conformation refers to the tertiary structure of a protein or polypeptide (e.g., an antibody, antibody chain, domain or region thereof). For example, the phrase light (or heavy) chain conformation refers to the tertiary structure of a light (or heavy) chain variable region, and the phrase antibody conformation or antibody fragment conformation refers to the tertiary structure of an antibody or fragment thereof.

    [0099] Specific binding of an antibody means that the antibody exhibits appreciable affinity for a particular antigen or epitope and, generally, does not exhibit significant cross reactivity. Appreciable binding includes binding with an affinity of at least 25 ?M. Antibodies with affinities greater than 1?10.sup.7 M.sup.?1 (or a dissociation coefficient of 1 ?M or less or a dissociation coefficient of 1 nm or less) typically bind with correspondingly greater specificity. Values intermediate of those set forth herein are also intended to be within the scope of the present invention and antibodies of the invention bind with a range of affinities, for example, 100 nM or less, 75 nM or less, 50 nM or less, 25 nM or less, for example 10 nM or less, 5 nM or less, 1 nM or less, or in embodiments 500 pM or less, 100 pM or less, 50 pM or less or 25 pM or less. An antibody that does not exhibit significant crossreactivity is one that will not appreciably bind to an entity other than its target (e.g., a different epitope or a different molecule). For example, an antibody that specifically binds to a target molecule will appreciably bind the target molecule but will not significantly react with non-target molecules or peptides. An antibody specific for a particular epitope will, for example, not significantly crossreact with remote epitopes on the same protein or peptide. Specific binding can be determined according to any art-recognized means for determining such binding. Preferably, specific binding is determined according to Scatchard analysis and/or competitive binding assays.

    [0100] As used herein, the term affinity refers to the strength of the binding of a single antigen-combining site with an antigenic determinant. Affinity depends on the closeness of stereochemical fit between antibody combining sites and antigen determinants, on the size of the area of contact between them, on the distribution of charged and hydrophobic groups, etc. Antibody affinity can be measured by equilibrium dialysis or by the kinetic BIACORE? method. The dissociation constant, Kd, and the association constant, Ka, are quantitative measures of affinity.

    [0101] In certain embodiments, the antibodies described herein or identified according to the methods described herein are blocking antibodies. As used herein, a blocking antibody or an antibody antagonist is one which inhibits or reduces biological activity of the antigen(s) it binds. In certain embodiments, the blocking antibodies or antagonist antibodies or portions completely inhibit the biological activity of the antigen(s). For example, the present invention includes antibodies which disrupt receptor/ligand interactions either partially or fully.

    Therapeutic Antibody Modifications

    [0102] In certain example embodiments, the therapeutic antibodies of the present invention may be modified, such that they acquire advantageous properties for therapeutic use (e.g., stability and specificity), but maintain their biological activity. Therapeutic antibodies may be modified to increase stability or to provide characteristics that improve efficacy of the antibody when administered to a subject in vivo. As used herein in reference to therapeutic antibodies, the terms modified, modification and the like refer to one or more changes that enhance a desired property of the therapeutic antibody. Modification includes a covalent chemical modification that does not alter the primary amino acid sequence of the therapeutic antibody itself. Such desired properties include, for example, prolonging the in vivo half-life, increasing the stability, reducing the clearance, altering the immunogenicity or allergenicity, or cellular targeting. Changes to a therapeutic antibody that may be carried out include, but are not limited to, conjugation to a carrier protein, conjugation to a ligand, conjugation to another antibody, PEGylation, polysialylation HESylation, recombinant PEG mimetics, Fc fusion, albumin fusion, nanoparticle attachment, nanoparticulate encapsulation, cholesterol fusion, iron fusion, acylation, amidation, glycosylation, side chain oxidation, phosphorylation, biotinylation, the addition of a surface active material, the addition of amino acid mimetics, or the addition of unnatural amino acids. Modified therapeutic antibodies also include analogs. By analog is meant a molecule that is not identical, but has analogous functional or structural features. For example, a therapeutic antibody analog retains the biological activity of a corresponding antibody, while having certain biochemical modifications that enhance the analog's function relative to another antibody. Such biochemical modifications could increase the analog's protease resistance, membrane permeability, or half-life, without altering, for example, antigen binding. An analog may include an unnatural amino acid.

    [0103] The recitation of a listing of chemical groups in any definition of a variable herein includes definitions of that variable as any single group or combination of listed groups. The recitation of an embodiment for a variable or aspect herein includes that embodiment as any single embodiment or in combination with any other embodiments or portions thereof.

    [0104] Modified antibodies (e.g., fusion proteins) may include a spacer or a linker. The terms spacer or linker as used in reference to a fusion protein refers to a peptide that joins the proteins comprising a fusion protein. Generally, a spacer has no specific biological activity other than to join or to preserve some minimum distance or other spatial relationship between the proteins. However, in certain embodiments, the constituent amino acids of a spacer may be selected to influence some property of the molecule such as the folding, net charge, or hydrophobicity of the molecule. Suitable linkers for use in an embodiment of the present invention are well known to those of skill in the art and include, but are not limited to, straight or branched-chain carbon linkers, heterocyclic carbon linkers, or peptide linkers. The linker is used to separate two peptides by a distance sufficient to ensure that, in a preferred embodiment, each peptide properly folds. Preferred peptide linker sequences adopt a flexible extended conformation and do not exhibit a propensity for developing an ordered secondary structure. Typical amino acids in flexible protein regions include Gly, Asn and Ser. Virtually any permutation of amino acid sequences containing Gly, Asn and Ser would be expected to satisfy the above criteria for a linker sequence. Other near neutral amino acids, such as Thr and Ala, also may be used in the linker sequence. Still other amino acid sequences that may be used as linkers are disclosed in Maratea et al. (1985), Gene 40: 39-46; Murphy et al. (1986) Proc. Nat'l. Acad. Sci. USA 83: 8258-62; U.S. Pat. Nos. 4,935,233; and 4,751,180.

    [0105] The clinical effectiveness of protein therapeutics (e.g., antibodies) is often limited by short plasma half-life and susceptibility to protease degradation. Studies of various therapeutic proteins (e.g., filgrastim) have shown that such difficulties may be overcome by various modifications, including conjugating or linking the polypeptide sequence to any of a variety of non-proteinaceous polymers, e.g., polyethylene glycol (PEG), polypropylene glycol, or polyoxyalkylenes (see, for example, typically via a linking moiety covalently bound to both the protein and the nonproteinaceous polymer, e.g., a PEG).

    [0106] It is well known that the properties of certain proteins can be modulated by attachment of polyethylene glycol (PEG) polymers, which increases the hydrodynamic volume of the protein and thereby slows its clearance by kidney filtration. (See, e.g., Clark et al., J. Biol. Chem. 271: 21969-21977 (1996)). Such PEG-conjugated biomolecules have been shown to possess clinically useful properties, including better physical and thermal stability, protection against susceptibility to enzymatic degradation, increased solubility, longer in vivo circulating half-life and decreased clearance, reduced immunogenicity and antigenicity, and reduced toxicity. Therefore, it is envisioned that certain agents can be PEGylated (e.g., on peptide residues) to provide enhanced therapeutic benefits such as, for example, increased efficacy by extending half-life in vivo. In certain embodiments, PEGylation of the agents may be used to extend the serum half-life of the agents and allow for particular agents to be capable of crossing the blood-brain barrier. Thus, in one embodiment, PEGylating antibodies improve the pharmacokinetics and pharmacodynamics of the antibodies.

    [0107] In regards to peptide PEGylation methods, reference is made to Lu et al., Int. J. Pept. Protein Res. 43: 127-38 (1994); Lu et al., Pept. Res. 6: 140-6 (1993); Felix et al., Int. J. Pept. Protein Res. 46: 253-64 (1995); Gaertner et al., Bioconjug. Chem. 7: 38-44 (1996); Tsutsumi et al., Thromb. Haemost. 77: 168-73 (1997); Francis et al., hit. J. Hematol. 68: 1-18 (1998); Roberts et al., J. Pharm. Sci. 87: 1440-45 (1998); and Tan et al., Protein Expr. Purif. 12: 45-52 (1998). Polyethylene glycol or PEG is meant to encompass any of the forms of PEG that have been used to derivatize other proteins, including, but not limited to, mono-(C1-10) alkoxy or aryloxy-polyethylene glycol. Suitable PEG moieties include, for example, 40 kDa methoxy poly(ethylene glycol) propionaldehyde (Dow, Midland, Mich.); 60 kDa methoxy poly(ethylene glycol) propionaldehyde (Dow, Midland, Mich.); 40 kDa methoxy poly(ethylene glycol) maleimido-propionamide (Dow, Midland, Mich.); 31 kDa alpha-methyl-w-(3-oxopropoxy), polyoxyethylene (NOF Corporation, Tokyo); mPEG2-NHS-40k (Nektar); mPEG2-MAL-40k (Nektar), SUNBRIGHT GL2-400MA ((PEG)240 kDa) (NOF Corporation, Tokyo), SUNBRIGHT ME-200MA (PEG20 kDa) (NOF Corporation, Tokyo). The PEG groups are generally attached to the peptide (e.g., RBD) via acylation or alkylation through a reactive group on the PEG moiety (for example, a maleimide, an aldehyde, amino, thiol, or ester group) to a reactive group on the peptide (for example, an aldehyde, amino, thiol, a maleimide, or ester group).

    [0108] The PEG molecule(s) may be covalently attached to any Lys, Cys, or K(CO(CH2)2SH) residues at any position in a peptide. In certain embodiments, the antibodies described herein can be PEGylated directly to any amino acid at the N-terminus by way of the N-terminal amino group. A linker arm may be added to a peptide to facilitate PEGylation. PEGylation at the thiol sidechain of cysteine has been widely reported (see, e.g., Caliceti & Veronese, Adv. Drug Deliv. Rev. 55: 1261-77 (2003)). If there is no cysteine residue in the peptide, a cysteine residue can be introduced through substitution or by adding a cysteine to the N-terminal amino acid. In certain embodiments, proteins are PEGylated through the side chains of a cysteine residue added to the N-terminal amino acid.

    [0109] In exemplary embodiments, the PEG molecule(s) may be covalently attached to an amide group in the C-terminus of a peptide. In certain embodiments, the PEG molecule used in modifying an agent of the present invention is branched while in other embodiments, the PEG molecule may be linear. In particular aspects, the PEG molecule is between 1 kDa and 100 kDa in molecular weight. In further aspects, the PEG molecule is selected from 10, 20, 30, 40, 50, 60, and 80 kDa. In further still aspects, it is selected from 20, 40, or 60 kDa. Where there are two PEG molecules covalently attached to the agent of the present invention, each is 1 to 40 kDa and in particular aspects, they have molecular weights of 20 and 20 kDa, 10 and 30 kDa, 30 and 30 kDa, 20 and 40 kDa, or 40 and 40 kDa. In particular aspects, the antibodies contain mPEG-cysteine. The mPEG in mPEG-cysteine can have various molecular weights. The range of the molecular weight is preferably 5 kDa to 200 kDa, more preferably 5 kDa to 100 kDa, and further preferably 20 kDa to 60 kDA. The mPEG can be linear or branched.

    [0110] The present disclosure also contemplates the use of PEG Mimetics. Recombinant PEG mimetics have been developed that retain the attributes of PEG (e.g., enhanced serum half-life) while conferring several additional advantageous properties. By way of example, simple polypeptide chains (comprising, for example, Ala, Glu, Gly, Pro, Ser and Thr) capable of forming an extended conformation similar to PEG can be produced recombinantly already fused to the antibodies (e.g., Amunix' XTEN technology; Mountain View, CA). This obviates the need for an additional conjugation step during the manufacturing process. Moreover, established molecular biology techniques enable control of the side chain composition of the polypeptide chains, allowing optimization of immunogenicity and manufacturing properties.

    [0111] Glycosylation can dramatically affect the physical properties of proteins and can also be important in protein stability, secretion, and subcellular localization (see, e.g., Sol? and Griebenow, Glycosylation of Therapeutic Proteins: An Effective Strategy to Optimize Efficacy. BioDrugs. 2010; 24(1): 9-21). Proper glycosylation can be essential for biological activity. In fact, some genes from eukaryotic organisms, when expressed in bacteria (e.g., E. coli) which lack cellular processes for glycosylating proteins, yield proteins that are recovered with little or no activity by virtue of their lack of glycosylation. For purposes of the present disclosure, glycosylation is meant to broadly refer to the enzymatic process that attaches glycans to proteins, lipids or other organic molecules. The use of the term glycosylation in conjunction with the present disclosure is generally intended to mean adding or deleting one or more carbohydrate moieties (either by removing the underlying glycosylation site or by deleting the glycosylation by chemical and/or enzymatic means), and/or adding one or more glycosylation sites that may or may not be present in the original sequence.

    [0112] Addition of glycosylation sites can be accomplished by altering the amino acid sequence. The alteration to the polypeptide may be made, for example, by the addition of, or substitution by, one or more serine or threonine residues (for O-linked glycosylation sites) or asparagine residues (for N-linked glycosylation sites). The structures of N-linked and O-linked oligosaccharides and the sugar residues found in each type may be different. One type of sugar that is commonly found on both is N-acetylneuraminic acid (hereafter referred to as sialic acid). Sialic acid is usually the terminal residue of both N-linked and O-linked oligosaccharides and, by virtue of its negative charge, may confer acidic properties to the glycoprotein. A particular embodiment of the present disclosure comprises the generation and use of N-glycosylation variants.

    [0113] The present disclosure also contemplates the use of polysialylation, the conjugation of peptides and proteins to the naturally occurring, biodegradable a-(2.fwdarw.8) linked polysialic acid (PSA) in order to improve their stability and in vivo pharmacokinetics. PSA is a biodegradable, non-toxic natural polymer that is highly hydrophilic, giving it a high apparent molecular weight in the blood which increases its serum half-life. In addition, polysialylation of a range of peptide and protein therapeutics has led to markedly reduced proteolysis, retention of activity in vivo activity, and reduction in immunogenicity and antigenicity (see, e.g., G. Gregoriadis et al., Int. J. Pharmaceutics 300(1-2): 125-30). As with modifications with other conjugates (e.g., PEG), various techniques for site-specific polysialylation are available (see, e.g., T. Lindhout et al., PNAS 108(18)7397-7402 (2011)).

    [0114] Additional suitable components and molecules for conjugation include, for example, thyroglobulin; albumins such as human serum albumin (HAS); tetanus toxoid; Diphtheria toxoid; polyamino acids such as poly(D-lysine:D-glutamic acid); VP6 polypeptides of rotaviruses; influenza virus hemaglutinin, influenza virus nucleoprotein; Keyhole Limpet Hemocyanin (KLH); and hepatitis B virus core protein and surface antigen; or any combination of the foregoing.

    [0115] Fusion of albumin to one or more antibodies of the present disclosure can, for example, be achieved by genetic manipulation, such that the DNA coding for HSA, or a fragment thereof, is joined to the DNA coding for the one or more antibodies. Albumin itself may be modified to extend its circulating half-life. Fusion of the modified albumin to one or more polypeptides can be attained by the genetic manipulation techniques described above or by chemical conjugation; the resulting fusion molecule has a half-life that exceeds that of fusions with non-modified albumin. (See WO2011/051489).

    [0116] Several albumin-binding strategies have been developed as alternatives for direct fusion, including albumin binding through a conjugated fatty acid chain (acylation). Because serum albumin is a transport protein for fatty acids, these natural ligands with albumin-binding activity have been used for half-life extension of small protein therapeutics. For example, insulin determir (LEVEMIR), an approved product for diabetes, comprises a myristyl chain conjugated to a genetically-modified insulin, resulting in a long-acting insulin analog.

    [0117] Another type of modification is to conjugate (e.g., link) one or more additional components or molecules at the N- and/or C-terminus of a polypeptide sequence, such as another protein, or a carrier molecule. Thus, an exemplary polypeptide sequence can be provided as a conjugate with another component or molecule. A conjugate modification may result in a polypeptide sequence that retains activity with an additional or complementary function or activity of the second molecule. For example, a polypeptide sequence may be conjugated to a molecule, e.g., to facilitate solubility, storage, in vivo or shelf half-life or stability, reduction in immunogenicity, delayed or controlled release in vivo, etc. Other functions or activities include a conjugate that reduces toxicity relative to an unconjugated polypeptide sequence, a conjugate that targets a type of cell or organ more efficiently than an unconjugated polypeptide sequence, or a drug to further counter the causes or effects associated with a disorder or disease as set forth herein.

    [0118] The present disclosure contemplates the use of other modifications, currently known or developed in the future, of the polypeptides to improve one or more properties. One such method for prolonging the circulation half-life, increasing the stability, reducing the clearance, or altering the immunogenicity or allergenicity of a polypeptide of the present disclosure involves modification of the polypeptide sequences by hesylation, which utilizes hydroxyethyl starch derivatives linked to other molecules in order to modify the molecule's characteristics. Various aspects of hesylation are described in, for example, U.S. Patent Appln. Nos. 2007/0134197 and 2006/0258607.

    [0119] In particular embodiments, the antibodies include a protecting group covalently joined to the N-terminal amino group. In exemplary embodiments, a protecting group covalently joined to the N-terminal amino group of the proteins reduces the reactivity of the amino terminus under in vivo conditions. Amino protecting groups include C1-10 alkyl, C1-10 substituted alkyl, C2-10 alkenyl, C2-10 substituted alkenyl, aryl, C1-6 alkyl aryl, C(O)(CH2)1-6-COOH, C(O)C1-6 alkyl, C(O)-aryl, C(O)O-C1-6 alkyl, or C(O)O-aryl. In particular embodiments, the amino terminus protecting group is selected from the group consisting of acetyl, propyl, succinyl, benzyl, benzyloxycarbonyl, and t-butyloxycarbonyl. In other embodiments, deamination of the N-terminal amino acid is another modification that may be used for reducing the reactivity of the amino terminus under in vivo conditions.

    [0120] Chemically modified compositions of the antibodies wherein the antibody is linked to a polymer are also included within the scope of the present invention. The polymer selected is usually modified to have a single reactive group, such as an active ester for acylation or an aldehyde for alkylation, so that the degree of polymerization may be controlled. Included within the scope of polymers is a mixture of polymers. Preferably, for therapeutic use of the end-product preparation, the polymer will be pharmaceutically acceptable. The polymer or mixture thereof may include but is not limited to polyethylene glycol (PEG), monomethoxy-polyethylene glycol, dextran, cellulose, or other carbohydrate-based polymers, poly-(N-vinyl pyrrolidone) polyethylene glycol, propylene glycol homopolymers, a polypropylene oxide/ethylene oxide co-polymer, polyoxyethylated polyols (for example, glycerol), and polyvinyl alcohol.

    [0121] In other embodiments, the antibodies are modified by PEGylation, cholesterylation, or palmitoylation. The modification can be to any amino acid residue. In preferred embodiments, the modification is to the N-terminal amino acid of the antibodies, either directly to the N-terminal amino acid or by way coupling to the thiol group of a cysteine residue added to the N-terminus or a linker added to the N-terminus such as trimesoyl tris(3,5-dibromosalicylate (Ttds). In certain embodiments, the N-terminus of the antibodies comprise a cysteine residue to which a protecting group is coupled to the N-terminal amino group of the cysteine residue and the cysteine thiolate group is derivatized with N-ethylmaleimide, PEG group, cholesterol group, or palmitoyl group. In other embodiments, an acetylated cysteine residue is added to the N-terminus of the agents, and the thiol group of the cysteine is derivatized with N-ethylmaleimide, PEG group, cholesterol group, or palmitoyl group. In certain embodiments, the antibodies of the present invention consist of an amino acid sequence which is bound with a methoxypolyethylene glycol(s) via a linker.

    [0122] Substitutions of amino acids may be used to modify an antibody of the present invention. The phrase substitution of amino acids as used herein encompasses substitution of amino acids that are the result of both conservative and non-conservative substitutions. Conservative substitutions are the replacement of an amino acid residue by another similar residue in a polypeptide. Typical but not limiting conservative substitutions are the replacements, for one another, among the aliphatic amino acids Ala, Val, Leu and Ile; interchange of Ser and Thr containing hydroxy residues, interchange of the acidic residues Asp and Glu, interchange between the amide-containing residues Asn and Gln, interchange of the basic residues Lys and Arg, interchange of the aromatic residues Phe and Tyr, and interchange of the small-sized amino acids Ala, Ser, Thr, Met, and Gly. Non-conservative substitutions are the replacement, in a polypeptide, of an amino acid residue by another residue which is not biologically similar. For example, the replacement of an amino acid residue with another residue that has a substantially different charge, a substantially different hydrophobicity, or a substantially different spatial configuration.

    [0123] In certain embodiments, antibodies of the present invention are modified by affinity maturation. Affinity maturation refers to the introduction of random mutations across the full length of selected CDR or variable chains and screening for increased affinity or neutralization activity. In certain embodiments, phage display or ribosome display is used to produce antibodies with increased affinity for the antigen. The in vitro affinity maturation has successfully been used to optimize antibodies, antibody fragments or other peptide molecules like antibody mimetics. Random mutations inside the CDRs are introduced using radiation, chemical mutagens or error-prone PCR. In addition, the genetic diversity can be increased by chain shuffling. Two or three rounds of mutation and selection using display methods like phage display usually results in antibody fragments with affinities in the low nanomolar range (see, e.g., Roskos L.; Klakamp S.; Liang M.; Arends R.; Green L. (2007). Stefan D?bel (ed.). Handbook of Therapeutic Antibodies. Weinheim: Wiley-VCH. pp. 145-169).

    [0124] One of skill in the art from this disclosure and the knowledge in the art will appreciate that there are a variety of ways in which to produce such therapeutic antibodies. In general, such therapeutic antibodies may be produced either in vitro or in vivo. Therapeutic antibodies may be produced in vitro as peptides or polypeptides, which may then be formulated into a pharmaceutical composition and administered to a subject. Such in vitro production may occur by a variety of methods known to one of skill in the art such as, for example, peptide synthesis or expression of a peptide/polypeptide from a DNA or RNA molecule in any of a variety of bacterial, eukaryotic, or viral recombinant expression systems, followed by purification of the expressed antibodies (e.g., with protein A or G). Alternatively, antibodies may be produced in vivo by introducing molecules (e.g., DNA, RNA, viral expression systems, and the like) that encode antibodies into a subject, whereupon the encoded therapeutic antibodies are expressed.

    [0125] In certain embodiments, the antibodies as defined for the present invention include derivatives that are modified, i.e., by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from generating an anti-idiotypic response. For example, but not by way of limitation, the antibody derivatives include antibodies that have been modified, e.g., by glycosylation, acetylation, pegylation, phosphylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, metabolic synthesis of tunicamycin, etc. Additionally, the derivative may contain one or more non-classical amino acids.

    Administration of Therapeutic Antibodies

    [0126] For therapeutic uses, the antibodies described herein may be administered systemically, for example, formulated in a pharmaceutically-acceptable buffer such as physiological saline. Preferable routes of administration include, for example, subcutaneous, intravenous, interperitoneal, intramuscular, or intradermal injections that provide continuous, sustained levels of the antibody in the patient. Treatment of human patients or other animals will be carried out using a therapeutically effective amount of a therapeutic identified herein in a physiologically-acceptable carrier. Suitable carriers and their formulation are described, for example, in Remington's Pharmaceutical Sciences by E. W. Martin. The amount of the therapeutic agent to be administered varies depending upon the manner of administration, the age and body weight of the patient, and with the clinical symptoms of the neoplasia. Generally, amounts will be in the range of those used for other agents used in the treatment of other diseases associated with neoplasia, although in certain instances lower amounts will be needed because of the increased specificity of the compound. For example, a therapeutic compound is administered at a dosage that is cytotoxic to a neoplastic cell.

    [0127] Human dosage amounts can initially be determined by extrapolating from the amount of antibody used in mice, as a skilled artisan recognizes it is routine in the art to modify the dosage for humans compared to animal models. Of course, this dosage amount may be adjusted upward or downward, as is routinely done in such treatment protocols, depending on the results of the initial clinical trials and the needs of a particular patient.

    [0128] The therapeutic regimens disclosed herein comprise administration of antibodies of the invention or pharmaceutical compositions thereof to the patient in a single dose or in multiple doses (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 10, 15, 20, or more doses). In one aspect, the therapeutic regimens comprise administration of the antibodies of the invention or pharmaceutical compositions thereof in multiple doses. When administered in multiple doses, the antibodies are administered with a frequency and in an amount sufficient to treat SARS-COV-2. For example, the frequency of administration ranges from once a day up to about four times a day. In another example, the frequency of administration ranges from about once a week up to about once every six weeks.

    [0129] Significant progress has been made in understanding pharmacokinetics (PK), pharmacodynamics (PD), as well as toxicity profiles of therapeutic antibodies in animals and humans, which have been in commercial development for more than three decades (see, e.g., Vugmeyster et al., Pharmacokinetics and toxicology of therapeutic proteins: Advances and challenges, World J Biol Chem. 2012 Apr. 26; 3(4): 73-92). In certain embodiments, therapeutic antibodies are administered by parenteral routes, such as intravenous (IV), subcutaneous (SC) or intramuscular (IM) injection. Molecular size, hydrophilicity, and gastric degradation are the main factors that preclude gastrointestinal (GI) absorption of therapeutic proteins (see, e.g., Keizer, et al., Clinical pharmacokinetics of therapeutic monoclonal antibodies. Clin Pharmacokinet. 2010 August; 49(8):493-507). Pulmonary delivery with aerosol formulations or dry powder inhalers has been used for selected proteins, e.g., exubera? (see, e.g., Scheuch and Siekmeier, Novel approaches to enhance pulmonary delivery of proteins and peptides. J Physiol Pharmacol. 2007 November; 58 Suppl 5(Pt 2):615-25). Intravitreal injections have been used for peptides and proteins that require only local activity (see, e.g., Suresh, et al., Ocular Delivery of Peptides and Proteins. In: Van Der Walle C., editor. Peptide and Protein Delivery. London: Academic Press; 2011. pp. 87-103). In certain embodiments, SC administration of therapeutic antibodies is often a preferred route. In particular, the suitability of SC dosing for self-administration translates into significantly reduced treatment costs.

    [0130] The pharmaceutical composition may be administered parenterally by injection, infusion or implantation (subcutaneous, intravenous, intramuscular, intraperitoneal, or the like) in dosage forms, formulations, or via suitable delivery devices or implants containing conventional, non-toxic pharmaceutically acceptable carriers and adjuvants. The formulation and preparation of such compositions are well known to those skilled in the art of pharmaceutical formulation. Formulations can be found in Remington: The Science and Practice of Pharmacy, supra.

    [0131] As indicated above, the pharmaceutical compositions according to the invention may be in the form suitable for sterile injection. To prepare such a composition, the suitable antibodies are dissolved or suspended in a parenterally acceptable liquid vehicle. Among acceptable vehicles and solvents that may be employed are water, water adjusted to a suitable pH by addition of an appropriate amount of hydrochloric acid, sodium hydroxide or a suitable buffer, 1,3-butanediol, Ringer's solution, and isotonic sodium chloride solution and dextrose solution. The aqueous formulation may also contain one or more preservatives (e.g., methyl, ethyl or n-propyl p-hydroxybenzoate).

    Vector Delivery

    [0132] The invention also provides a delivery system comprising one or more vectors or one or more polynucleotide molecules, the one or more vectors or polynucleotide molecules comprising one or more polynucleotide molecules encoding an antibody of the present invention.

    [0133] In general, and throughout this specification, the term vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. Vectors include, but are not limited to, nucleic acid molecules that are single-stranded, double-stranded, or partially double-stranded; nucleic acid molecules that comprise one or more free ends, no free ends (e.g., circular); nucleic acid molecules that comprise DNA, RNA, or both; and other varieties of polynucleotides known in the art. One type of vector is a plasmid, which refers to a circular double stranded DNA loop into which additional DNA segments can be inserted, such as by standard molecular cloning techniques. Another type of vector is a viral vector, wherein virally-derived DNA or RNA sequences are present in the vector for packaging into a virus (e.g., retroviruses, replication defective retroviruses, adenoviruses, replication defective adenoviruses, and adeno-associated viruses). Viral vectors also include polynucleotides carried by a virus for transfection into a host cell. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively-linked. Such vectors are referred to herein as expression vectors. Vectors for and that result in expression in a eukaryotic cell can be referred to herein as eukaryotic expression vectors. Common expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.

    Identification of Neutralizing Antibodies

    [0134] Applicants identified specific gene signatures present in B cells that produced neutralizing antibodies (clusters 3 and 4 of Table 4). In certain embodiments, neutralizing antibodies are identified by first enriching for B cells expressing the signature. In certain embodiments, cell sorting using antibodies specific for surface markers in the signatures are used to enrich for the cell types. In certain embodiments, fluorescence-activated cell sorting (FACS) can be used to enrich for the B cells. In certain embodiments, magnetic beads specific for surface markers can be used to enrich for the B cells. In certain embodiments, B cells are enriched from a subject infected with the pathogen (e.g., virus). Antibodies for any pathogen may be identified by enriching for B cells having the disclosed signatures followed by sequencing of the antibody sequences from the enriched cells.

    [0135] In certain embodiments, B cells are obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as Ficoll separation. In one preferred embodiment, cells from the circulating blood of an individual are obtained by apheresis or leukapheresis. The apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets. In one embodiment, the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps. In one embodiment of the invention, the cells are washed with phosphate buffered saline (PBS). B cells can be further isolated by positive or negative selection. A preferred method is cell sorting and/or selection via magnetic immunoadherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells positively or negatively selected. Such separation can be performed using standard methods available in the art. For example, any magnetic separation methodology may be used including a variety of which are commercially available, (e.g., DYNAL? Magnetic Particle Concentrator (DYNAL MPC?)).

    [0136] In certain embodiments, the method includes assays capable of validating antibody binding and neutralization activity. In certain embodiments, the validation assay is an immunoassay. Immunoassay methods are based on the reaction of an antibody to its corresponding target or analyte and can detect the analyte in a sample depending on the specific assay format. Immunoassays have been designed for use with a wide range of biological sample matrices Immunoassay formats have been designed to provide qualitative, semi-quantitative, and quantitative results. Quantitative results may be generated by determining the concentration of analyte detected by an antibody.

    [0137] Numerous immunoassay formats have been designed. Exemplary assay formats include enzyme-linked immunosorbent assay (ELISA), radioimmunoassay, fluorescent, chemiluminescence, and fluorescence resonance energy transfer (FRET) or time resolved-FRET (TR-FRET) immunoassays. ELISA or EIA can be quantitative for the detection of an analyte/biomarker. This method relies on attachment of a label to either the analyte or the antibody and the label component includes, either directly or indirectly, an enzyme. ELISA tests may be formatted for direct, indirect, competitive, or sandwich detection of the analyte. Additional techniques include, for example, agglutination, nephelometry, turbidimetry, Western blot, immunoprecipitation, immunocytochemistry, immunohistochemistry, flow cytometry, Luminex assay, and others (see ImmunoAssay: A Practical Guide, edited by Brian Law, published by Taylor & Francis, Ltd., 2005 edition).

    [0138] Viral neutralizing assays can be used to validate identified antibody frameworks. In certain embodiments, the assay uses live virus. In certain embodiments, the assay uses pseudotyped virus particles (see, e.g., Gentili, 2015). In certain embodiments, the neutralizing assay is performed without live virus (see, e.g., Tan, C. W., Chia, W. N., Qin, X. et al. A SARS-CoV-2 surrogate virus neutralization test based on antibody-mediated blockage of ACE2-spike protein-protein interaction. Nat Biotechnol 38, 1073-1078 (2020).

    [0139] Further embodiments are illustrated in the following Examples which are given for illustrative purposes only and are not intended to limit the scope of the invention.

    EXAMPLES

    Example 1B Cell Genomics and Structural Studies Uncover Cross-Neutralizing SARS-COV-2 Antibodies

    [0140] Applicants used scRNA-Seq to investigate SARS-COV-2 spike-specific B cell responses in 14 subjects who had recovered from COVID-19. By matching the VDJ sequence and transcriptional profile with neutralization and binding studies from 92 monoclonal antibodies produced from single B cells, Applicants identified two transcriptional clusters that are enriched in B cells that produce binding and neutralizing antibodies. Six of the most potently neutralizing antibodies in the collection derived from B cells in these two transcriptional clusters were structurally characterized. Applicants found that they adopt distinct RBD-binding orientations, including the BG10-19 antibody that reaches between adjacent RBDs on the protomers of a single spike trimer, resulting in a locked spike trimer conformation that cannot bind ACE2. BG10-19 binds adjacent RBDs in a manner distinct from previously-described antibodies that lock the trimer into a closed conformation (Barnes et al., 2020a; Tortorici, 2020). It recognizes SARS-COV-2, SARS-COV, and zoonotic RBDs, and demonstrated potent neutralization of SARS-COV-2, the UK variant B.1.1.7 (Davies et al., 2021), the South African variant B.1.351 (Tegally et al., 2020) as well as the heterologous SARS-COV pseudotyped viruses. Furthermore, characterization of antibodies belonging to the VH3-53/VH3-66-encoded class (Barnes et al., 2020b; Wu et al., 2020a; Yuan et al., 2020) showed common binding modes for antibodies with short (<14 amino acids) and long (>15 amino acids) CDRH3 loops, providing new insights into this recurring class of SARS-COV-2 neutralizing antibodies.

    [0141] A cohort of recently recovered COVID-19 patients shows serum neutralizing activity. To understand the development of B cell responses after SARS-COV-2 infection, Applicants enrolled 14 subjects who had recently recovered from COVID-19. All subjects were diagnosed in March 2020, none required hospitalization, and the time between diagnosis and enrollment of subjects ranged between 31 and 61 days with a median of 51 days (Table 1). 12 of 14 subjects were diagnosed with COVID-19 using PCR-based testing at the time of presentation. The remaining two subjects were diagnosed based on serum reactivity to RBD in ELISA, clinical symptoms and history of recent exposure (Table 1). All subjects had serum antibodies against RBD in ELISA (Table 1).

    [0142] To evaluate serum neutralizing activity, Applicants used a pseudotyped virus with SARS-COV-2 spike (S) protein (Robbiani et al., 2020; Schmidt et al., 2020)(STAR Methods). Applicants detected serum neutralization in 11 of 14 (79%) subjects (FIG. 8A, Table 1). ID.sub.50 titers ranged from 51 to 655, and no correlation was seen between serum neutralization and time since diagnosis or age of the subjects (FIG. 8B, C, Table 1). Although 3 of the top 4 neutralizing sera were obtained from male subjects, there was no statistically significant difference between serum neutralizing activity in female versus male subjects (FIG. 8D, Table 1). Applicants conclude that serum neutralizing activity was detected in a majority of subjects in this cohort of recently recovered non-hospitalized SARS-COV-2 patients.

    [0143] SARS-COV-2 binding B cell repertoires from recovered subjects are enriched for class 1 neutralizing antibodies against RBD. To characterize the B cell response against the SARS-COV-2 spike, Applicants sorted a total of 6,113 B cells from 14 subjects that bound to the SARS-COV-2 receptor binding domain (RBD) or SARS-COV-2 S trimer (Wrapp et al., 2020) using fluorescence-activated cell sorting (FACS) (FIGS. 1A, B). The frequency of SARS-COV-2 S- or RBD-binding B cells ranged from 0.05-0.3% of CD19+ B cells (FIGS. 1A, B). Applicants profiled sorted cells by 5 directed scRNA-Seq for both mRNA and paired VDJ profiling, recovering matched single-cell VDJ and transcriptome profiles in 129-649 cells for SARS-COV-2 S and 47-487 cells for RBD per donor (FIG. 1C). Applicants identified clonally related B cells of each donor, by accounting for V and J gene similarities as well as sequence similarity between the heavy chain complementarity-determining region (CDRH3) amino acid sequences (Nouri and Kleinstein, 2018). Expanded B cell clones, which Applicants define as the clones with at least 2 clonally related cells in the samples, accounted for 7-45% of sorted B cells in the 14 subjects (FIG. 1D).

    [0144] Applicants tested if the sorted B cell repertoires include cells that have undergone somatic hypermutation and class switch recombination, two steps in the pathway to generate high affinity B cell responses (Victora and Nussenzweig, 2012). Assessing immunoglobulin isotypes, Applicants found that the fractions of IgG.sup.+, IgM/IgD.sup.+ and IgA.sup.+ B cells varied substantially among subjects (9-48%, 48-87% and 3-12% respectively) (FIG. 8E). When Applicants investigated clonal expansion within each antibody isotype, Applicants found that in 8 of 14 subjects IgM+ clones were statistically significantly more expanded than either IgA+ clones or IgG+ clones or both (FIG. 8O). Inferring levels of somatic mutations (from RNA, Methods), the total number of inferred heavy chain somatic mutations was lower in SARS-COV-2 S- and RBD-binding B cells than in historic control memory B cells (Rubelt et al., 2012) (FIG. 8F). IgM.sup.+ and IgD.sup.+ SARS-CoV-2 binding B cells showed significantly lower levels of inferred heavy chain somatic mutations compared to IgG.sup.+ and IgA.sup.+ B cells (FIG. 8G). Lower levels of somatic mutations were especially observed in IgM+ B cells with low clonal expansion as 9/14 subjects showed a statistically significant positive correlation between clone size and number of inferred heavy chain mutations in their IgM+ repertoire as opposed to IgG+ and IgA+ cells where this positive correlation was only observed in 4 and 0 subjects respectively (FIG. 8P).

    [0145] Applicants next tested if the sorted B cells were enriched for immunoglobulin genes VH3-53 and VH3-66, as class 1 antibodies that block ACE2 binding to the RBD show a preference for VH3-53 and VH3-66 heavy chain genes (Barnes et al., 2020b; Wu et al., 2020a; Yuan et al., 2020). Several class 1 antibodies have been isolated from different subjects, most of which carry CDRH3 regions that are shorter than 14 amino acids (IMGT definition; (Lefranc et al., 2015)) (Barnes et al., 2020b; Wu et al., 2020a; Yuan et al., 2020). Applicants thus compared the frequency of these two VH genes to combined historic control memory B cells from 14 healthy donors (Rubelt et al., 2012). 13 of the 14 recovered donors showed a higher fraction of combined VH3-53/VH3-66 in B cell repertoires against SARS-COV-2 S, RBD or both compared to historic memory B cell controls. This difference was statistically significant in 10 of 14 (71%, FDR<0.1, Two-proportions z-test) subjects (FIG. 1E) and remained significant in 10 of 14 (71%, FDR<0.1, Two-proportions z-test) subjects when considering only antibodies with CDRH3 regions shorter than 14 amino acids (not shown). Among other antibody features, the kappa and lambda light chain ratios were comparable to historic controls (FIG. 8H), whereas CDRH3 length and hydrophobicity were slightly increased and CDRH3 charge was decreased, and these differences existed for both S- and RBD-binding B cells (FIGS. 8I-K) and across Ig isotypes (FIGS. 8L-N). Thus, the B cell repertoire that binds to SARS-COV-2 S and SARS-COV-2 RBD in recovered individuals includes class switched IgG and IgA affinity maturated B cells and is enriched for heavy chain genes that are associated with class 1 neutralizing antibodies. See, also, FIGS. 15, 28 and 29.

    [0146] SARS-COV-2 spike binding monoclonal antibodies are directed against RBD and targets outside of the RBD. To functionally evaluate selected antibodies, Applicants chose 4 of the 14 subjects with the highest serum neutralization titers (FIG. 8A and Table 1) and produced a total of 92 antibodies from these donors (Table 2). The selection of antibodies consisted of 72 representatives from most of the expanded B cell clones in these subjects and 20 singlets (FIGS. 9A-D). All of the selected antibodies selected were expressed as IgG1s in order to allow for direct comparison of binding and neutralization and were initially evaluated for binding by ELISA. 56 of 92 antibodies (61%) showed strong or intermediate binding to either SARS-COV-2 S, RBD, or both in ELISA (FIG. 2A and Table 3). 42 of 56 strong or intermediate binders (75%) bound to both SARS-COV-2 S and RBD, 9 of 56 strong or intermediate binders (16%) only bound to SARS-CoV-2 S, and 5 of 56 (9%) only to RBD (FIG. 2A and Table 3). Applicants conclude that most antibodies isolated from SARS-COV-2 S- and RBD-binding B cells target either the RBD or epitopes on the spike outside of the RBD.

    [0147] Table 2A-2B. Selected Antibodies for functional evaluation (related to FIGS. 2 and 9). All neutralization results in this table are from antibodies expressed as IgG1. A. Shown are isotype, VH gene, CDRH3 amino acid sequence, light chain kappa or lambda light chain use, V kappa/V lambda gene, light chain CDRL3 amino acid sequence, sorting bait used to identify the cell, antibody name, IC50 in ?g/ml in SARS-COV-2 pseudovirus neutralization assay (PV), IC80 in ?g/ml in SARS-COV-2 pseudovirus neutralization assay, IC50 in ?g/ml in SARS-COV-2 authentic virus neutralization assay (LV), IC80 in ?g/ml in SARS-COV-2 authentic virus neutralization assay for antibodies from subject BG1, BG4, BG7 and BG10 as indicated by the antibody names. (SEQ ID NOS: 1-184). B. Shown are the heavy chain sequences (HC), kappa light chain (KC) sequences and third lambda light chain (LC) sequences for the indicated antibodies tested (SEQ ID NOS: 185-368).

    TABLE-US-00002 TABLE2A CDR3 PV PV LV LV VH CDR3 LIGHT VK/VL LIGHT SORT IC50 IG80 IC50 IG80 ISOTYPE GENE HEAVYCHAIN CHAIN GENE CHAIN BAIT Name (ug/ml) (ug/ml) (ug/ml) (ug/ml) IGH IGHV6- CAKQWLANWFDPW IGK IGKV3- CQQSESSPY RBD BG1- >50 >50 M 1 20 TF 1 IGHG IGHV1- CARGRAGYYDFWSTSS IGL IGLV1- CAAWDDSL RBD BG1- >50 >50 1 8 LDNGGMDVW 47 SGVVF 3 IGH IGHV3- CVKDVPSMYYIFWSGQ IGK IGKV1- CQQYNTYS RBD BG1- >50 >50 M 23 GTYW 5 PITF 4 IGH IGHV3- CAKDLPSRYYDFWSG IGK IGKV1- CQQYNSYS RBD BG1- >50 >50 M 23 QGNYW 5 SITF 5 IGHG IGHV2- CAREMATITGLDYW IGK IGKV1- CQQSYSTP RBD BG1- 1.178 10.581 0.2037 0.3314 1 70 39; RTF 6 IGK V1D-39 IGHA IGHV2- CARVPPTDYHFDSW IGK IGKV3- CQHYGSSP 2P BG1- >45 >45 1 70 20 PLTF 7 IGH IGHV1- CARDTSGYRNPGYGM IGK IGKV3- CQQRSNWP 2P BG1- >50 >50 M 18 DVW 11 PWTF 8 IGHG IGHV5- CATGTFLAVPGFDFW IGL IGLV6-57; CQSYDSGR RBD BG1- >25 >25 1 51 IGLV6-57 QGVF 9 IGH IGHV3- CARDLQRYGSGSSLGP IGK IGKV1- CQQLDTYP RBD BG1- >50 >50 M 48 NYFDYW 9 RF 10 IGH IGHV4- CARRAQYYYDSSGYY IGK IGKV3- CQQYNSYS RBD BG1- >35 >35 M 39 DAFDIW 20 TF 11 IGHG IGHV3- CARDVFRYDSSGRPRY IGK IGKV2- CMQALQTP RBD BG1- 1.151 >50 0.2338 0.3866 1 13 AFDIW 28; LTF 12 IGKV2D- 28 IGHG IGHV4- CARETRWNWIDSW IGK IGKV4- CQQYHNTP 2P BG1- >30 >30 1 59; 1 WTF 13 IGHV4- 59 IGHG IGHV3- CARDLVDYGMDVW IGK IGKV1- CQQLNSYP RBD BG1- 0.020 0.072 0.03716 0.06751 1 53 9 PYTF 14 IGHA IGHV3- CAKDGRRDGYNHALD IGK IGKV1- CQQYSSYP RBD BG1- >50 >50 1 43D NW 5 TF 15 IGH IGHV3- CAKGRESTSIGGWFDP IGK IGKV1- CQHYNAYP 2P BG1- >37 >37 M 30; W 16 DHL 16 IGHV3- 30-5 IGH IGHV CARTIVGGTNWYFDL IGL IGLV1- CASWDDSV RBD BG1- 24.883 >50 5.174 15.25 M 2-70 W 44 NGVF 17 IGH IGHV CARRVMGSGWLDSW IGL IGLV2- CSSYTSSST 2P BG1- >50 >50 M 4-39 14 WVF 18 IGHG IGHV CAKDMGNGFYYYYGL IGK IGKV2D- CMQTIHLP RBD BG1- >30 >30 1 3-9 DVW 29 RVTF 19 IGHA IGHV3- CAKDAPDVVLVPVPY IGK IGKV3- CQHYGSSR 2P BG1- >50 >50 2 23; YHYGLEVW 20 RTF 20 IGHV3- 23D IGHA IGHV3- CARERSGSYYARVELG IGL IGLV2- CSSYTSSIT RB BG1- >25 >25 1 30 YW 14 GVF D 21 IGHG IGHV3- CASSRPPIGQLVPGLDL IGL IGLV1- CQSYDSRL RBD BG1- 0.023 0.072 0.09962 0.1181 1 66; DWFDPW 40 SGWVF 22 IGHV3- 66 IGHA IGHV CARDSYRGGGIW IGK IGKV1- CQQYDNLP RBD BG1- 0.009 0.039 0.02004 0.02348 1 3-53 33; QTF 23 IGKV1D- 33 IGHG IGHV1- CARGPYYYDSGGYYL IGK IGKV3- CQQYAGSP RBD BG1- 0.004 0.007 0.04294 0.07228 1 69; DYW 20 RTF 24 IGHV1- 69 IGHG IGHV3- CARDMGGDVFDIW IGK IGKV1- CQQLNSSPP RBD BG1- 0.091 0.59 0.1224 0.14601 1 53 9 KLTF 25 IGHA IGHV4- CAAHITVFGIITGNWFD IGL IGLV1- CQSYASSLS RBD BG1- 0.360 3.962 0.235 0.3127 1 39 PW 40 VHVVF 26 IGHA IGHV3- CARESAAAWGWLDPW IGK IGKV139; CQQSYSMP RBD BG1- >40 >40 1 53 IGKV1D- YTF 27 39 IGHG IGHV3- CAKDLGYSYGSEIFDY IGK IGKV1- CQQSYSTP RBD BG1- 10.398 39.842 12.75 17.54 1 23 W 39; VF 28 IGKV1D- 39 IGH IGHV3- CARARSGSYYSAIDYW IGK IGKV1- CQQYDYLP 2P BG4- >50 >50 M 30-3 33; LTF 1 IGKV1D- 33 IGH IGHV3- CAKEAYFTAWLHFPFD IGK IGKV3- CQQYGSSL 2P BG4- >50 >50 M 23; PW 20 TF 2 IGHV3- 23D IGHG IGHV3- CARDRDDYGDPYGMD IGL IGLV3- CYSVADNM 2P BG4- >50 >50 3 30; VW 27 GVF 3 IGHV3- 30-3 IGHG IGHV3- CTTGPTVRGVSVYW IGL IGLV7- CLLSYSGA 2P BG4- >50 >50 2 15 46 WVF 4 IGHG IGHV1- CARSVGYDAFDVW IGL IGLV1- CAAWDDSL RBD BG4- >45 >45 1 2 47 FVVF 5 IGH IGHV3- CARDLMDYDILTGYYP IGK IGKV4- CQQYFSTPP RBD BG4- >50 >50 M 21 AGYW 1 STF 6 IGH IGHV1- CARGPPPPAITMIVVTT IGK IGKV22 CMQALQTP RBD BG4- >35 >35 M 2 VWTS 28; YTF 7 IGKV2D- 28 IGHG IGHV5- CARLETTVTTDWFDP IGL IGLV2- CSSYTRGN RBD BG4- >50 >50 1 10-1 W 14 YVF 8 IGHG IGHV3- CTIGNWHGSGNNIMHD IGK IGKV4- CHQYYLVP RBD BG4- >50 >50 3 49 YW 1 FTF 9 IGHG IGHV1- CARDRWFGKLEGSFD IGL IGLV2- CCSYATGS RBD BG4- 5.53 48.924 11.48 15.58 1 2 VW 23; SVVF 10 IGLV2- 23; IGLV2- 23 IGH IGHV4- CARDTVVVVGAHAFDI IGK IGKV4- CQQYYTTP RBD BG4- 11.335 36.996 10.7 13.55 M 34 W 1 LTF 11 IGHG IGHV4- CARPQVLYYYGSGSYS IGL IGLV1- CQSYDSSLS 2P BG4- >50 >50 1 39 HWFDPW 40 AVWVF 12 IGH IGHV3- CARGSGWYVGFDYW IGL IGLV1- CAAWDDSL RBD BG4- >50 >50 M 48 47 SALVF 13 IGH IGHV1- CARVTTIPQYDYGDYY IGL IGLV2- CCSYAGSS 2P BG4- 0.878 8.971 0.2553 0.3563 M 2 YYYGMDVW 23 TLVF 14 IGHG IGHV4- CARDLGQDW IGK IGKV3- CQQYGSSP 2P BG4- >50 >50 3 59 20 WTF 15 IGH IGHV4- CARDIFGSGSPPSGVAF IGL IGLV2- CSSHTSSSS RBD BG4- 0.806 9.388 0.1342 0.1703 M 61 DYW 14 PHVVF 16 IGHG IGHV3- CARESYGMDVW IGK IGKV3- CQQYGSSP 2P BG4- 0.024 0.102 0.1276 0.2202 1 53 20 GTF 17 IGHG IGHV1- CARVKEWGSYYSDSG IGL IGLV2- CCSYAGTY 2P BG4- >50 >50 1 69; SHGKNYFDYW 11 TVIF 18 IGHV1- 69D IGH IGHV1- CARDGYSSSFIPGPRNY IGK IGKV3- CQQFNNWP RBD BG4- >50 >50 M 2 YGMDVW 15 RGTF 19 IGHG IGHV1- CARPRGRLITFGGLIVT IGK IGKV2- CMQALQTP 2P BG4- >50 >50 1 18 TLDYYYGMGVW 28; VTF 20 IGKV2D- 28 IGHG IGHV1- CATDKADTSWWEFDP IGL IGLV7- CLLSYSGV RBD BG4- >35 >35 1 2 W 46 VVF 21 IGHG IGHV3- CARFSKLYQWSFDIW IGL IGLV2- CCSYAGTY 2P BG4- >50 >50 1 53 11 TPVVF 22 IGH IGHV3- CARGTHYGSGSYYHW IGK IGKV3- CQQYNNW RBD BG4- >50 >50 M 53 15 PPGLKITF 23 IGHG IGHV3- CVRDLDYYGMDVW IGK IGKV1- CQQLNSSP RBD BG4- 0.013 0.05 0.02494 0.04633 1 53 9 GSLTF 24 IGHG IGHV3- CARDLEVVGAMDVW IGK IGKV3- CQQYGSPM 2P BG4- 0.003 0.013 0.04379 0.0706 1 53 20 YTF 25 IGHG IGHV3- CAREGPHGMDVW IGK IGKV1- CQQYDNLP RBD BG4- 0.016 0.072 0.04001 0.05179 1 53 33; PTF 26 IGK V1D-33 IGHG IGHV3- CARGPVRGVITHFDYW IGL IGLV2- CSSYTSSST 2P BG4- >50 >50 3 53 14 SSVF 27 IGHD IGHV3- CVKSSSGWYLRLGYW IGK IGKV2- CMQALQTP 2P BG7- >50 >50 30; 28; TF 1 IGHV3- IGKV2D- 30-5 28 IGH IGHV3- CAREGRRGQWSWFDP IGK IGKV3- CQQFGSSPL 2P BG7- >50 >50 M 53 W 20 YTF 2 IGH IGHV3- CAGSPVRGVITHFDYW IGL IGLV2- CSSYTSSST 2P BG7- >50 >50 M 53 14 QVF 3 IGH IGHV4- CARVDRRYCIITSCYIF IGK IGKV4- CQQYYSTPI RBD BG7- >50 >50 M 61 DYW 1 TF 4 IGH IGHV3- CARGRDGYYYGMDV IGK IGKV1- CQQLNSLF 2P BG7- >50 >50 M 30-3 W 9 TF 5 IGH IGHV1- CARAPPFSSSSIGVDYW IGK IGKV1- CQQYNSYP 2P BG7- >50 >50 M 2 16 LTF 6 IGH IGHV1- CAKDHCATTNCFEYLY IGK IGKV2- CMQSLQTR 2P BG7- >50 >50 M 2 FGMGVW 28; TF 7 IGKV2D- 28 IGH IGHV4- CARDLTYYGSNGYTN IGK IGKV1- CQQYNTYF 2P BG7- >50 >50 M 4 W 5 WTF 9 IGH IGHV3- CASSPVRGVITQFDYW IGL IGLV2- CSSYTSRSP 2P BG7- >50 >50 M 53 14 WVF 10 IGHG IGHV5- CARHDGSKVTTNDYW IGK IGKV3- CQQRRDWP 2P BG7- >50 >50 1 51 11 GTF 11 IGHA IGHV3- CARDRSGSYYRPGYW IGK IGKV1-33; CQQYGNLP 2P BG7- >50 >50 1 30-3 IGKV1D- PLTF 12 33 IGH IGHV3- CAQTGGSYFGPFDYW IGL IGLV2- CYSYTTSST 2P BG7- >50 >50 M 30; 14 PYVF 13 IGHV3- 30; IGHV3- 30-5 IGHG IGHV3- CAKDILYGDYVGGFAY IGL IGLV2- CSSYTTSST RBD BG7- 0.385 19.178 0.2084 0.2981 1 9 W 14 LVF 14 IGHG IGHV1- CAIPYSSVTFDCW IGK IGKV3- CQQYGSSR RBD BG7- 0.016 0.092 0.1139 0.1345 1 18 20 PTF 15 IGHG IGHV3- CARDSQPHYYYGVDV IGL IGLV2- CSSYTKTRT RBD BG7- 3.5992 21.792 3.172 4.817 1 53 W 14 LYVF 16 IGHG IGHV5- CAKKKDDRAEAVFDY IGL IGLV1- CATWDDSL RBD BG7- >50 >50 1 51 W 44 NTYVF 17 IGHG IGHV3- CARGAAMVKELFDYW IGK IGKV4- CQQYYSTP RBD BG7- 0.083 0.244 0.1152 0.1601 1 53 1 LTF 18 IGHG IGHV3- CARVRWLQGGIDYW IGL IGLV6- CQSYDSGS RBD BG7- 2.735 13.72 1.854 3.653 1 7 57 WVF 19 IGHG IGHV1- CARGGRYCSSTTCYSG IGL IGLV1- CQSYDSSLS RBD BG7- 0.007 0.023 0.05679 0.0942 1 8 VGMDVW 40 GWVF 20 IGH IGHV3- CAKSNSSGLTPFDHW IGK IGKV1- CQQSYSNP RBD BG10- >50 >50 M 9 39; FTF 1 IGKV1D- 39 IGH IGHV4- CARRDGSYFDYW IGL IGLV3- CQAGDSDT RBD BG10- >50 >50 M 39 1 VLF 2 IGHG IGHV4- CARHVSDGQSIGWLYY IGL IGLV3- CQVWDRSS RBD BG10- >50 >50 1 39 FDCW 21 VF 3 IGHA IGHV4- CARLAPFGERRVDQYY IGK IGKV2D- CMQSTQLP RBD BG10- >50 >50 1 31 LMDVW 29 WTF 4 IGHA IGHV4- CARAYYYYYMDVW IGL IGLV1- CSAWDDSL RBD BG10- >50 >50 1 4 47 RGPVF 5 IGH IGHV4- CARADRGYCTITDCFIF IGK IGKV4- CQQYYSTP RBD BG10- >50 >50 M 61 NYW 1 LTF 6 IGHG IGHV3- CTRGAHYDFWRGYYT IGL IGLV1- CQSYDSRL RBD BG10- >50 >50 1 13 DDHHYMDVW 40 SAWVF 7 IGHA IGHV3- CVRGEGGPHDAFDIW IGL IGLV3- CQVWDSSR RBD BG10- >50 >50 1 11 21 DLRVF 8 IGH IGHV3- CVRCGYDDWYFDVW IGL IGLV3- CQAWDSST 2P BG10- >50 >50 M 7 1 GVF 9 IGHG IGHV1- CGRGPTTAKSGVEWFD IGL IGLV1- CQSFDSSLS RBD BG10- 0.099 0.359 0.03891 0.05747 1 8 PW 40 GFYVF 10 IGHA IGHV3- CAKDMGWNVFQGLD IGL IGLV2- CTSYRSSSL RBD BG10- >50 >50 1 9 VW 14 QGVF 11 IGHA IGHV1- CARSWSAYYNWFDPW IGK IGKV3- CQHYGSSP 2P BG10- >50 >50 1 18 20 PVTF 12 IGH IGHV3- CTTDRHVRGTYWGAY IGL IGLV1- CAAWDDSL RBD BG10- >50 >50 M 15; YYYGMDVW 44 NGLYVF 13 IGHV3- 15 IGHG IGHV3- CARAVRISSGYGLYGD IGL IGLV3- CQVWDSSS 2P BG10- 12.318 >50 8.683 9.542 1 74 SDYFDYW 21 DPWVF 14 IGH IGHV3- CARARGDAFDIW IGL IGLV1- CGTWDNSL RBD BG10- >50 >50 M 48 51 SVGVF 15 IGHG IGHV5- CARPLFYCSGGSCLTG IGL IGLV2- CSSYAGSD 2P BG10- >50 >50 1 51 YW 8 NWVF 16 IGHA IGHV3- CARGRRDGNDLAPDY IGL IGLV3- CYSTDSSD 2P BG10- >50 >50 1 74; W 10 NHRVF 17 IGHV3- 74 IGHA IGHV3- CVKDLGAYASGRLAD IGK IGKV1- CQQSYTTP RBD BG10- >50 >50 1 30; W 39; YTF 18 IGHV3- IGK39 30-5 IGHG IGHV5- CARTQWGYNYGSHFF IGL IGLV1- CAAWDASL RBD BG10- 0.009 0.026 0.03334 0.03846 1 51 YMDVW 47 SGYVF 19

    TABLE-US-00003 TABLE2B Aminoacidsequencesofthevariableregionsoftheantibodiesproducedandtested (heavychainsequences(HC),kappalightchain(KC)sequencesandlambdalightchain(LC) sequences).(SEQIDNOS:185-368). HCBG1-1 TGVHSQVQLQQSGPGLVKPSQTLSLTCAISGDSVSSKNAAWNWIRQSPSRGLEWLGTTYYRSKWYN DYAVSVKGRIAINPDTSKNQFSLQLHSVTPEDTAVYYCAKQWLANWFDPWGQGTQVTVSSAST HCBG1-3 TGVHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYDINWVRQATGQGLEWMGWMNPNSGNTG YAQKFQGRVTMTRNTSISTAYMELSSLTSEDTAVYYCARGRAGYYDFWSTSSLDNGGMDVWGQGT TVTVSSAST HCBG1-4 TGVHSEVHLVESGGDLVHPGGSLRLSCVASGFTFTDYAMTWVRQAPGKGLEWVSTISGNGGTTNTA DSVKGRFTISRDNSKNTLYLEMSSLSDEDTAIYYCVKDVPSMYYIFWSGQGTYWGQGTLVTVSSAST HCBG1-5 TGVHSEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSTISNSGGTTNYA DSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCAKDLPSRYYDFWSGQGNYWGQGTLVTVSSAS T HCBG1-6 TGVHSQVTLRESGPALVKPTQTLTLTCTFSGFSLSTSGMCVSWIRQPPGKALEWLARIDWDDDKYYS TSLRTRLTISKDTSKNQVVLTMTNMDPVDTATYYCAREMATITGLDYWGQGTLVTVSSAST HCBG1-7 TGVHSQVTLRESGPALVKPTQTLTLTCTFSGFSLSTSGMCVSWIRQPPGKALEWLALIDWTDDKYYS TSLKTRLTISKDSSKNEVVLTMTNMDPVDTATYYCARVPPTDYHFDSWGQGTLVTVSSAST HCBG1-8 TGVHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNY AQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDTSGYRNPGYGMDVWGQGTTVTVSSAS T HCBG1-9 TGVHSEVQLVQSGAEVKKPGESLKISCKTSGYSFASYWIGWVRQMPGKGLEWMGIIYPGDSDTIYTP PFQGQVTISADTSTRTASLEWRSLRASDSAIYYCATGTFLAVPGFDFWGQGTLVSVSSAST HCBG1-10 TGVHSEVQLVESGGGLAQPGGSLRLSCAASGFTFSTYSMNWVRQAPGKGLEWVSFISRSSNTIYYAD SVKGRFTISRDNAKNSLYLQMNSLRDEDTAVYYCARDLQRYGSGSSLGPNYFDYWGQGTVVTVSSA ST HCBG1-11 TGVHSQLHLQESGPGLVKPSETLSLTCTASGGSISSSSYYWGWIRQPPGKGLEWIGSVYYSGRTYYNP SLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARRAQYYYDSSGYYDAFDIWGQGTTVTVSSAST HCBG1-12 TGVHSEVQLVESGGGLVQPGGSLRLSCAASGFTFSTYDMHWVRQATGKGLEWVSAIGTAGDTYYP GSVQGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARDVFRYDSSGRPRYAFDIWGQGTMVTVSSA ST HCBG1-13 TGVHSQVQLQESGPGLVKPSETLSLTCTVSGGSMSSDYWSWIRQPPGKGLEWIGYIYYRGSTNLNPS LQSRLTMSVDTSKNQFSLKLSSVTAADTAVYYCARETRWNWIDSWGQGTPVTVSSAST HCBG1-14 TGVHSEVQLVESGGGLIQPGGSLRLSCAASGLTVNSNYMTWVRQAPGKGLEWVSVIYSGGSTFYAD SVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDLVDYGMDVWGQGTTVTVSSAST HCBG1-15 TGVHSDVQLVESGGVVVQPGGSLRLACAASGFTFDDYAMHWVRQAPGKGLEWVSLITRDGGSTHY ADSVKGRFTISRDNSKNSLYLQMNSLRLEDTAFYYCAKDGRRDGYNHALDNWGQGTLVTVSSAST HCBG1-16 TGVHSQVQLVESGGGVVQPGRSLRLSCAASGFSFSSHVMHWVRQAPGKGLEWVAVISYDGSNKFY ADSVKGRFTISRDSSKNTVFLQMNSLRDEDTAMYYCAKGRESTSIGGWFDPWGQGTLVTVSSAST HCBG1-17 TGVHSQVTLRESGPSLVKPTQTLTLTCTFSGFSLSTSGMCVSWIRQPPGKALEWLARIDWDDDKFYST SLKTRLTISKGTSRNQVVLTMTNMGPVDTATYYCARTIVGGTNWYFDLWGRGTLVTVSSAST HCBG1-18 TGVHSQLQLQESGPGLVKPSETLSLTCTVSGGSISSSSYYWGWIRQPPGKGLEWIGNFYYIGSTNYNP SLKSRVTISVDTSRNQFSLKLTSVTAADTAVYYCARRVMGSGWLDSWGQGTLVTVSSAST HCBG1-19 TGVHSEVQLVESGGGLVQPGGSLRLACAVSGLILDDYALHWVRLAPGKGLEWVSGINWNSGTIHYA DSVRGRFTTSRDNAKRSLYLQMNSLRPEDTALYYCAKDMGNGFYYYYGLDVWGQGTSVTVSSAST HCBG1-20 TGVHSEVLLLESGGGLVQPGGSLRLSCAASGFPFGSYAMSWVRQAPGKGLEWVSVISGSADTTYYA DSVKGRFTISRDNSKNTLYLQMNSLGAEDTAVYYCAKDAPDVVLVPVPYYHYGLEVWGQGTTVTV SSAST HCBG1-21 TGVHSQVQLVESGGGVVQPGRSLRLSCAASGFTFRTYDMHWVRQAPGKGLEWVAVISYDGSIKYFA DSVKDRFTISRDNSQSTLYLQMNSLRAEDTAVYYCARERSGSYYARVELGYWGQGTLVTVSSAST HCBG1-22 TGVHSEVQLVESGGGLVQPGGSLRLSCSVSGFTVSSNYMNWVRQAPGKGLEWVSVIYPGGSTFYPD SVKGRFTISRDDSKNTLYLQMNSLRPEDTAAYYCASSRPPIGQLVPGLDLDWFDPWGQGTLVIVSSA ST HCBG1-23 TGVHSEVQLVESGGGLIQPGGSLRLSCAASGLTVSSNYMSWVRQAPGKGLEWVSVMYPGGSTYYA DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDSYRGGGIWGQGTMVTVSSAST HCBG1-24 TGVHSQVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGRIISMFGIANNA QKFQGRLTITADTSTSTAYMELSSLRSEDTAVYYCARGPYYYDSGGYYLDYWGQGTLVTVSSAST HCBG1-25 TGVHSEVQLVESGGGLIQPGGSLRLSCAASGFIVSRNYMSWVRQAPGKGLEWVSVIYSGGSTFYADA VKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDMGGDVFDIWGQGTMVTVSSAST HCBG1-26 TGVHSQLQLQESGPGLVKPSETLSLTCTVSGGSIYSSDYYWGWIRQPPGKGLEWIGSMHYSGSTYHS PSLNSRVTISVDPSTNQLSLRLSSATAADTAVYYCAAHITVFGIITGNWFDPWGQGTLVTVSSAST HCBG1-27 TGVHSEVQLVESGGGLIQPGGSLRLSCAASGFNLSGNYMSWVRQAPGQGLEWVSLIYAGGYAYYA DSVKGRFTISRDNSKNMFYLQMNSLRAEDTAIYYCARESAAAWGWLDPWGQGTLVTVSSAST HCBG1-28 TGVHSEVQLVESGGGLVQPGGSQRLSCAASGFTFSSYVINWVRQAPGKGLEWVSAISGSGDITYYAD SVKGRFTMSRDNSKKTLYLQMNSLRAEDTAVYYCAKDLGYSYGSEIFDYWGQGTLVTVSSAST HCBG4-1 ATGVHSQVRLVESGGGVVQPGRSLRLSCAVSGFTFSSYAMNWVRQAPGKGLEWVTVISYDGSNKY YADSVKGRFTISRDNSKNTLYLQMNSLRPDDTAVYYCARARSGSYYSAIDYWGQGTLVTVSSAST HCBG4-2 ATGVHSEVQLLESGGSLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKEAYFTAWLHFPFDPWGQGTLVTVSSAST HCBG4-3 ATGVHSHVQLVESGGGVVQPGRSLRISCAASGFTFSSYTMHWVRQAPGKGLEWVAVISKEADISYD GNNKYYADSVKGRFTISRDNSKNTLYLQLNSLRTEDTAVYYCARDRDDYGDPYGMDVWGQGTTV TVSSAST HCBG4-4 ATGVHSEVQLVESGGGLVKPGGSLRLSCAASEFTFSNVWMSWVRQAPGKGLEWVGRIKSKTDGGT TDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTGVYYCTTGPTVRGVSVYWGQGTLVTVSSAST HCBG4-5 ATGVHSQVQLMQSGAEVKKPGASVKVSCKASGDSFTDYYVHWVRQAPGQGLEWMGWISPYSGGT NYAPKFRGRVTMTRDTSITTAHMELGRLRSDDTAVYFCARSVGYDAFDVWGPGTMVTVSSAST HCBG4-6 ATGVHSEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYTMNWVRQAPGKGLEWVSSISGAPNYIYY ADSVKGRFTISRDNAKNSLSLQMNSLRAEDTAVYYCARDLMDYDILTGYYPAGYWGQGTLVTVSS AST HCBG4-7 ATGVHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINLNSGGT NYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGPPPPAITMIVVTTVWTSWGQGTTVT VSSAST HCBG4-8 ATGVHSEVQLVQSGAEVKKPGESLRISCKGSGYSFTSYWISWVRQMPGKGLEWMGRIDPSDSYTNY SPSFQGHVTISADKSISTAYLQWSSLKASDTAMYYCARLETTVTTDWFDPWGQGTLVTVSSAST HCBG4-9 ATGVHSEVQLVESGGGLAQPGRSLRLSCRCSGFRFGDYAVNWVRQFPGKGPEWIGFIRTKTFGAATQ YAASVKGRFTISRDDSQSVAYLQMNRLITDDTAVYYCTIGNWHGSGNNIMHDYWGQGTLVSVSSAS T HCBG4-10 ATGVHSQVQLVQSGAEVKKPGASVKVSCKASGYIFTGYYIHWVRQAPGQGLEWMGWINPISGGTN YAQKFQGRVTATRDTSITTAYMELTSLTSDDTAVFYCARDRWFGKLEGSFDVWGQGTMVTVSSAST HCBG4-11 ATGVHSQVQLQQWGAGLLKPSETLSLTCAVYDESFSDYYWTWIRQPPGKGLEWIGEINHSGSTNYN PSLKSRVTISVDTSKNQFSLRLSSVTAADTAVYYCARDTVVVVGAHAFDIWGQGTMVTVSSAST HCBG4-12 ATGVHSQLQLQESGPGLVKPSETLSLTCIVSGGSISSSSYYWGWIRQPPGKGLEWIGTIYNSGSTHYNP SLRSRVTISVDTSKSHFSLKLSSVTAADTAVYYCARPQVLYYYGSGSYSHWFDPWGQGTLVTVSSAS T HCBG4-13 ATGVHSEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYEMNWVRQAPGKGLEWVSYISSSGSTIYYA DSVKGRFTISRDNAKNSLYLQVNSLRAEDTAVYYCARGSGWYVGFDYWGQGTLVTVSSAST HCBG4-14 ATGVHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYIHWVRQAPGQGLEWMGWINPNSGGT NYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYFCARVTTIPQYDYGDYYYYYGMDVWGQGT TVTVSSAST HCBG4-15 ATGVHSQVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLDWIGYIYYSGSTNYNPS LKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDLGQDWGQGTLVTVSSAST HCBG4-16 ATGVHSQVQLQESGPGLVKPSQTLSLTCTVSGGSISSGSSYWSWIRQPAGKGLEWIGRIYTSGSTNYN PSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDIFGSGSPPSGVAFDYWGQGTLVTVSSAST HCBG4-17 ATGVHSEVQLVESGGGLIQPGGFLRLSCAASGLTVSSNYMNWVRQAPGKGLEWVSVIYSGGSTYYA DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARESYGMDVWGQGTTVTVSSAST HCBG4-18 ATGVHSQVQLVQSGAEVKKPGSSVKVSCKASGGTFSNYAVSWVRQAPGQGLEWMGGIISIFATANY AQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARVKEWGSYYSDSGSHGKNYFDYWGQGTL VTVSSAST HCBG4-19 ATGVHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTGYSMHWVRQAPGQGLEWMGWINPNSGGT NYAQKFQGRVTMTRDTSISTTYMELSRLRSDDTAVYYCARDGYSSSFIPGPRNYYGMDVWGQGTTV TVSSAST HCBG4-20 ATGVHSQVHLVQSGAEVKKPGASVKVSCKASGYTFTSYGINWVRQAPGQGLEWMGWISAYNGNT NYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARPRGRLITFGGLIVTTLDYYYGMGVW GQGTTVTVSSAST HCBG4-21 ATGVHSQVQLVQSGPEVKKPGASVRVSCKTSGHTFTDYWIQWVRQAPGQGLEWMGWIELSTGGTN YAPKFQGRVAMSSDTSIRTAYMDLWSLTSDDTALYYCATDKADTSWWEFDPWGQGTLVTVSSAST HCBG4-22 ATGVHSEVQLVESGGGLVQPGASLRLSCAASGFTVSNNYMSWVRQAPGKGLEWVSVIYSGGSTYY ADSVKGRFTISRHNSENTLYLQMNSLRAEDTAVYYCARFSKLYQWSFDIWGQGTMVTVSSAST HCBG4-23 ATGVHSEVQLVESGGGLVQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSGGSTYYA DSVKGRFTISRHNSKNTLYLQMNSLRAEDTAVYYCARGTHYGSGSYYHWGQGTLVTVSSAST HCBG4-24 ATGVHSEVQLVESGGGLIQPGGSLRLSCAASGLTVSSNYMNWVRQAPGKGLEWVSVIYSGGSTFYA DSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCVRDLDYYGMDVWGQGTTVTVSSAST HCBG4-25 ATGVHSEVQLVESGGGLIQPGGSLRLSCAASGITVVRNYMTWVRQAPGKGLEWVSVIYSGGTTYYA DSVKGRFTISRDNSKNTMYLQMNSLRAEDTAIYYCARDLEVVGAMDVWGQGTTVTVSSAST HCBG4-26 ATGVHSEVQLVESGGGLIQPGGSLRLSCAASGVIVSSNYMSWVRQAPGKGLEWVSVIYSGGSTYYA DSVKGRFTISRDKSKNTLYLQMNSLRAEDTAVYYCAREGPHGMDVWGQGTTVTVSSAST HCBG4-27 ATGVHSEVQLVESGGGLVQPGGSLRLSCAASGFTILSNYMSWVRQAPGKGLEWVSVIYSGGSTYYA DSVKGRFTISRHNSKNTLFLQMNSLRVEDTAVYYCARGPVRGVITHFDYWGQGTLVTVSSAST HCBG7-1 ATGVHSQVQLVESGGGVVRPGRSLRLSCAASGFTFSTYGMHWVRQAPGKGLEWVAIISYDGNNKY YTDSVKGRFTISRDNSKNMVYLQMNSLRAEDTAVYYCVKSSSGWYLRLGYWGRGTLVTVSSAST HCBG7-2 ATGVHSEVQLVESGGGLIQAGGSLRLSCTASGFSVSGNYMNWVRQAPGQGLEWVSVIYTDDTTYYP DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREGRRGQWSWFDPWGQGTLVTVSSAST HCBG7-3 ATGVHSEVQLVESGGGLIQPGGSLRLSCTASTFTVSSNYMSWVRQAPGKGLEWVSVIYTGGSTYYA DSVKGRFTISRDNSKNTLYLQVNSLRAEDTAVYYCAGSPVRGVITHFDYWGQGTLVTVSSAST HCBG7-4 ATGVHSQVQLQESGPGLVKPSETLSLTCIVSGGSVSSSSYYWSWIRQPPGKGLEWIGYVDYSGSTNY NPSLKSRVTMSVDTSKNQFSLRLSSVTAADTAMYYCARVDRRYCIITSCYIFDYWGQGTLVTVSSAS T HCBG7-5 ATGVHSQVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVAVISYDGGNKY YADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGRDGYYYGMDVWGQGTTVTVSSAST HCBG7-6 ATGVHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTGYSIHWVRQAPGQGLEWMGWINPYTGDTS YVQKFQGCVTMTRDTSISTAYMELSRLTSDDTAVYYCARAPPFSSSSIGVDYWGQGTLVTVSSAST HCBG7-7 ATGVHSQVQLVQSGAEVKKPGASVKVSCKASGYSFSDYYLQWVRQAPGQGLEWMGWINPKSGGT HYAQKFQGRVTVTRDTSISTTYMELSSLRSDDTAVYYCAKDHCATTNCFEYLYFGMGVWGQGTTV TVSSAST HCBG7-9 ATGVHSQVQLQESGPKQVKPSETLSLTCTVSGASMSSYYWFWLRQPAGKGLEWIGRIYSGGSTNYN PSFKSRVTMSVDTSKNQFFLELSSVTAADTAVYYCARDLTYYGSNGYTNWGQGTLVTVSSAST HCBG7-10 ATGVHSEVQLVESGGGLIHPGGSLRLSCAASGFTVTSNYMSWVRQAPGKGLEWVSVIYSGGSTYYA DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASSPVRGVITQFDYWGQGTLVTVSSAST HCBG7-11 ATGVHSEVQLVQSGAEVKKPGESLKISCKGSGYTFTNYWIAWVRQMPGKGLEWMGAIYPGDSDTR YSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYFCARHDGSKVTTNDYWGQGTLVTVSSAST HCBG7-12 ATGVHSQVQLVESGGGVVQPGRSLRLSCAASGFTFSIYAMHWVRQAPGKGLEWVAVISYDGSNKY YADSVKGRFTISRDNSKNTLYLQMNSLRVEDTAVYYCARDRSGSYYRPGYWGQGTLVTVSSAST HCBG7-13 ATGVHSQVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGNNKY YADSVKGRFTISRDNSKNTLYLQMNSLRPEDTAVYYCAQTGGSYFGPFDYWGQGTLVTVSSAST HCBG7-14 ATGVHSEVQLVESGGGLVQPGRSLRLSCAASGFTFEDYAMHWVRQTPGKGLEWVSGISWNGGIIGY ADSVKGRFTISRDNAKNSLYLQMIRLRAEDTALYYCAKDILYGDYVGGFAYWGQGTLVTVSSAST HCBG7-15 ATGVHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYAISWVRQAPGQGLEWMGWVSAYNGNT NYAQKLQGRVTMTTDTSTNTAYMELRSLRSDDTAIYYCAIPYSSVTFDCWGQGTLVTVSSAST HCBG7-16 ATGVHSEVQLVESGGGLVQPGGSLRLSCVASGFTVTNNFMNWIRQAPGMGLEWVAVVYPGGGSDY SDSVKGRFIISRDNSKNTVYLQMNSLRSEDTAIYYCARDSQPHYYYGVDVWGQGATVTVSSAST HCBG7-17 ATGVHSEVQLVQSGAEVKKPGESLKISCKVSGYRFTSYWIGWVRQMPGKGLEWMGMIYLSDSDSR VGPSFRGQVTISADKSISTAYLQWSSLKTSDSAVYYCAKKKDDRAEAVFDYWGQGTLVTVSSAST HCBG7-18 ATGVHSEVQLMESGGGLIQPGGSLRLSCAASGFIVSSNYMSWVRQAPGKGLEWVSVIYSGGGTDYA DSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCARGAAMVKELFDYWGQGTQVTVSSAST HCBG7-19 ATGVHSEVQLVESGGGLVQPGGGSLRLSCAASGFTFSTYWMSWVRQAPGKGLEWVANIKEDGSEK YYVDSVKGRVTISRDNAKNSLYLQMNSLRVEDTAVYYCARVRWLQGGIDYWGQGTLVTVSSAST HCBG7-20 ATGVHSQVQLVQSGAEVKKAGASVKVSCKASGYTFTSYDINWVRQASGQGLEWMGWMNPISGNT GYAQKFQGRVTMTRNTSITTAYMELSSLRSEDTAVYFCARGGRYCSSTTCYSGVGMDVWGQGTTV TVPSAST HCBG10-1 ATGVHSEVQLVESGGGLVQPGRSLRLSCAASGFTFDEYAMHWVRQAPGKGLEWVSGISWSSVSIAY ADSVKGRFTISRDKAKNSLYLQMNSLRAEDTALYYCAKSNSSGLTPFDHWGQGLLVTVSSAST HCBG10-2 ATGVHSQLQLQESGPGLVKPSETLSLTCTVSGGSISGSSYQWGWVRQPPGKGLAWIAGIHYSGSTYY NPSLKSRVTISVETSKNQFSLRLYSVTATDTSLYYCARRDGSYFDYWGQGALVTVSSAST HCBG10-3 ATGVHSQLQLQESGPGLVKPSETLSLTCTVSGDSMSSRSYYWGWIRQPPGKGLEWIGSIYYSGDTYY DPSLKSRVTISVDTSKIQFTLNLSSVTAADTAVYYCARHVSDGQSIGWLYYFDCWGQGTLVTVSSAS T HCBG10-4 ATGVHSQVQLQESGPGFVKPSQTLSLTCTVSGGSLSSGGYYWTWIRQHPGKGLEWIGYISSSGSTFYN PSLKSRITISIDTSENQFSLKVSSVTAADTAVYYCARLAPFGERRVDQYYLMDVWGQGTTVTVSSAST HCBG10-5 ATGVHSQVQLQESGPGLVRPSGTLSLTCGVSGGSISSNNWWSWVRQPPGKGLEWIGEIHYSGGTNY NPSLKSRVTISLDRSTNQFSLRLTSVTAADTAVYYCARAYYYYYMDVWAEGTTVTVASAST HCBG10-6 ATGVHSQVQLQESGPGLVKPSETLSLTCTVSGGSISSTSYYWSWVRQPPGKGLEWIGYIYYSGNTNY NPSLKSRVTMSVDTSKNQFSLKLSSVTAADTAVYYCARADRGYCTITDCFIFNYWGQGTLVTVSSAS T HCBG10-7 ATGVHSEVQLVESGGGLVQPGESLRLSCTASAFSVNTYDMYWVRQPTGKGLEWVSTIRVTGDTYYP DSVKGRFTISRESATNSLYLQMNSLRAGDTAIYYCTRGAHYDFWRGYYTDDHHYMDVWGKGTTVT VSSAST HCBG10-8 ATGVHSQMELVESGGGLVKPGGSLRLSCASSGFSLGDYYMTWIRQAPGKGLEWVSYISRSDGKTFY ADSVKGRFTLSTDDGKKSLYLQMNSLRAEDTAVYYCVRGEGGPHDAFDIWGQGTMVTVSSAST HCBG10-9 ATGVHSEVQLVESGGGLVQPGGSLRLSCAASGFTFRNYWMSWVRQAPGKGLEWVANIKQDGSEKY YVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCVRCGYDDWYFDVWGRGTLVTVSSAST HCBG10-10 ATGVHSQVQLVQSGAEVKKPGASVKVSCKASGYIFTNYDINWVRQATGQGLEWMGWMNPNSGNA GYAQKFQGRVTMTRNTSITTAYMELSSLRSEDTAVYYCGRGPTTAKSGVEWFDPWGQGTLVTVSSA ST HCBG10-11 ATGVHSEVQLEESGGGLVQPGRSLRLSCVASGFSFDDYAVHWVRQAPGKGLEWVSGINWNSDSTD YADSVEGRFTISRDNAKKSVYLQMRSLRAEDSALYYCAKDMGWNVFQGLDVWGQGTTVTVSSAST HCBG10-12 ATGVHSQVQLVQSGAEVKKPGASVKVSCMASGFSFTSFVISWVRQAPGQGLEWMGWISAYNGNTD YAQKFQGRVTMTTDTSTSTAYMELRSLRSDDTAIYYCARSWSAYYNWFDPWGQGTLVTVSSAST HCBG10-13 ATGVHSEVQLVESGGDLVKPGGSLRLSCTVSRFTFKNAWMSWVRQAPGKGLEWVGRIKSKADGGT TDYAAPVRTRFTISRDDSKNTLYLQMNSLTSEDTAVYYCTTDRHVRGTYWGAYYYYGMDVWGQG TTVTVSSAST HCBG10-14 ATGVHSEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLVWVSRINNDGSSTS YADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCARAVRISSGYGLYGDSDYFDYWGQGTLV TVSSAST HCBG10-15 ATGVHSEVQLVESGGGSVQPGGSLRLSCAASGFTFSPYSMTWVRQAPGKGLEWVSYISSSSSTIHYA ESVKGRFTISRDNARDSLYLQMNSLKDEDTAVYYCARARGDAFDIWGQGTMVTVSSAST HCBG10-16 ATGVHSEVQLVQSGAEVKKPGESLRISCKGFGYYFPSYWIAWVRQMPGKGLEWMGIIYPGDSGTRY SPSFRGQVTISADRSISTAYLQWSSLKASDTAIYYCARPLFYCSGGSCLTGYWGQGTLVTVSSAST HCBG10-17 ATGVHSEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYCMHWVRQAPGKGLVWVSRIKSDGSGTTY ADSVQGRFTISRDNAKNALFLQMNSLRAEDTAVYYCARGRRDGNDLAPDYWGQGTLVTVSSAST HCBG10-18 ATGVHSQVQLVESGGGVVQPGRSLRLSCAASGFPFIISGMHWVRQAPGKGLEWVAVLSFDGSNEYY ADSVKGRFTISRDNSKNTLYLQIDSLGPEDTAVYYCVKDLGAYASGRLADWGQGTLVTVSSAST HCBG10-19 ATGVHSEVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGVIYPGDSDTRY SPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARTQWGYNYGSHFFYMDVWGKGTTVTVSS AST KCBG1-1 TGVHSEIVLTQSPGTLSLSPGEGTTLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASGRATGIPDRFS GSGSGTDFTLTISRLEPEDFAVYYCQQSESSPYTFGQGTKLEIKRT KCBG1-4 TGVHSDIQMTQSPSTMSASVGDRVTITCRASQSISNWLAWYQQKPGKAPNLLIYKASSLESGVPSRFS GSGSGTEFTLTISSLQPDDFATYYCQQYNTYSPITFGQGTRLEIKRT KCBG1-5 TGVHSDIQMTQSPSTLSASVGDRVTITCRASQNINSRLAWYQQKSGKAPKPLIYKASSLESGVPSRFS GGGSGTEFTLTISSLQPDDFATYYCQQYNSYSSITFGQGTRLEIKRT KCBG1-6 TGVHSDIQMTQSPSSLSASVGDRVTITCRASQNIRRYLNWYQQKPGNAPKLLIYAASSLQSGVPSRFS GSGSGTDFTLTISSLQPDDFATYSCQQSYSTPRTFGQGTKVEIKRT KCBG1-7 TGVHSEIVLTQSPGTLSLSPGERAALSCRASLPISARYLAWYQQKPGQTPRLLIYGASSRATGIPDRFS GSGSGTDFTLTISRLDPEDFAVYYCQHYGSSPPLTFGGGTKVEIKRT KCBG1-8 TGVHSEIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSG SGSGTDFTLTISSLEPEDFAVYYCQQRSNWPPWTFGQGTKVEIKRT KCBG1-10 TGVHSDIQLTQSPSFLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSG SGSGTEFTLTISSLQPEDFATYYCQQLDTYPRFGGGTKVDIQRT KCBG1-11 TGVHSEIVLTQSPGTLSLSPGERATLSCRASQSVNSRFLAWYQQKPGQAPRLLIYAASSRATGIPDRFS GSGSGTDFTLTISSLQPDDFATYYCQQYNSYSTFGQGTKVEIKRT KCBG1-12 TGVHGDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRASGV PDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTPLTFGPGTKVDIKRT KCBG1-13 TGVHSDIVMTQSPDSLAVSLGERATISCKSSQSVSYTSNNKSYLAWYQQKAGQPPKLLIYWASTRES GVPDRFSGSGSGTDFSLTISSLQAEDVAVYYCQQYHNTPWTFGQGTKVEIKRT KCBG1-14 TGVHSDIQLTQSPSFLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSG SGSGTEFTLTIRSLQPEDFATYYCQQLNSYPPYTFGQGTKLEIKRT KCBG1-15 TGVHSDIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLINRASSLESGVPSRFSG SGSGTEFTLTISSLQPDDFATYYCQQYSSYPTFGQGTKVEIKRT KCBG1-16 TGVHSDIQMTQSPSSLSASVGDRVTITCRASQGIGNYLAWFQQKPGKAPKSLIYVASSLQSGVPSKFS GSGSGTDFILSISSLQPEDFATYYCQHYNAYPITFGQGTRLEIKRTV KCBG1-19 TGVHGDVVLTQTPLSLSVTPGQPASISCKSNQSLLHSDGKTYLYWYFQRPGQPPQLLIYEVSNPFSGV PYRFSGSGSGTDFTLKISRVEAEDVGVYYCMQTIHLPRVTFGQGTRLDIKRT KCBG1-20 TGVHSEIVLTQSPGTLSLSPGERATLSCRASQSVTGNFLSWYQQKPGQAPRLLIYGASSRATGIPDRFS GSGSGTDFTLTISRLEPEDFAVYYCQHYGSSRRTFGQGTKVEIKRT KCBG1-23 TGVHSDIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLQIGVPSRFS GSGSGTDFTFTISSLQPEDIATYYCQQYDNLPQTFGGGTKVEIKRT KCBG1-24 TGVHSEIVLTQSPGTLSLSPGERATLSCRASQSVGSGYLAWYQQRPGQAPRLLIYGASSRATGIPDRFS GSGSGTDFTLTISRLEPEDFAVYYCQQYAGSPRTFGQGTRLEIKRT KCBG1-25 TGVHSDIQLTQSPSFLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSG SGSGTEFTLTISSLQPEDFATYYCQQLNSSPPKLTFGGGTKVEIKRT KCBG1-27 TGVHSDIQMTQSPSSLSASVGDRVTITCRASQSMSTYLNWYQQKAEKAPKLLIYAASSLQSGVPSRFS GSGSGTDFTLTISSLQPEDFATYYCQQSYSMPYTFGQGTKLEVKRT KCBG1-28 TGVHSDIQMTQSPSSLSASVGDRVTITCRASQSISGYLNWYQHKAGKAPKLLIYAASSLQSGVPSRFS GSGSGTDFTLTISSLQPEDFATYYCQQSYSTPVFGQGTKLEIKRT KCBG4-1 TGVHSDIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPSRFS GSGSGTDFTFTISSLQPEDIATYYCQQYDYLPLTFGGGTKVEIKRT KCBG4-2 TGVHSEIVLTQSPGTLSLSPGERATLSCRASQSVSSSYFAWYQQRPGQAPRLLIYGASSRATGIPDRFS GSGSGTDFTLTISRLEPEDFAVYYCQQYGSSLTFGGGTKVEIKRT KCBG4-6 TGVHSDIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQKPGQPPKLLIYWASTRES GVPDRFSGSGSGTDFTLTISRLQAEDVAVYYCQQYFSTPPSTFGGGTKVEIKRT KCBG4-7 TGVHGDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRASGV PDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTPYTFGQGTKLEIKRT KCBG4-9 TGVHSDIVLTQSPDSLGVSLGERATINCRATETVLYSPHNRNYLAWYQQKAGQPPKLLFYWATTREN GVPDRFSATGSATDFTLTVNSLQAEDVAVYYCHQYYLVPFTFGPGTRVDIKRT KCBG4-11 TGVHSDIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLGWYQQKPGQPPKLLIYWASTRES GVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYTTPLTFGGGTKVEIKRT KCBG4-15 TGVHSEIVLTQSPGTLSLSPGERATLSCRASQSVSTIYLAWYQQKPGQAPRLLIYAASSRATGIPDRFS GSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRT KCBG4-17 TGVHSEIVLTQSPGTLSLSPGERATLSCRASQSISSTYLAWYQQKLGQAPRLLMYGASSRATGIPDRFS GSGSGSDFTLTISRLEPEDFAVYFCQQYGSSPGTFGQGTKLEIKRT KCBG4-19 TGVHSEIVMTQSPAALSVSPGERATLSCRASQSVTSNLAWYQQKPGQAPRLLIYGASTRATGIPARFS GSGSGTEFTLTISSLQSEDFAVYYCQQFNNWPRGTFGQGTKVEVKRT KCBG4-20 TGVHGDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSDRAFGV PDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTPVTFGGGTKVEIKRT KCBG4-23 TGVHSEIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASTRATGIPARFS GSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPGLKITFGQGTRLEIKRT KCBG4-24 TGVHSDIQLTQSPAFLSASVGDRVTITCRASQGISSYLAWYQQRPGKAPKLLIYAASTLQSGVPSRFSG SGSGTEFTLTISSLQPEDFATYYCQQLNSSPGSLTFGGGTKVEIKRT KCBG4-25 TGVHSEIVLTQSPGTLSLSPGERATLSCRASQSVPSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFS GSGSGTDFTLTISRLEPEDFAVYYCQQYGSPMYTFGQGTKLEIKRT KCBG4-26 TGVHSDIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIFDASNSETGVPSRFS GSGSGTDFTFTISSLQPEDIATYYCQQYDNLPPTFGQGTKLQIKRT KCBG7-1 ATGVHGDIVMTQSPLSLPVTPGEPASISCRSSQSLLQSNGYNYLDWYLQKPGQSPQLLIYLGSNRASG VPDRFSGSGSGTDFTLKISRVEADDVGVYYCMQALQTPTFGGGTKVEIKRT KCBG7-2 ATGVHSEIVLTQSPGTLSLSPGERATLSCRASQSVSSTYLAWYQQKPGQAPSLLIYGASHRATGIPDRF SGSGSGTDFTLTISRLEPEDFAVYYCQQFGSSPLYTFGQGTKLEIKRT KCBG7-4 ATGVHSDIVMTQSPDSLAVSLGERATINCKSSLSVLYSSNNKNYLAWYQQKPGQPPKLLIYWASTRE SGVPDRFSGSGSGTDFTLTISGLQAEDVAVYYCQQYYSTPITFGQGTRLEIKRT KCBG7-5 ATGVHSDIQLTQSPSFLSASVGDRVTITCRASQGINSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFS GSGSGTEFTLTISSLQPEDFATYYCQQLNSLFTFGPGTKVDIKRT KCBG7-6 ATGVHSDIQMTQSPSSLSASVGDRVTITCRASQAISNYLAWFQQKPGKAPKSLIYAASSLQSGVPSKF SGSGSGTDFTLTISSLQPEDFATYYCQQYNSYPLTFGGGTKVEIKRT KCBG7-7 ATGVHGDIVVTQSPLSLPVAPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRASG VPDRFSGSGSGTDFTLKISRVEAEDVGIYYCMQSLQTRTFGQGTKVEIKRT KCBG7-9 ATGVHSDIQMTQSPSTLSASVGDRVTITCRASQSISRWLAWYQQTPGKAPKLLIYKASSLESGVPSRF SGSGSGTEFTLTISSLQPDDFATYYCQQYNTYFWTFGQGTKVEVKRT KCBG7-11 ATGVHSEIVLTQSPATLSLSPGERATLSCRASQSVPTYLAWYQQKPGQAPRLLIYDASNRATGVPARF SGSGSGTDFTLTISSLEPEDFAVYYCQQRRDWPGTFGQGTKLEIKRT KCBG7-12 ATGVHSDIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPSRF SGSGSGTDFTFTISSLQPEDIATYYCQQYGNLPPLTFGQGTRLEIKRT KCBG7-15 ATGVHSEIVLTQSPGTLSLSPGERATLSCRASQSVSGTFLAWYQQKPGQAPRLLISGASSRATGIPDRF SGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSRPTFGQGTKLEIKRT KCBG7-18 ATGVHSDIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQKPGQPPKLLIYWASTRE SGVPDRFSGSGSGTDFTLTITSLQAEDVAVYYCQQYYSTPLTFGPGTKVDIKRT KCBG10-1 ATGVHSDIQMTQSPSSLSASVGDRVTITCRASHSISDYLNWYQQKPGKAPKLLIYAASSLQSGVPSRF SGSGSGTDFTLTISSLQPKDFATYYCQQSYSNPFTFGPGTKVDIKRT KCBG10-4 ATGVHGDIVMTQTPLSLSVTPGQPASFSCRSSESLLYSDGKTYLHWYLRKPGQPPQLLIYEVSKRFSG VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSTQLPWTFGQGTKVEIQRT KCBG10-6 ATGVHSDIVMTQSPDSLAVSLGDRATINCKSSQNLLFSSNNKNYLAWYQQKPGQPPKLLIYWASTRE SGVPDRFSGSGSGTDFTLTITSLQAEDVAVYYCQQYYSTPLTFGGGTKVEIKRT KCBG10-12 ATGVHSEIVLTQSPGTLSLSPGERATLSCRASQSVSSIYLAWYQQKPGQAPRLLIYGASSRATGIPDRF SGSGSGTDFTLTISRLEPEDFAVYYCQHYGSSPPVTFGQGTKLEIKRT KCBG10-18 ATGVHSDIQMTQTPSSLSASVGDRVSITCRASQNIHTFLIWYLQRPGKAPNFLIYAASSLQSGVPSRFS GSGSETDFTLTISSLQPEDFGTYYCQQSYTTPYTFGQGTKLEIKRT LCBG1-3 TGSWAQSVLTQPPSASGTPGQRVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLIYRNNQRPSGVPDRF SGSKSGTSASLAISGLRSEDEADYYCAAWDDSLSGVVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG1-9 TGSWANFMLTQPHSVSDSPGRTVTISCTRSSGDIASSYVQWYQQRPGSVPTTVIHENSERPSGVPDRF SGSIDTSSNSASLTISGLQTEDEAVYYCQSYDSGRQGVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG1-17 TGSWAQSVLTQSPSASGTPGQRVTISCSGSSSNIGGNTVNWYQQLPGTAPKLLIYSNNQRPSGVPDRF SGSKSGTSASLAISGLQSEDEADYYCASWDDSVNGVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG1-18 TGSWAQSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKVMIYDVRNRPSGVSN RFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTWVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG1-21 TGSWAQSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVSNRPSGVSN RFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSITGVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG1-22 TGSWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYYVHWYQQHPGTAPKLLIYGNSNRPSGVPD RFSGSKSGTSASLAITGLQAEDEADYYCQSYDSRLSGWVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG1-26 TGSWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNNNRPSGVPD RFSGSKSGTSASLAITGLQAEDEADYYCQSYASSLSVHVVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG4-3 TGSVTSFELTQPSSVSVSPGQTVTITCSGDVLEKKYVRWFQQRPGQAPILVIYKDTERPSRIPERFSGSS SGTTVSLIITGAQVEDEADYYCYSVADNMGVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG4-4 TGSNSQAVVTQEPSLTVSPGGTVTLTCGSTTGAVTSGHYPYWFQQKPGQAPRTLIYDTNNKHSWTPA RFSGSLLGGKAALTLSGAQPEDEAEYYCLLSYSGAWVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG4-5 TGSWAQSVLTQPPSASGTPGQRVTVSCSGSSSNILNNYVYWYQQLPGTAPKLLIYRNNQRPSGVPDR FSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLFVVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG4-8 TGSWAQSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSNRPSGVSN RFSGSKSGNTASLTISGLQAEDEADYYCSSYTRGNYVFGTGTKVTVLGQPKANPTVTLFPPS LCBG4-10 TGSWAQSALTQPASVSGSPGQSITISCTGTSDDVGGYNLVSWYQQHPSKAPKLMIYAANKRPSGVSN RFSGSKSGNTASLTISGLQAEDEAHYYCCSYATGSSVVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG4-12 TGSWAQSVLTQPPSVSGAPGQRITISCTGSTSNIGAGYDVHWYQQLPGTAPKLLIYANSNRPSGVPDR FSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSAVWVFGTGTKVTVLRQPKANPTVTLFPPS LCBG4-13 TGSWAQSVLTQPPSASGTPGQRVTISCSGSNSNIGSNYVYWYQQLPGTAPKLLIYRNNQRPSGVPDRF SGSKSGTSASLAISGLRSEDEADYYCAAWDDSLSALVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG4-14 TGSWAQSALTQPASVSGSPGQSITISCTGTSSDVGSYNLVSWYQHHPGKAPKLMIYEVSKRPSGVSNR FSGSKSGNTASLTISGLQAEDETDYYCCSYAGSSTLVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG4-16 TGSWAQSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKIMIYDVSNRPSGVSN RFSGSKSGNTASLTISGLQAEDEADYYCSSHTSSSSPHVVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG4-18 TGSWAQSALTQPRSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSQRPSGVP DRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGTYTVIFGGGTKLTVLGQPKAAPSVTLFPPS LCBG4-21 TGSNSQAVVTQEPSLTVSPGGTVTLTCGSSTGTVTSYHYAYWFQQKPGQVPRVLIYDTSDKPSWTPA RFSGFLLGDKAALTLSGAQPEDEADYYCLLSYSGVVVFGGGTKLTVLGQPRSAPSVTLFPPS LCBG4-22 TGSWAQSALTQPRSVSGSPGQSVTISCTGSSTDVGVYNYVSWYQQHPGNAPKLMIFDVSKRPSGVPD RFSGSKSGNTASLTISGLQAEDEADYYCCSYAGTYTPVVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG4-27 TGSWAQSALTQPASVSGSPGQSITISCTGTSSDVGGYDFVSWYQQHPGKAPKLMIYDDINRPSGVSNR FSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTSSVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG7-3 ATGSWAQSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSNRPSGVS NRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTQVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG7-10 ATGSWAQSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSNRPSGVS NRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSRSPWVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG7-13 ATGSWAQSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVSNRPSGVS SRFSGSKSGNTASLTISGLQAEDEADYYCYSYTTSSTPYVFGTGTKVTVLGQPKANPTVTLFPPS LCBG7-14 ATGSWAQSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSNRPSGVS NRFSGSKSGNTASLTISGLQAEDEADYYCSSYTTSSTLVFGTGTKVTVLGQPKANPTVTLFPPS LCBG7-16 ATGSWAQSGPTQPASVSGSPGQSITISCTGTSTDVGGYHYVSWHQQHPGEAPKLIIYEVSNRPSGVSH RFSGSKSGNTASLTISGLQAEDEADYYCSSYTKTRTLYVFGTGTMVTVLGQPKANPTVTLFPPS LCBG7-17 ATGSWAQSVLTQPPSASGTPGQRVTISCSGSSSNIGGNTVTWYRQLPGTAPKLLISTNNQRPSGVPDR FSGSKSGTSASLAISGLQSEDEADYYCATWDDSLNTYVFGTGTKVTVLGQPKANPTVTLFPPS LCBG7-19 ATGSWANFMLTQPRSVSESPGKTVTISCTRTSGSIAINYVQWYQQRPGSSPTTVIYEDSQRPSGVPDRF SGSIDSSSNSASLTISGLKTEDEADYYCQSYDSGSWVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG7-20 ATGSWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYHQLPGTAPKFLIYGNSNRPSGVP DRFSGSKSGTSASLAITRLQAEDEADYYCQSYDSSLSGWVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG10-2 ATGSVTSYELTQPPSVSVSPGQTATITCSGDKLGDQFVSWYRQRPGQSPVVVIYQDIKRPSGIPERFSG SNSGNRATLTIRGTQALDEADYYCQAGDSDTVLFGGGTQLTVLGQPKAAPSVTLFPPS LCBG10-3 ATGSVTSYVLTQPPSVSVAPGQTARISCGGDKIGSKNVHWYQQKPGQAPVLVVYDDSDRPSGIPERF SGSNSGNTATLTITRVEARDEADYYCQVWDRSSVFGTGTKVSVLGQPKANPTVTLFPPS LCBG10-5 ATGSWAQSLLTQPPSASGTPGQRVTISCSGGSSNIGSNSVCWYQQLPGTAPKLLIYRSNQRPSGVPDR FSGSKSGTSASLAISGLWSEDEADYYCSAWDDSLRGPVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG10-7 ATGSWAQSVLTQPPSVSGAPGQRVTISCTGSTSNIGAGYDVHWYQQLPGTAPKLLIYANTNRPSGVP DRFSGSKSGTSASLAISGLQAEDEADYFCQSYDSRLSAWVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG10-8 ATGSVTSYVLTQPPSVSVAPGQTARISCGGNNIESKTVHWYQQKPGQAPILVVYDDNDRPSGIPERFS GSNSGNTATLSISRAEAGDEADYYCQVWDSSRDLRVFGGGTKLSVLGQPKAAPSVTLFPPS LCBG10-9 ATGSVTSYELTQPPSVSVSPGQTASITCSVDKLGNKYVCWYQQKPGQSPVLVIYQDSKRPSGIPERFS GSNSGNTATLTISGTQAMDEADYYCQAWDSSTGVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG10-10 ATGSWAQSVLTQPPSVSGAPGQRVTISCTGSSSDIGAGYNVHWYQQLPGTAPKLLIYGNNNRPSGVP DRFSGSKSGASASLAISGLQAEDEADYYCQSFDSSLSGFYVFGTGTKVTVLGQPKANPTVTLFPPS LCBG10-11 ATGSWAQSALTQPASVSGSPGQSITISCTGTTSDVGGYNYVSWYQQHPGKAPKLMIFEVSNRPSGVS DRFSGSKSGNTASLTISGLQAEDEADYYCTSYRSSSLQGVFGTGTKVTVLGQPKANPTVTLFPPS LCBG10-13 ATGSWAQSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYTNNQRPSGVPDR FSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGLYVFGTGTKVTVLGQPKANPTVTLFPPS LCBG10-14 ATGSVTSYVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPERFS GSNSGNTATLTISRVEAGDEADYYCQVWDSSSDPWVFGGGTKVTVLGQPKAAPSVTLFPPS LCBG10-15 ATGSWAQSVLTQPPSVSAAPGQKVTISCSGNSSNIGNNYVSWYHQLPGTAPKLLIYDNNKRPSGIPDR FSGSKSGTSATLGITGLQTGDEADYYCGTWDNSLSVGVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG10-16 ATGSWAQSALTQPPSASGSPGQSVTISCTGTSSDIGAYNYVSWYQQHPDKAPKLMIYEVNNRPSGVS DRFSGSKSGNTASLTVSGLQAEDEADYYCSSYAGSDNWVFGGGTKLAVLGQPKAAPSVTLFPPS LCBG10-17 ATGSVTSYALTQPPSVSVSPGQTARITCSGDALPRRYAYWYQQKSGQAPVLVIYEDTKRPSGIPERFS GSSSGTMATLTISGAQVEDEADYYCYSTDSSDNHRVFGGGTKLTVLGQPKAAPSVTLFPPS LCBG10-19 ATGSWAQSVLTQPPSASGTPGQRVTISCSGSSSNIGSDHVYWYQQLPGTAPKLFIYRNNQRPSGVPDR FSGSKSGTSASLAISGLRSEDEADYYCAAWDASLSGYVFGTGTKVTVLGQPKANPTVTLFPPS

    [0148] Antibodies isolated from SARS-COV-2 S- and RBD-binding B cells are typically non-polyreactive. Polyreactivity is a feature of antibodies that is selected against in several checkpoints throughout B cell development (Wardemann et al., 2003), but can be generated during affinity maturation (Tiller et al., 2007). Antibody responses to HIV-1 envelope trimer, for example, display elevated levels of polyreactivity, which was suggested to be a means to increase antibody avidity in the setting of a low density of envelope spikes on the HIV surface (Mouquet et al., 2010) and to allow for better binding to divergent HIV-1 envelope strains (Prigent et al., 2018). At the same time, polyreactivity negatively affects the half-life and therefore clinical utility of monoclonal antibodies when considered for clinical use in humans (Horwitz et al., 2013; Shingai et al., 2014).

    [0149] To assess if antibodies isolated from SARS-COV-2 S- and RBD-binding B cells have an increased frequency of polyreactivity, Applicants tested all 92 isolated antibodies for binding to dsDNA, insulin, bacterial lipopolysaccharide (LPS) and streptavidin-APC by ELISA (Wardemann et al., 2003). Applicants included streptavidin-APC as an antigen to additionally assess any potential off-target binding of B cells to the reagent used to stain the baits used in cell sorting (Methods). 11 of 92 (12%) of all antibodies and 6 of 56 (11%) intermediate or strong binders to SARS-COV-2 S or RBD showed reactivity against two or more of the four polyyreactivity antigens in ELISA (FIG. 9E and Table 3), significantly less than polyreactivity frequencies detected in healthy memory B cells (22.7%, (Tiller et al., 2007)) or HIV-specific B cells (75% (Mouquet et al., 2010)). In addition, Applicants tested all 92 antibodies in an ELISA assay developed to screen for off-target antibody binding against baculovirus lysate in the presence of bovine serum albumin (BSA) (Hotzel et al., 2012) (Methods). None of the antibodies were found to be reactive against baculovirus lysate in this assay (Table 3). Applicants conclude that most antibodies isolated from SARS-COV-2 S- and RBD-binding B cells are not polyreactive when expressed as IgG1 and that intermediate or strong binding to the SARS-COV-2 surface trimer does not require polyreactivity.

    [0150] Neutralizing antibodies against SARS-COV-2 mostly arise from IgG+ B cells and target the RBD. Applicants next screened all 92 antibodies for neutralizing activity in the pseudotyped virus neutralization assay used on the serum samples (Robbiani et al., 2020; Schmidt et al., 2020) (above and Methods). 27 of 92 antibodies (29%) showed neutralizing activity when tested up to a concentration of at least 25 ?g/ml, and neutralizing antibodies were identified from all 4 selected subjects (FIG. 9F and Table 2). IC50 values ranged from 3 ng/ml to 25 ?g/ml with a median of 99 ng/ml (FIG. 9F and Table 2). Neutralizers showed at least intermediate binding in ELISA to both SARS-COV-2 S trimer and RBD, with the exception of one antibody, BG4-14, a weak neutralizer with binding by ELISA only to RBD (Tables 2 and 3).

    [0151] Neutralizing activity was detected for 21 of 42 antibodies (50%) selected from IgG cells compared with 4 of 35 (11%) from IgM/D cells and 2 of 15 (13%) from IgA cells (?2=15.9, P value 0.0004) (FIG. 9G and Table 2). To evaluate if these 27 neutralizers were similarly potent against authentic SARS-COV-2 virus compared with pseudovirus, Applicants tested their activities in a neutralization assay against authentic SARS-COV-2 and found the results between both SARS-COV-2 neutralization assays to be comparable (correlation coefficient (r) for comparison between IC.sub.50 values 0.701, P value <0.0001) (FIG. 2B, FIG. 9H and Table 2). Applicants conclude that neutralizing antibodies targeting the RBD of SARS-COV-2 were present in all four selected subjects, mostly arise from IgG.sup.+ B cells, and are active against both a pseudotyped virus and against authentic SARS-COV-2. See, also, FIGS. 17-20.

    [0152] Select antibodies retain potent neutralizing activity against circulating variants B.1.1.7 and B.1.351. Several circulating variants of SARS-COV-2, including B.1.1.7 and B.1.351 (Tegally et al., 2020) show decreased sensitivity to some SARS-COV-2 monoclonal antibodies, polyclonal sera from recovered COVID-19 patients (Wibmer et al., 2021) and sera from individuals who have received SARS-COV-2 mRNA vaccines (Wang et al., 2021) (Wu et al., 2021) (Liu et al., 2021). To test if the antibodies described herein retain neutralizing activity against B.1.1.7 and B.1.351 Applicants produced pseudotyped SARS-COV-2 viruses carrying the reported spike mutations in these variants ((Davies et al., 2021) (Tegally et al., 2020) and Methods) and tested antibodies BG10-19, BG1-22, BG4-25 and BG7-15 in a pseudovirus neutralization assay (FIGS. 2E and 9I). All three antibodies neutralized B.1.1.7 with similar potency as WT (D614G) and both BG10-19 and BG7-15 retained neutralization potency against B.1.351 whereas both BG1-22 and BG4-25 showed a 15-fold increase in IC50 values against this variant respectively (FIGS. 2E and 9I). Applicants conclude that BG10-19 and BG7-15 retain potent neutralizing activity against the recently identified circulating variants B.1.1.7 and B.1.351.

    [0153] Antibody BG10-19 potently neutralizes both SARS-COV-2 and SARS-COV. Antibodies that target conserved epitopes among different betacoronaviruses are the subject of intense investigation given their potential utility in future coronavirus outbreaks. A small set of antibodies that were isolated from SARS-COV-infected individuals have been shown to cross-react with SARS-COV-2 (Pinto et al., 2020a) and vice versa (Robbiani et al., 2020).

    [0154] To evaluate potential cross-reactivity of the antibodies to other coronaviruses, Applicants tested all 92 neutralizing antibodies for binding to SARS-COV and MERS-COV spike (S) protein and RBD in ELISA (FIG. 2C, 2F and Table 3). Two SARS-COV-2 non-neutralizing antibodies showed strong cross binding to MERS (BG4-23 and BG1-13), one of which (BG4-23) also showed strong cross binding to SARS-COV (Table 3). Three SARS-COV-2 neutralizers (BG1-28, BG10-14, BG10-19) showed strong cross-binding to SARS-COV (Table 3), and BG10-19 also showed weak binding to MERS S (FIG. 2C). Applicants next tested if any of the SARS-COV-2 neutralizers that cross-bind SARS-COV also show neutralizing activity against SARS-COV using a pseudovirus neutralization assay. BG10-19 neutralized SARS-COV potently with an IC50 value of 3 ng/ml compared with 20 ng/ml for antibody S309, a cross neutralizing antibody that was originally isolated from a SARS-COV patient (FIG. 2D, 2G) (Pinto et al., 2020a). BG10-19 also neutralized SARS-COV-2 more potently than S309 with an IC.sub.50 of 9 ng/ml compared to 79 ng/ml (Table 2 and (Pinto et al., 2020a)). BG1-28 and BG10-14 did not neutralize SARS-COV and neither did a selection of SARS-COV-2 neutralizers that showed intermediate cross binding to SARS-COV in ELISA (FIG. 2D, 2G and Table 3).

    [0155] IgA dimerization increases neutralization of SARS-COV-2. Secreted IgA and IgM antibodies can, if expressed with J chain, multimerize and therefore increase overall antibody avidity depending on the density and accessibility of the antigen binding sites (Klein and Bjorkman, 2010). Consistent with this, some IgA dimers of SARS-COV-2 neutralizing antibodies show increased neutralizing potency when compared to their monomeric versions (Wang et al., 2020b). To test the effect of dimerization on neutralizing activity in our antibodies Applicants expressed and purified 13/15 antibodies which were derived from IgA+ B cells (Tables 2 and 3) as IgA monomers and dimers (FIG. 9J, K) and tested them for neutralization of SARS-COV-2 in a pseudotyped neutralization assay. Both antibodies that showed neutralizing activity against SARS-COV-2 when expressed as IgG1 (BG1-23 and BG1-26, Tables 2 and 3) showed similar neutralization potency when expressed as IgA monomers. In dimeric form, their neutralizing activity increased with molar neuralization ratios (MNRs) (Klein and Bjorkman, 2010) of 6 and 8 respectively suggesting an added avidity effect through dimerization (FIGS. 9L, M). 6 of the remaining 11 antibodies that had not shown any neutralizing activity when expressed as IgG1 neutralized SARS-COV-2 either weakly only as dimeric IgA (BG10-5) or both as IgA monomer and dimer with IC50 values ranging from 26 ng/ml (dimeric BG10-8) to 6.5 ?g/ml (dimeric BG1-15) (FIGS. 9L, M). MNRs>2 were observed for weakly neutralizing IgA dimer BG1-27 (MNR=3) and potently neutralizing IgA dimer BG10-8 (MNR=10.86) suggesting that in these cases dimerization leads to increased overall avidity of the antibody (Klein and Bjorkman, 2010) (FIGS. 9L, M). Applicants conclude that expression as IgA can increase the neutralizing activity of some SARS-COV-2 antibodies against SARS-COV-2 pseudovirus and that in some cases dimerization can further increase potency by increasing overall antibody avidity.

    [0156] A cryo-electron microscopy structure of a complex between the SARS-COV-2 S trimer and the Fab fragment of cross-neutralizing antibody BG10-19. To understand the mechanism of potent BG10-19-mediated neutralization of both SARS-COV-2 and SARS-COV, Applicants determined a 3.3 ? single-particle cryo-electron microscopy (cryo-EM) structure of a complex between a soluble, stabilized SARS-COV-2 S (Hsieh et al., 2020) and the BG10-19 Fab (FIG. 3, FIG. 10 and Table 5).

    [0157] The BG10-19-S structure revealed S trimers adopting a closed conformation bound to three BG10-19 Fab fragments (FIGS. 3A and 10A-C). BG10-19 recognizes a quaternary epitope comprising distinct regions from all three protomers, including interactions that bridge two neighboring RBDs and the N165.sub.NTD-glycan (FIG. 3B). Specifically, BG10-19 uses five of its six complementarity-determining region (CDR) loops to interact with a proteoglycan epitope focused atop the RBD ?1 (residues 338-347) and ?2 (residues 364-374) helices, with additional contacts with residues 436-450 (FIG. 3C-G). The CDRH2 and CDRH3 loops mediate the majority of RBD contacts (?760 ?.sup.2 of ?1090 ?.sup.2 total paratope buried surface area (BSA)), establishing extensive hydrogen bonding and van der Waals interactions with RBD residues (FIG. 3E, G). The N343.sub.RBD-glycan (modeled as a complex-type pentasaccharide) at the base of the al helix interfaces with both CDRH3 and CDRL2 loops, including contacts with the core fucose moiety in a manner similar to the cross-reactive SARS-COV monoclonal antibody S309 (FIG. 3F) (Pinto et al., 2020a). The CDRH2 and CDRH3 loops mediate the majority of RBD contacts (?760 ?.sup.2 of ?1090 ?.sup.2 total paratope buried surface area (BSA)), establishing extensive hydrogen bonding and van der Waals interactions with RBD residues (FIG. 3E,F). Collectively, interactions mediated by CDRH1-3 and CDRL2 loops establish the primary epitope recognized by BG10-19, which does not overlap with the ACE2 receptor-binding motif (RBM) (FIG. 10) and accounts for 87% of BSA on the S trimer (?925 ?.sup.2 of peptide BSA and ?220 ?.sup.2 glycan BSA).

    [0158] However, unlike the binding mode of S309, BG10-19 adopts a pose that positions the light chain CDRL1 loop and FWR3 atop the neighboring down RBD to lock the S trimer into a closed conformation (FIG. 3A-D and FIG. 10C). This binding orientation is distinct from previously-described neutralizing antibodies that utilize interactions of long CDRH3s to mediate bridging interactions to stabilize the S trimer in a closed, prefusion conformation state (Barnes et al., 2020a; Tortorici, 2020). Additional BG10-19 interactions on the neighboring RBD involve residues 490-498 (FIG. 3D), which overlap with the ACE2 RBM and contribute ?150 ?.sup.2 BSA to the total quaternary epitope. Such interactions prevent sampling of the up RBD conformation to expose the ACE2 RBM, thus blocking the SARS-COV-2 S 6P trimer binding to immobilized sACE2-CH3 (Tada et al., 2020) in SPR experiments (FIG. 3H). These data suggest that BG10-19 utilizes a neutralization mechanism that inhibits exposure of the ACE2 RBM.

    [0159] Furthermore, sequence conservation at the BG10-19 epitope explains the potent cross-neutralizing activity against SARS-COV (FIG. 2D, G). The primary binding site for BG10-19 comprises 23 of 29 residues strictly or conservatively substituted between SARS-COV-2 and SARS-COV RBDs (FIG. 10E). Given the highly conserved nature of the BG10-19 epitope, Applicants further characterized the potential of BG10-19 to cross-react with heterologous sarbecoviruses. Bat coronavirus strains WIV1-CoV and SCH014-CoV belong to the clade 1 family of sarbecoviruses and are ACE2-tropic (Li et al., 2003). When Applicants assessed BG10-19 cross-reactivity to these viruses, Applicants observed the binding to WIV1-COV RBD at the same levels as SARS-COV-2 and SARS-COV, but no neutralizing activity (FIG. 10G-J). The lack of neutralizing activity against WIV1-CoV was surprising, given its 95% amino acid sequence identity with SARS-COV (Cohen et al., 2020; Pinto et al., 2020a). Interestingly, key sequence differences occur at RBD positions 346, 439, 440, and 445, and mutations at these positions have been shown to provide immune escape against class 3 anti-SARS-COV-2 neutralizing antibodies and polyclonal sera (Thomson et al., 2020; Weisblum et al., 2020). For example, substitutions at RBD residue R346 have the potential to disrupt cation-pi and hydrogen bond interactions at the antibody-antigen interface (FIGS. 3E, F and 10D). Overall, the findings suggest that the SARS-CoV-2 trimer-specific antibody response includes rare antibodies such as BG10-19 with highly potent cross-neutralizing activity against SARS-COV. See, also, FIGS. 24-26.

    [0160] SARS-COV-2 S- and RBD-binding B cell repertoires include different B cell populations. To characterize the transcriptional properties SARS-COV2 and RBD-binding B cells, Applicants performed scRNA-seq paired with VDJ sequencing of B cell populations sorted from the 14 convalescent subjects. These B cells were selected based on expression of CD20, CD19 and SARS-COV-2 S or RBD binding alone without selection for other surface markers or immunoglobulin isotype expression (Methods and above). Applicants profiled 6,113 sorted B cells, revealing 6 distinct transcriptional cell clusters (TCs) (FIGS. 4A, B) that had representation from all donors, though with enrichment of some donors in specific clusters. (FIG. 11A and see below). These clusters were neither dependent on binding to SARS-COV-2 S or RBD (FIG. 11B) nor on cell cycle phase (FIG. 11C). As expected, CD44 and CXCR4 were abundantly expressed throughout all TCs, consistent with their frequent expression among mature B cells (FIG. 11D) (Kremmidiotis and Zola, 1995; Nagasawa et al., 1996; Nie et al., 2004). CD38 expression levels were low throughout all clusters, in keeping with a low frequency of antibody-secreting cells which was expected as B cells were selected based on binding of surface immunoglobulin to SARS-COV-2 S or RBD (Ellebedy et al., 2016) (FIG. 11D). The cell clusters were distinguished by increased expression of specific marker genes (FIG. 4A), such as genes associated with different B cell populations, including na?ve and memory B cells, consistent with isotype, mutation status and clonal expansion features of these cells. Specifically, the TC1 marker genes FCER2 (CD23) and TCL1A are known to be highly expressed in mature na?ve B cells (FIG. 4A, Table 4) (Horns et al., 2020), consistent with an enrichment in TC1 of IgD and IgM B cells (36% and 63% of cells, respectively, FIG. 11E) with low levels of inferred somatic mutations (FIG. 11F) and minimal clonal expansion (FIG. 11G, H). In TC3 and TC4, CD27 and CD80, both expressed in memory B cells (Moroney et al., 2020; Zuccarino-Catania et al., 2014) were highly expressed (FIG. 12A), and the majority of cells in these clusters were IgG1+(53% and 73% of cells, respectively, FIG. 11E), somatically mutated (FIG. 11F) and more clonally expanded than cells in TC1 (FIG. 11G, H). Cells in TC3 and TC4 are also highly expressed CXCR3, a chemokine receptor found on some class switched B cells that is believed to facilitate migration to sites of inflammation (Moroney et al., 2020; Muehlinghaus et al., 2005) and CD70, which is upregulated on stimulated B cells where its interaction with CD27 on effector T cells plays an important role in antiviral T cell responses (Izawa et al., 2017; van Gisbergen et al., 2011) (FIG. 4A and FIG. 12A).

    [0161] In the weeks following vaccination or infection with influenza or infection with Ebola, antigen specific B cells can present as antibody secreting cells, memory B cells or activated B cells (ABCs), which wane after several weeks and show relatively higher expression levels of CD52, TLR10, CD19 and CD20 (Ellebedy et al., 2016). To test if either TC3 or TC4 include ABCs, Applicants examined the distribution of expression levels in each cell cluster of CD52, TLR10, CD19 and CD20 and 10 other genes that are expressed at higher levels in ABCs compared to memory B cells (FIG. 12A) (Ellebedy et al., 2016). All 14 genes were significantly higher expressed (one-tailed t-test, FDR<0.01) in TC4 than in TC3 (FIG. 12A). Thus, SARS-COV-2 S- and RBD-binding B cell repertoires in recently recovered subjects include ABCs (TC4) and memory B cells (TC3) that are both mostly IgG1.sup.+, show expansion of B cell clones and somatic hypermutation. Applicants also detected IgD.sup.+ and IgM.sup.+ mature na?ve B cells (TC1) with low levels of somatic hypermutation, minimal clonal expansion and high expression of CD23 and TCLA1.

    TABLE-US-00004 TABLE 4 Transcriptome cluster marker genes (related to FIG. 4 and FIG. 11). For each of the 6 transcriptome clusters the top 30 genes that are differentially upregulated are displayed. Genes are included only if their minimum log fold change is greater than 0.25 with a false discovery rate (FDR) < 0.05. Columns show the gene name, transcriptome cluster, average log fold change (avg_logFC) and BH adjusted P values (p_val_adj) respectively. gene cluster avg_logFC p_val_adj EMP3 0 0.742674 7.4E?231 CIB1 0 0.704189 5.3E?174 LITAF 0 0.696586 1.1E?144 LGALS1 0 0.648787 6.46E?87 RHOB 0 0.591643 1.06E?85 COTL1 0 0.586451 4.6E?187 SRGN 0 0.570442 3.11E?24 PSAP 0 0.528844 6.22E?96 YWHAH 0 0.52012 1.77E?44 TNFRSF1B 0 0.51046 6.22E?57 ITM2C 0 0.509568 1.57E?77 IFITM2 0 0.450464 9.91E?88 FCRLA 0 0.444861 1.77E?91 SYK 0 0.436202 1.16E?85 THEMIS2 0 0.40288 1.43E?83 VOPP1 0 0.401409 6.67E?78 CNFN 0 0.387881 2.94E?19 S100A6 0 0.38559 1.87E?38 CBLB 0 0.384918 1.32E?81 RGS2 0 0.381306 1.48E?47 GPR183 0 0.380305 2.76E?66 NEAT1 0 0.379959 4.52E?59 KLK1 0 0.373715 5.25E?20 LY6E 0 0.368067 7.06E?75 MAP1LC3B 0 0.363525 4.22E?38 CLECL1 0 0.359972 4.62E?21 ARL4C 0 0.359298 8.06E?19 FCGR2B 0 0.359257 1.82E?75 ENC1 0 0.357722 2.84E?59 MYADM 1 1.243403 2.3E?225 TCL1A 1 1.225935 3.7E?199 IGLL5 1 1.046009 2.42E?69 TUBA1A 1 1.03559 2.7E?164 BACH2 1 0.901778 1E?144 CXCR4 1 0.864938 8.9E?189 FCER2 1 0.827531 8.04E?86 CA5B 1 0.783617 9.16E?76 FOS 1 0.762213 1.7E?99 YBX3 1 0.73925 4.63E?44 TAGAP 1 0.705204 4.6E?109 TSC22D3 1 0.700201 2.2E?176 TXNIP 1 0.684033 5.7E?154 IQGAP1 1 0.68283 8.19E?82 ITM2B 1 0.682475 1.7E?113 IL4R 1 0.673833 1.02E?36 CFAP20 1 0.669236 6.18E?48 PIK3IP1 1 0.666655 5.62E?36 APLP2 1 0.602008 3.22E?48 DUSP1 1 0.601203 6.7E?111 ARL4A 1 0.57224 7.76E?46 FOXP1 1 0.559891 1.4E?105 SNX9 1 0.550919 2.06E?56 FAM129C 1 0.54711 2.8E?55 KLF3 1 0.541581 2.6E?32 SNX29 1 0.530698 5.2E?35 JUN 1 0.514755 7.63E?56 TMEM123 1 0.510121 3.92E?29 H1FX 1 0.507778 1.98E?11 LINC00926 1 0.495411 2.6E?63 LINC01857 2 0.89658 6.2E?141 LY9 2 0.805187 1.06E?55 ZNF331 2 0.793354 1.3E?112 NR4A2 2 0.716041 8.47E?46 ZFP36 2 0.683502 8.91E?92 JUNB 2 0.621796 5.86E?87 CXCR4 2 0.61256 3.1E?119 H3F3B 2 0.5396 4.45E?84 RGS2 2 0.48302 2.18E?31 SELENOK 2 0.449154 1.37E?49 CD83 2 0.437254 1.85E?45 SAT1 2 0.429319 2.81E?36 BTG1 2 0.421039 6.36E?76 EZR 2 0.415967 7.78E?86 IDI1 2 0.411112 1.24E?23 HSPA5 2 0.401979 3.29E?29 FTH1 2 0.397222 1.3E?58 C7orf50 2 0.388294 6.36E?20 ZFP36L2 2 0.376236 1.65E?23 ATP6V0C 2 0.36337 3.38E?34 PTP4A1 2 0.356091 4.39E?16 GPR183 2 0.350688 1.52E?24 SELENOM 2 0.347283 1.93E?07 RPS3 2 0.334121 3.2E?182 PDCD4 2 0.333819 2.22E?18 PDE4B 2 0.328615 8.84E?26 DDIT4 2 0.328236 5.39E?06 RPL3 2 0.325632 8.5E?151 ZFAS1 2 0.322384 3.31E?41 SNX9 2 0.322189 2.42E?32 PDE4D 3 0.617391 1.4E?74 GRAMD1C 3 0.5433 7.13E?80 TMEM156 3 0.48219 2.27E?75 NFKBIA 3 0.404666 4.09E?61 CXCR3 3 0.390844 1.47E?37 CFLAR 3 0.346347 7.76E?37 PIM3 3 0.331141 5.81E?32 TKT 3 0.328569 3.22E?51 CD70 3 0.315321 1.15E?18 RHOF 3 0.312104 2.01E?29 MGAT4A 3 0.304847 1.51E?26 HOPX 3 0.298667 3.67E?23 CAPG 3 0.296711 1.13E?45 MARCKSL1 3 0.295157 1.35E?35 S100A10 3 0.289821 7.32E?59 CD80 3 0.285129 1.57E?19 ZFP36L1 3 0.28247 3.44E?27 COCH 3 0.280678 1.25E?25 HMGA1 3 0.279839 9.8E?37 FAS 3 0.27515 2.3E?11 BASP1 3 0.27404 6.05E?23 PAPSS1 3 0.261811 1.77E?19 ITGB2-AS1 3 0.258236 4.33E?23 LYPLAL1 3 0.258037 1.67E?18 NME2 3 0.256528 7.04E?27 MIF 3 0.253228 2.95E?27 LMNA 3 0.252637 6.57E?15 ACTG1 4 2.187489 0 GAPDH 4 1.415694 0 S100A10 4 1.383357 7.2E?274 ACTB 4 1.243456 0 TKT 4 1.199748 2E?301 PFN1 4 1.193543 0 CORO1A 4 1.132533 0 HSPA8 4 1.082111 3.2E?263 S100A4 4 1.056015 3.6E?181 HMGA1 4 1.043888 1.8E?253 CNN2 4 1.042658 3.6E?276 SELL 4 1.018083 5.4E?218 TMSB10 4 0.991662 0 ARPC1B 4 0.991293 4.7E?219 CLIC1 4 0.952471 6.8E?232 RAC2 4 0.938414 1.2E?246 ARHGDIB 4 0.90303 1.3E?289 SLC25A5 4 0.889603 6.1E?229 VIM 4 0.859558 7.6E?175 PPP1R18 4 0.84057 1.9E?201 PPP1CA 4 0.833401 4E?215 CAPZB 4 0.814333 3.8E?206 ANXA2 4 0.803902 2.7E?162 CAPG 4 0.793994 6.6E?194 CFL1 4 0.778148 1.4E?279 LDHB 4 0.752417 7.2E?191 LTB 4 0.736497 1.6E?162 TUBB 4 0.725367 1E?110 PPIA 4 0.721525 1.9E?250 LCP1 4 0.719491 1.6E?135 PTPRC 5 1.302366 3.5E?69 MALAT1 5 1.155559 9.5E?118 TMEM123 5 1.08055 0.000249 B4GALT1 5 1.077235 3.42E?24 NFKBID 5 1.057845 7.32E?09 CEMIP2 5 1.021713 2.23E?06 LINC00926 5 1.016311 7.84E?33 VPS13C 5 1.015257 0.003396 MTRNR2L12 5 1.012071 7.3E?48 SMCHD1 5 1.00159 2.43E?26 NSF 5 0.997369 1.08E?09 BACH1 5 0.983251 1.45E?12 PARP14 5 0.975469 3.07E?05 EML4 5 0.971648 1.41E?31 CD69 5 0.967358 0.000444 CASP8 5 0.954006 1.86E?11 BTG2 5 0.953929 3.32E?09 NCOA3 5 0.949408 7.56E?17 SF1 5 0.949164 4.3E?55 REL 5 0.941262 1.26E?27 MS4A1 5 0.940841 1.15E?49 AKAP13 5 0.936896 3.65E?06 TMEM131L 5 0.931662 0.000402 PRDM2 5 0.921625 7.83E?18 PNN 5 0.918618 6.3E?23 STK4 5 0.914263 1.76E?21 PELI1 5 0.90293 0.000183 SRSF4 5 0.899508 2.23E?07

    TABLE-US-00005 TABLE 5 Cryo-EM data collection and refinement statistics (related to FIGS. 3, 5, 6 and. FIGS. 10, 13, and 14). BG10-19 Fab BG1-22 Fab BG7-15 Fab BG7-20 Fab BG1-24 Fab SARS-COV-2 S 6P SARS-COV-2 S 6P SARS-COV-2 S 6P SARS-COV-2 S 6P SARS-COV-2 S 6P PDB XXXX XXXX XXXX XXXX XXXX EMD xxxx xxxx xxxx xxxx xxxx Data collection conditions Microscope Talos Arctica Talos Artica Talos Arctica Talos Artica Talos Artica Camera Gatan K3 Summit Gatan K3 Summit Gatan K3 Summit Gatan K3 Summit Gatan K3 Summit Magnification 45,000x 45,000x 45,000x 45,000x 45,000x Voltage (kV) 200 200 200 200 200 Recording mode counting counting counting counting counting Dose rate (e.sup.?/pixel/s) 13.5 13.3 13.8 13.8 13.3 Electron dose (e.sup.?/?.sup.2) 60 60 60 60 60 Defocus range (?m) 0.7-2.0 0.7-2.0 0.7-2.0 0.7-2.0 0.7-2.0 Pixel size (?) 0.8689 0.8689 0.8689 0.8689 0.8689 Micrographs collected 3,807 3,386 3,065 3,717 2,609 Micrographs used 2,860 2,720 2,464 2,830 2,060 Total extracted particles 856,326 756,649 791,968 809,834 556,346 Refined particles 162,522 188,436 209,924 230,863 105,245 Particles in final refinement 101,085 71,104 130,297 135,666 84,059 Symmetry imposed C3 C3 C1 C1 C1 Nominal Resolution (?) FSC 0.5 (unmasked/masked) 7.5/3.7 7.6/4.1 7.8/4.0 8.0/4.3 8.3/4.5 FSC 0.143 (unmasked/masked) 4.4/3.3 5.9/3.7 5.2/3.7 6.7/3.8 6.7/4.0 Refinement and Validation Initial model used 7K43 7K4N 6XKL 6XKL 6XKL Number of atoms Protein 28,466 27,798 25,662 25,238 28,871 Ligand 715 873 837 675 779 MapCC (global/local) 0.81/0.79 0.80/0.75 0.74/0.73 0.79/0.76 0.86/0.81 Map sharpening B-factor 55.7 75.3 80.7 92.4 79.1 R.m.s. deviations Bond lengths (?) 0.002 0.005 0.01 0.015 0.001 Bond angles (?) 0.6 0.89 0.92 0.73 0.9 MolProbity score 2.37 2.26 2.46 2.19 2.14 Clashscore (all atom) 19.7 14.8 18.1 19.24 15.2 Poor rotamers (%) 1.3 1.1 2.4 0.32 0 Ramachandran plot Favored (%) 94 89.9 93.7 96.63 92.9 Allowed (%) 5.6 10.1 6.3 3.24 6.5 Disallowed (%) 0.4 0 0 0.13 0.6

    [0162] Memory B cells and activated B cells are enriched for cells that generate binding and neutralizing antibodies. To test if antibodies with high levels of binding to or neutralization of SARS-COV-2 were preferentially isolated from B cells in certain TCs, Applicants identified the clusters from which the 92 antibodies Applicants produced and tested are derived. Given that antibodies were selected for production and testing only based on representation of expanded clones (72/92) or randomly selected mostly IgG+ or IgA+ singlets (20/92) all transcriptional clusters are not equally represented among the 92 antibodies (Table 3). However, 20 of 33 (60%) neutralizers, 14 of 15 (94%) potent neutralizers (IC50?0.1 ?g/ml) and 5 of 10 (50%) non-neutralizing high binders were derived from cells in TCs 3 and 4 (FIGS. 4D and 9L, Tables 2 and 3), whereas 36 of 49 (73%) of the low binders belonged to TCs 0 and 2 (FIG. 4D and Table 3). The majority of neutralizers from TCs 3 and 4 were derived from singlets or small clones and did not have clonal members in other TCs among the cells Applicants sampled (FIG. 12D, Table 3). Applicants further tested the clusters for enrichment in class 1 neutralizers (VH3-53/VH3-66 antibodies with short CDRH3 regions (Barnes et al., 2020a) and see above). VH3-53/VH3-66 antibodies were overall significantly enriched in TC3 and TC4 compared to TCs 1, 2 and 5 (FIGS. 4E and 12B, two-tailed t-test, P<=0.0001), and all (8/9) VH3-53/VH3-66 neutralizing antibodies with CDRH3 regions shorter than 14 amino acids according to IMGT definition (Lefranc et al., 2015) were derived from B cells that belonged to either TC3 or TC4 (Tables 2 and 3). Note that the difference between TC3 and TC0 did not reach statistical significance. Applicants conclude that both strongly binding and neutralizing antibodies against SARS-COV-2 are frequently isolated from cells with a transcriptional profile consistent with memory B cells and ABCs.

    [0163] Frequency of SARS-COV-2 S- and RBD-binding ABCs and memory B cells correlates with serum neutralizing activity. While memory B cells and antibody secreting plasma cells are two separate B cell compartments that are regulated differently (Leyendeckers et al., 1999), memory B cells and plasma cells can originate from the same germinal center reaction, memory B cells can become antibody secreting plasma cells upon antigen binding and stimulation (Victora and Nussenzweig, 2012) and antibodies derived from memory B cells against HIV have been detected in serum from matched patients using mass spectrometry (Scheid et al., 2009a). Whether the frequency of memory B cells among SARS-COV-2 S- and RBD-binding B cells correlates with plasma neutralizing activity in recently recovered subjects is not known. To test this, Applicants measured if the frequency of cells from any TC among SARS-COV-2 S- and RBD-binding B cells correlated with serum neutralization in the 14 study subjects and found that the frequency of only TC3 and TC4 cells correlated positively with serum neutralization against SARS-COV-2 in a pseudovirus assay (Pearson's r=0.64 and 0.66, P=0.013 and 0.011, respectively) (FIG. 12C) and this correlation was not significantly affected by correcting for time since COVID-19 diagnosis (Pearson's r=0.69 and 0.76, P=0.017 and 0.007, respectively). Applicants conclude that expansion of both SARS-COV-2 binding memory B cells and ABCs correlate with serum neutralization titers against SARS-COV-2 in convalescent COVID-19 patients.

    [0164] VH3-53/VH3-66 antibodies with long CDRH3s can adapt class 1 antibody structural poses. Given the enrichment of VH3-53/VH3-66-encoded antibodies in TC3 and TC4 that correlated with strong binding and potent neutralization of SARS-COV-2, Applicants selected two antibodies which were coded by cells in these clusters with distinct CDRH3 lengths for structural characterization of their Fab fragments complexed with SARS-COV-2 RBD or stabilized S trimer. Applicants solved a 3.0 ? crystal structure of Fabs from BG4-25 (VH3-53-encoded with 12 aa CDRH3, IC.sub.80=13 ng/ml) and the SARS-COV antibody CR3022 (Tian et al., 2020) in complex with SARS-COV-2 RBD (FIG. 13A and Table 6). Consistent with the binding mode of class 1 neutralizing antibodies (Barnes et al., 2020b; Yuan et al., 2020), BG4-25 recognizes a RBD epitope that overlaps with >90% of residues in the ACE2 RBM (FIG. 13B), which is only fully accessible with up RBD conformations. Two V-gene encoded regions in class 1 neutralizing antibodies prominently contribute to epitope recognition; the .sup.31SNY.sup.33 CDRH1 and .sup.53SGGS.sup.56 CDRH2 sequence motifs, which take part in extensive hydrogen bond interactions at the RBD interface (Yuan et al., 2020; Tan et al., 2021; Wu et al., 2020b). Analysis of inferred somatic mutations in 93 VH3-53/VH3-66 antibodies coded in the collection of SARS-COV-2 binding B cells with CDRH3 less than 14 amino acids (IMGT definition; (Lefranc et al., 2015) revealed frequent inferred mutations in these motifs, including S31R and S56T in the antibody heavy chain positions 31 and 56, respectively, which are observed in BG4-25 (FIG. 13C-E). VH3-53/VH3-66-encoded antibodies from SARS-COV-2 binding B cells with short CDRH3s were also enriched for inferred mutations Y58F, F27L, and T28I, with the latter two mutations reported to increase neutralization potency in this class of antibodies (Hurlburt et al., 2020). Despite lacking these specific mutations, BG4-25 shows exceptional neutralizing activity, which is potentially explained by the F27I and S31R CDRH1 loop mutations that provide increased van der Waals interactions along the antibody-RBD interface (FIG. 13D, E).

    [0165] In addition to the recurrent, class 1 neutralizing antibodies defined by VH3-53/VH3-66-encoded gene segments and short CDRH3s (e.g., BG4-25), a subset of VH3-53/VH3-66-encoded neutralizing antibodies have been described with CDRH3 lengths >15 amino acids which would seemingly be incompatible with the binding mode of the recurring class 1 antibodies. A 3.7 ? cryo-EM structure of BG1-22 (VH3-53-encoded with 21 aa CDRH3, IC.sub.80=72 ng/ml, Table 2) Fab complexed with stabilized S trimers revealed binding of BG1-22 to up RBD conformations (FIGS. 5A and 13F-H). Surprisingly, the binding orientation of BG1-22 was consistent with class 1 antibody binding modes (FIG. 5B), which contrasts with previously-characterized VH3-53/VH3-66-long CDRH3 antibodies (Barnes et al., 2020a) (Wu et al., 2020a). To accommodate this binding mode, the 21-residue long CDRH3 of BG1-22 flips outward towards RBD residue Q493 resulting in a slight rotation of the antibody light chain relative to the canonical class 1 RBD-binding antibodies (FIG. 5C-E). The displaced CDRH3 conformation makes few sidechain interactions with the RBD, such that 6 residues of the CDRH3 loop are disordered (FIG. 5C, D).

    [0166] Although unliganded Fab structures often exhibit a disordered CDRH3 (e.g., 1RZI, 1RZF), it is unusual for an antibody bound to an antigen to exhibit a disordered CDRH3. From an examination of 731 antibody-antigen structures with resolutions of 3.5 ? or better in the Structural Antibody Database (SABDab; (Dunbar et al., 2014)), Applicants found only 6 with missing residue numbers between heavy chain residues 95 to 107, implying a disordered CDRH3 (PDB Codes 3LH2, 4JDT, 7JWB, 5ANM, 4M8Q, 3LHP). None of these complexes involved conventional antibody-antigen pairs; instead, they were germline forms of antibodies, the epitope was presented in a scaffold, or only the VH domain was involved in binding. This suggests that the orientation adopted by BG1-22 is not one that promotes CDRH3-mediated interactions with the antigen, as is classically observed in antibody-antigen structures, but instead simply accommodates the longer CDRH3 length by displacing much of the loop to outside the antibody-antigen interface. Taken together, these results provide further insight into the recurring VH3-53/VH3-66 neutralizing antibody class and suggests that longer CDRH3s, while infrequent, are not a restriction to V-gene mediated interactions at the RBD interface for VH3-53/VH3-66 antibodies. See, also, FIGS. 16, 27, 29 and 30-33.

    TABLE-US-00006 TABLE 6 X-ray crystallographic data collection and refinement statistics (related to FIGS. 5 and 13). BG4-25 - SARS2-RBD PDB ID (12-2, SSRL) Data collection.sup.a Space group P2.sub.12.sub.12.sub.1 Unit cell (?) 56.0, 104.3, 268.8 ?, ?, ? (?) 90, 90, 90 Wavelength (?) 1.0 Resolution (?) 38.8-3.0 (3.16-3.0) Unique Reflections 31,903 (4079) Completeness (%) 97.9 (88.1) Redundancy 6.1 (4.2) CC.sub.1/2 (%) 97.2 (25.9) <I/?I> 4.0 (0.7) Mosaicity (?) 0.23 R.sub.merge (%) 27.1 (135.8) R.sub.pim (%) 12.5 (88.6) Wilson B-factor 60.9 Refinement and Validation Resolution (?) 38.8-3.0 Number of atoms Protein 8,183 Ligand 0 Waters 0 R.sub.work/R.sub.free (%) 22.8/27.6 R.m.s. deviations Bond lengths (?) 0.01 Bond angles (?) 1.6 MolProbity score 1.89 Clashscore (all atom) 18.9 Poor rotamers (%) 0.9 Ramachandran plot Favored (%) 86.4 Allowed (%) 11.1 Disallowed (%) 0.7 Average B-factor (?) 80.5 .sup.aNumbers in parentheses correspond to the highest resolution shell

    [0167] Structural characterization of neutralizing antibodies with distinct epitope recognition and mutational escape patterns. To further understand the specificity of RBD-targeting, Applicants determined cryo-EM structures of Fab-S complexes for three additional potently neutralizing antibodies: BG7-15 (VH1-18-encoded, 11 aa CDRH3, IC.sub.80=92 ng/ml), BG7-20 (VH1-8-encoded, 20 aa CDRH3, IC.sub.80=23 ng/ml) and BG1-24 (VH1-69-encoded, 16 aa CDRH3, IC.sub.80=7 ng/ml), to resolutions of 3.7, 4.0, and 3.9 ?, respectively (FIGS. 6 and 14, Table 5). In all cases, Fabs were bound to either up or down RBD conformations, demonstrating recognition of antibody epitopes in either state. Analysis of the BG7-15-S structure revealed an antibody epitope focused on RBD residues 439-451, mainly mediated by contacts with CDRH3 and CDRL3 loops, which is non-overlapping with the ACE2 RBM (FIG. 6B-D). Overlay of BG7-15 and REGN-10987 (Hansen et al., 2020) showed a shared antibody footprint that binds outside the ACE2 RBM but would sterically hinder ACE2 receptor binding to RBD (FIG. 3H and FIG. 6E) while allowing binding of class 1 neutralizing antibodies (e.g., BG4-25, C102, REGN-10933).

    [0168] Cryo-EM structures of BG7-20-S and BG1-24-S complexes revealed RBD-targeting similar to human neutralizing antibodies that belong to the class 2 binding mode (Barnes et al., 2020a). This class of SARS-COV-2 neutralizing antibodies is defined by potent neutralizers capable of recognizing up and down RBD conformations, an epitope that overlaps with the ACE2 RBM, has secondary interactions with neighboring up RBDs, and has the potential for intra-protomer avidity effects. Despite preferred VH gene usages yet to be established for class 2 antibodies (BG7-20 and BG1-24 are VH1-8 and VH1-69, respectively), BG7-20 and BG1-24 show a similar epitope focused along the RBD ridge that overlaps with residues involved in ACE2 binding and includes contacts with E484, F486, and Q493. The binding pose of BG1-24 promotes stabilization of the N165.sub.NTD glycan, adding to the observation that class 2 antibodies can involve interprotomer glycan contacts (Cao et al., 2020a). Interestingly, the N-glycan interaction is mediated by a hydrophobic Met-Phe sequence at the tip of CDRH2, a common feature of VH1-69 antibodies (Chen et al., 2019). This feature has been attributed to facilitating broad neutralization by antibodies against influenza and Hepatitis C (Guthmiller et al., 2020) (Chen et al., 2019) and likely explains BG1-24's polyreactivity (FIG. 9E and Table 3).

    [0169] With the use of monoclonal antibodies as therapeutic options for SARS-COV-2 infection, understanding possible RBD mutations selected under monoclonal antibody pressure and the frequency of SARS-COV-2 isolates harboring RBD mutations that confer immune escape is critical. While deep mutational scanning and in vitro selection experiments have facilitated the choice of therapeutic antibody cocktails, these experiments have also illustrated that single-point mutations are sufficient for viral escape (Greaney et al., 2020; Weisblum et al., 2020). Indeed, reports of the SARS-COV-2 spike variant N439K, which now accounts for 3-4% of global isolates, could potentially limit the use of REGN-10987 as a therapy in SARS-COV-2 infection (Barnes et al., 2020b).

    [0170] To assess the effects of RBD substitutions, Applicants assayed ELISA binding and SARS-COV-2 pseudovirus neutralization for 6 of the 7 antibodies reported in this study against a panel of RBD point mutations by ELISA (FIG. 7A-P). Decreased binding and neutralization potency was observed for most antibodies when RBD substitutions occurred within the antibody epitope and were consistent with RBD substitutions known to decrease binding of antibodies in the same class (FIG. 7C-Q) (Barnes et al., 2020a; Greaney et al., 2020). Notable exceptions included BG7-15, which showed neutralizing activity against the RBD N439K mutant that confers escape against REGN-10987, and BG4-25, which neutralized the class 1 escape variant A475V (FIG. 7M, N). In general, decreased binding affinity correlated with RBD mutations that conferred viral escape in pseudotyped viral neutralization assays and were consistent with the observation that RBD mutations that affect antibodies from one class do not affect antibodies in a different RBD-targeting class (FIGS. 7C-H and K-P). Given that several potently neutralizing antibodies were non-competitive, Applicants assessed antibody cocktails for synergistic neutralization effects (IC50.sub.eff>1) against SARS-COV-2 pseudovirus using a previously described synergistic model (West et al., 2010). Results suggest that only the BG10-19+ BG4-25 antibody combination demonstrated synergistic neutralizing activity (FIG. 7Q) with other pairs showing no synergistic effects, consistent with published results for similarly classed antibody pairs (Hansen et al., 2020).

    [0171] Finally, given the broad binding and neutralization activity of BG10-19 against a panel of SARS-COV-2 RBD substitutions (FIG. 7J, K), Applicants utilized a rVSV/SARS-COV-2 chimeric virus to determine spike variants that escape neutralization BG10-19 ((Weisblum et al., 2020) Methods). Initial attempts at selection experiments for BG10-19 showed no viral escape variants, consistent with observations for potently neutralizing convalescent plasma, antibody cocktails, and some monoclonal antibodies (Weisblum et al., 2020). However, after several passages, plaque purified viruses harboring the G339R and L441P mutations showed partial escape from BG10-19 (FIG. 7R). Thus, Applicants conclude that BG10-19's SARS-COV-2/SARS-CoV cross neutralization and ability to tolerate single RBD mutations within its epitope makes it an attractive therapeutic candidate as Applicants observe increasing point mutations among different SARS-COV-2 isolates (FIG. 10D). See, also, FIGS. 22, 23 and 27.

    [0172] Discussion Antibodies play an indispensable role in antiviral immune responses both through their ability to neutralize viruses via interactions with their Fabs (Corti and Lanzavecchia, 2013) and by engaging other components of the immune system through interactions with their Fc regions (Bournazos et al., 2020). Characteristic features of different viruses influence the dynamics of how antiviral B cell and antibody responses are generated. HIV-1, for example, constrains efficient antibody responses through narrow structural pathways to broad neutralization (Scheid et al., 2011) and by causing B cell exhaustion (Moir et al., 2008).

    [0173] In this study, Applicants show from a comprehensive in-depth analysis of SARS-COV-2 binding B cells from convalescent individuals 4-8 weeks post SARS-COV-2 infection that the repertoire of SARS-COV-2 binding B cells includes clonally expanded memory B cells and ABCs, as well as mature na?ve B cells that are mostly observed as singlets, IgM.sup.+ or IgD.sup.+ and non-mutated. Interestingly, Applicants found clonal cells to be present in TC0, which is enriched in IgM.sup.+ B cells with inferred somatic mutations and low expression of CD27. Despite showing clonal expansion and somatic mutations, antibodies produced from this cluster were mostly low binding and non-neutralizing. An important point to consider in this context is that the comparatively low affinity of these antibodies could potentially be overcome in vivo if expressed as pentamers in the presence of J chain, similar to the observation of increased neutralization of some IgA antibodies when expressed as dimers. Applicants speculate that this cluster might contain cells from an early extrafollicular B cell response as also observed in influenza infection (Lam and Baumgarth, 2019). On the other hand, high binding and potent neutralizing activity were mostly detected in antibodies isolated from ABCs and memory B cells that shared transcriptional phenotypes across different individuals.

    [0174] Immunologic correlates for protection from SARS-COV-2 after vaccination or prior exposure are not yet defined, but studies of other respiratory viruses suggest that serum neutralization could play an important role in protective immunity against SARS-COV-2 (Kulkarni et al., 2018; Verschoor et al., 2015). Consistent with other SARS-COV-2 studies, Applicants did not detect any intra-donor correlation between serum neutralization and the potency of monoclonal antibodies (Robbiani et al., 2020), but Applicants found a strong correlation between serum neutralization and the relative size of the ABC and memory B cell populations. This underscores the close relationship between high affinity memory B cell responses and serum antibody activity in SARS-COV-2. It is important to investigate if a similar correlation exists in individuals who have been vaccinated against SARS-COV-2 in an effort to delineate different responses to SARS-CoV-2 vaccines. Given its limited size, entry into the memory B cell compartment is tightly regulated by selection for high affinity of the immunoglobulin receptor (Victora and Nussenzweig, 2012). If neutralizing activity can also be selected for in the germinal center reaction is not known. Applicants did not find that to be the case, as both non-neutralizing high binders and neutralizers were found in TC3 and TC4 which are consistent with post germinal center B cells. This highlights the importance of integrating antibody structural and functional information in antiviral vaccine design, as neutralization cannot be independently selected for in the immune response (Chen et al., 2018).

    [0175] The structural analysis revealed new insights into commonalities and differences among RBD-specific monoclonal antibodies. For example, in common with potently neutralizing antibodies C144 (Barnes et al., 2020a) and S2M11 (Tortorici, 2020), BG10-19 bridges between adjacent RBDs to lock the S trimer into a closed, prefusion conformation. However, in contrast to most previously described antibodies, BG10-19 recognizes a conserved epitope within the RBD core that is accessible in up/down RBD conformations on the spike trimer of both SARS-COV-2 and SARS-COV (unlike the conserved, cryptic CR3022 epitope only accessible on up RBD conformations), which may allow design of immunogens that elicit cross-reactive protection against future emerging coronaviruses. BG10-19's unique binding/neutralization properties and resistance to all RBD mutations identified in circulating isolates with a frequency >0.01%, including those found within the B.1.1.7 and B.1.351 lineages, make this an ideal therapeutic candidate in the arsenal against SARS-COV-2.

    [0176] Additionally, high-resolution structures of VH3-53/VH3-66-class antibodies provided further understanding of the rules that govern potent neutralization and viral escape from this recurring antibody class and showed that CDRH3 length may not be a limitation to VH gene segment-mediated interactions at the RBD interface. Collectively, these structures and insights into the cellular processes behind the induction of potent, cross-reactive, neutralizing antibodies will not only aid in the battle to control the current COVID-19 pandemic through the use of safe and effective antibody treatments but will also provide additional criteria for the evaluation of humoral immune responses elicited from candidate vaccines against emerging zoonotic viruses with pandemic potential.

    Example 2-SARS/COV2/MERS Cross Binding Antibodies

    [0177] Applicants also identified antibodies that bind to SARS, COV2 and MERS (FIGS. 34-39 and Table 7). Applicants used Hash tags for cells specific to MERS, SARS and COV2 and sequenced the antibodies together (FIG. 34). When used as sorting bait all 6 proteins yielded differently expanded B cell clones (FIG. 35). There was considerable clonal overlap between B cells sorted with the 6 different proteins (FIG. 36). The majority of expanded clones were IgM+, but some expanded clones include class switched B cells (FIG. 37). Sorting with SARS/MERS/COV2 trimers selects for antibodies that bind outside of the RBD region of the spike protein (FIG. 38). Thus, the antibodies may be specific to non-mutated virus as most mutations occur in the RBD domain. Thus, the antibodies may be used for identifying immunogenic epitopes outside of the RBD domain. FIG. 39 shows staining with multiple coronavirus trimers for use in simultaneous staining.

    TABLE-US-00007 TABLE7 SARS/MERS/CoV2Antibodies(SEQIDNOS:369-446). Iso- VH Heavy CDR3 Light VK/VL CDR3 type Gene Chain HeavyChain Chain Gene LightChain Virus Name IGHGI IGHV4- IGHJ6 CARHWRDCSGGVC IGL IGLVI-40 IGLJ2, CQSYDGSL MERS LKA1 59 QASQYSSMDVW IGLJ3, SESAVF 2P IGLJ3 IGHGI IGHV4- IGHJ6 CARHWRDCTGGVC IGL IGLVI-40 IGLJ2, CHSYDGSL SARS LKA2 59 RASQYSSMDVW IGLJ3, SESAVF 2P IGLJ3 IGHA2 IGHV4- IGHJ6 CARHWRDCSGGVC IGL IGLVI-40 IGLJ2, CQSYDGSL SARS 59 RASQYSSMDVW IGLJ3, SESAVF 2P IGLJ3 IGHA2 IGHV4- IGHJ6 CARHWRDCSGGVC IGL IGLVI-40 IGLJ2, CQSYDGSL SARS 59 RASQYSSMDVW IGLJ3, SESAVF 2P IGLJ3 IGHA1 IGHV4- IGHJ6 CARHWRDCNRGVC IGL IGLVI-40 IGLJ2, CHSYDGTL SARS 59 RASQYSSMDVW IGLJ3, SESAVF 2P IGLJ3 IGHGI IGHV4- IGHJ6 CARHWRECSGGVC IGL IGLVI-40 IGLJ2, CQSYDGSL SARS 59 RASQYSSMDVW IGLJ3, SESAVF 2P IGLJ3 IGHGI IGHV4- IGHJ6 CARHWRDCNGGVC IGL IGLVI-40 IGLJ2, CQSYDGSL SARS 59 RASQYASMDVW IGLJ3, SESAVF 2P IGLJ3 IGHGI IGHV4- IGHJ6 CARHWRECSGGVC IGL IGLVI-40 IGLJ2, CQSYDGSL SARS 59 RTSQYSSMDVW IGLJ3, SESAVF 2P IGLJ3 IGHGI IGHV4- IGHJ6 CARHWRDCSGGVC IGL IGLVI-40 IGLJ3 CHSYDGSL COVID LKA3 59 RASQYSAMDVW SESAVF 2P IGHA1 IGHV3- IGHJ3 CAHVRPLTGYHVGH IGL GLVI-51 IGLJ2, CGTWDTSL MERS LKA4 30 DPFDIW IGLJ3, SIGVF 2P IGLJ3 IGHA1 IGHV3- IGHJ3 CAHVRPLTGYHVGH IGL IGLVI-51 IGLJ2, CGTWDTSL MERS 30 DPFDIW IGLJ3, RIGVF 2P IGLJ3 IGHA1 IGHV3- IGHJ3 CAHVRPLTGYHVGH IGL IGLVI-51 IGLJ3 CGTWDTSL SARS LKA5 30 DPFDIW SIGVF 2P IGHA1 IGHV3- IGHJ3 CAHVRPLTGYHVGH IGL IGLVI-51 IGLJ2, CGTWDTSL SARS 30 DPFDIW IGLJ3, SAGVF 2P IGLJ3 IGHA1 IGHV3- IGHJ3 CAHVRPLTGYHVGR IGL IGLVI-51 IGLJ2, CGTWDTSL SARS 30 DPFDIW IGLJ3, SAGVF 2P IGLJ3 IGHA1 IGHV3- IGHJ3 CAHVRPLTGYHVGR IGL IGLV3-1 IGLJ2, CQAWNN SARS 30 DPFDVW IGLJ3 NNVVF 2P IGHA1 IGHV4- IGHJ4 CARGFDYW IGK IGKV3- IGKJI CQQYGNS MERS LKA6 59 20 PWTF 2P IGHGI IGHV4- IGHJ4 CARGFDYW IGK IGKV3- IGKJI CLQYGGSG SARS LKA7 59 20 WTF 2P IGHGI IGHV4- IGHJ4 CARGFDYW IGK IGKV3- IGKJI CQQYGSSP SARS 59 20 WTF 2P IGHG3 IGHV4- IGHJ4 CARGFDYW IGK IGKV3- IGKJI CQQYGSSP SARS 59 20 WTF 2P IGHGI IGHV4- IGHJ4 CARGFDYW IGK IGKV3- IGKJI CHQYGSSP SARS 59 20 WTF 2P IGHGI IGHV4- IGHJ3 CARRIYGGDGFDIW IGL IGKV3- IGLJI CQVWHGT SARS LKA8 59 21 GDQYVF 2P IGHGI IGHV4- IGHJ3 CARRIYGGDGFDIW IGL IGKV3- IGLJI CQVWPGS SARS 59 21 SDHYVF 2P IGHGI IGHV4- IGHJ3 CARRIYGGDGFDIW IGL IGKV3- IGLJI CQVWHGT SARS 59 21 SDHYVF 2P IGHA1 IGHV3- IGHJ6 CARSRGGSYYYGM IGK IGKV1- IGKJ2, CQQSYSTL SARS LKA9 30 DVW 39 IGKJ2 ETF 2P IGHGI IGHV3- IGHJ6 CARSRGGSYYYGM IGK IGKV1- IGKJI CQHYNSFS SARS 30 DVW 5 PTWTF 2P IGHGI IGHV3- IGHJ6 CARAAGGGYYYGM IGL IGLV2- IGLJI CCSYAGGY SARS LKA10 30 DVW 23 VF 2P IGHGI IGHV3- IGHJ6 CARAAGGNYYYGM IGK IGKV1- IGKJ4 CQQSYGSP SARS 30 DVW 39 LTF 2P IGHA1 IGHV4- IGHJ3 CARSVAALTWELNK IGK IGKV3- IGKJI CQQYGSPT COVID LKA11 59 LAFDVW 20 WTF 2P IGHA1 IGHV4- IGHJ3 CARSVAALTWELNK IGK IGKV3- IGKJI CQQYGSPT COVID 59 LAFDVW 20 WTF RBD IGHA1 IGHV1- IGHJ4 CAQTTPYDSSGYYRS IGK IGKV3- IGKJ4 CQQRTNW MERS LKA12 69 YW 11 PPRLTF 2P IGHA1 IGHV1- IGHJ4 CAETTPYDSSGYYRS IGK IGKV3- IGKJ4 CQQRTNW SARS LKA13 69 YW 11 PPRLTF 2P IGHGI IGHVS- IGHJ4 CARWEAGGTSPLDY IGK IGKVI-5 IGKJ2 CQRYNSYS SARS LKA14 51 W QNTF 2P IGHGI IGHVS- IGHJ4 CARWEAGGTSPLDS IGK IGKVI-5 IGKJ2, CQQYSSYS SARS 51 W IGKJ2 QITF 2P IGHA1 IGHV3- IGHJ4 CARGYGDYYFDYW IGK IGKV3- IGKJ2, CQHFGSSP SARS LKA15 66 20 IGKJ2, LF 2P IGKJ2 IGHGI IGHV3- IGHJ4 CARAYGDYYFDYW IGK IGKV3- IGKJ2, CQQYRTF SARS 66 20 IGKJ2 2P IGHG3 IGHVS- IGHJ5 CARHPKGYGLRLPN IGL IGLV2- IGLJI CSSYTSSST SARS LKA16 51 WFDPW 14 FF 2P IGHG3 IGHVS- IGHJ5 CARHPKGYGLRLPN IGL IGLV2- IGLJI CSSYTTSST SARS 51 WFDPW 14 FF 2P IGHGI IGHV3- IGHJ4 CAKDLLPYRCSGGS IGL IGLVI- IGLJ2, CSAWDDS SARS LKA17 23 CFGLYFDYW 44 IGLJ3 LNGVVF 2P IGHM IGHV3- IGHJ4 CAKDLLPYRCSGGS IGL IGLVI- IGLJ2, CAAWDDS SARS 23 CFGFYFDYW 44 IGLJ3 LNGVVF 2P

    Example 3Methods

    [0178] Experimental model and subject details. All work with human samples was performed in accordance with approved Institutional Review Board protocols (IRB) which were reviewed by the IRB at Brigham and Women's Hospital, Boston. Subjects who had recovered from COVID-19 (Table 1) were recruited through a patient cohort that has been created in collaboration between The Broad Institute of MIT and Harvard, Cambridge (MA, USA) and Brigham and Women's Hospital, Boston (MA, USA) under IRB protocol 2020P000849, Biorepository for Samples from those at increased risk for or infected with SARS-COV-2. Blood draws were performed at Brigham and Women's Hospital.

    [0179] Serum RBD Enzyme-linked immunosorbent assay (ELISA). Serum ELISAs against SARS-COV-2 RBD were performed in a protocol modified from (Roy et al., 2020). MaxiSorp 384-well microplates (Sigma) were coated with 50 ?l/well of 2,500 ng/ml of SARS-COV-2 RBD in coating buffer (1 packet BupH carbonate-bicarbonate (ThermoFisher) in 500 ml of Milli-Q H20) overnight at 4? C. Plates were then washed 3 times with 100 ?l/well of wash buffer (0.05% Tween-20, 400 mM NaCl, and 50 mM Tris-HCl [pH 8.0] in Milli-Q H20) using a BioTek 406 plate washer. Plates were blocked by adding 100 ?l/well of blocking buffer (1% BSA, 140 mM NaCl, and 50 mM Tris-HCl (pH 8.0)) for 30 min at room temperature. Plates were then washed as described above. 50 ?l of 1:100 diluted serum samples in dilution buffer (1% BSA, 0.05% Tween-20, 140 mM NaCl, and 50 mM Tris-HCl (pH 8.0)) were added to the wells and incubated for 30 min at 37? C. Plates were then washed 7 times as described above. 50 ?l/well of 1:25,000 diluted detection antibody solution (HRP-anti human IgG and IgM, Bethyl Laboratory #A80-104P, A80-100P) was added to the wells and incubated for 30 min at room temperature. Plates were then washed 7 times as described above. 40 ?l/well of Pierce TMB peroxidase substrate (ThermoFisher) was then added to the wells and incubated at room temperature for 3 min (IgG) or 5 min (IgM). The reaction was then stopped by adding 40 ?l/well of stop solution (0.5M H2S04 in Milli-Q H20) to each well. The OD was read after 15 min at 450 nm and 570 nm on a BioTek Synergy HT. For control antibodies CR3022 (Tian et al., 2020) IgG1 and IgM (Absolute Antibody #Ab01680-10.0, Ab01680-15.0) dilution curves, the antibodies were diluted to a concentration of 1 ?g/ml in dilution buffer and duplicate 12 two-fold serial dilution curves were generated. One known positive and two known negative samples were included on each plate as controls.

    [0180] Serum ELISA analysis. A standard curve based on absorbances from the monoclonal antibody CR3022 (Tian et al., 2020) dilution series included with each plate was used to estimate antibody abundance in test samples and allow for comparison of results across batches. Estimated antibody abundance in test samples was compared to the background signal from a cohort of pre-pandemic serum samples that served as negative controls. Serum samples with antibody abundance greater than 3 standard deviations (SD) above the mean of the pre-pandemic serum samples were considered to be positive and samples with antibody abundance less than 3 SD above the mean of the pre-pandemic serum samples were considered negative.

    [0181] SARS-COV-2 and SARS-COV pseudovirus neutralization assay. Neutralizing activity against SARS-COV-2 pseudovirus was measured using a single-round infection assay in human ACE2-expressing target cells. Convalescent patient serum samples were tested against pseudotyped virus particles produced in 293T/17 cells (American Type Culture Collection) by co-transfection of plasmids encoding codon-optimized S (containing D at position 614) with a partially deleted cytoplasmic tail (provided by Dr. Dan Barouch, Beth Israel Deaconess Medical Center), and the HIV-1 backbone vector SG3 ? Env (NIH AIDS Reagent Program). This pseudovirus strain was used for infecting TZM.bl/ACE2 target cells which encode an integrated luciferase reporter gene under control of an HIV-1 LTR. Subsequently, a second pseudovirus assay platform was implemented and used for testing neutralizing activity of purified monoclonal antibodies. This assay platform utilized pseudovirus produced in 293T/17 cells by co-transfection of plasmids encoding codon-optimized SARS-COV-2 full-length S (containing G at position 614), packaging plasmid pCMV ?R8.2 expressing HIV-1 gag and pol, and luciferase reporter plasmid pHR CMV-Luc. Plasmids were kindly provided by Dr. Barney Graham (NIH, Vaccine Research Center). This pseudovirus strain was used for infecting 293/ACE2 target cells. The 293T and TZM.bl cell lines stably overexpressing the human ACE2 cell surface receptor protein were kindly provided by Drs. Michael Farzan and Huihui Ma (The Scripps Research Institute). For neutralization assays, serial dilutions of patient serum samples (primary 1:20 with 3-fold dilution series) or antibodies (up to 50 ?g/ml with 5-fold dilution series) were performed in duplicate followed by addition of pseudovirus. Plates were incubated for 1 hour at 37? C. followed by addition of 293T/ACE2 or TZM.bl/ACE2 target cells (1?10.sup.4/well). Wells containing cells+pseudovirus (without sample) or cells alone acted as positive and negative infection controls, respectively. Assays were harvested on either day 2 (TZM.bl/ACE2 target cells) or day 3 (293/ACE2 target cells) using Promega Bright-Glo luciferase reagent and luminescence detected with a Perkin-Elmer Victor luminometer. Titers were determined as the serum dilution or antibody concentration that inhibited 50% or 80% virus infection (serum ID.sub.50/ID.sub.80 or antibody IC.sub.50/IC.sub.80 titers, respectively).

    [0182] Similarly, neutralizing activity of monoclonal antibodies against SARS-COV pseudovirus as well as SARS-COV-2 variants B.1.1.7 and B.1.351 was determined using HIV-based lentiviral particles pseudotyped with either SARS-COV S lacking the C-terminal 21 amino acids of the cytoplasmic tail or SARS-COV-2 S (containing G at position 614) carrying the reported spike mutations in B.1.1.7 and B.1.351 (Tegally et al., 2020) (Davies et al., 2021). Pseudotyped particles were generated and neutralization assays were performed as previously described (Crawford et al., 2020a) (Crawford et al., 2020b). Briefly, the genes encoding the respective spike proteins were co-transfected with Env-deficient HIV backbone to create pseudotyped lentiviral particles. For neutralization assays, 4- or 5-fold serially diluted purified IgG was incubated with SARS-COV pseudotyped virus for 1 hour at 37? C. The virus/antibody mixture was added to 293TACE2 target cells and incubated for 48 hours at 37? C., then cells were lysed and luciferase activity was measured using Britelite Plus (Perkin Elmer). Relative luminescence units (RLUs) were normalized to values derived from cells infected with pseudotyped virus in the absence of antibody. Data were fit to a 5-parameter nonlinear regression in AntibodyDatabase (West et al., 2013).

    [0183] Blood sample processing. 60-80 ml of blood from each donor were processed using Ficoll Paque Plus (GE Healthcare) in order to isolate peripheral blood mononuclear cells (PBMCs) according to the manufacturer's instructions. After PBMC isolation Applicants immediately proceeded with isolation of CD20 B cells using magnetic cell separation (MACS). In brief, cells were resuspended in MACS buffer (phosphate buffered saline (PBS) pH 7.2, 0.5% bovine serum albumin (BSA) and 2 mM EDTA) and stained with mouse anti-human CD20 IgG1 antibody coupled to magnetic beads (Miltenyi Biotec, #130-091-104). After washing and resuspending in MACS buffer cells were added to LS columns (Miltenyi Biotec) placed on a magnetic stand and the columns washed 3 times with 3 ml MACS buffer before removing the columns from the magnet and elution of cells according to the manufacturer's instructions. Cells were then washed and resuspended in Cell Staining Buffer (Biolegend, #420201).

    [0184] Cell staining and sorting. CD20 enriched cells were stained with DNA-barcoded Totalseq C antibodies (Biolegend) according to the manufacturer's instructions. In brief, cells underwent Fc receptor blocking with Human TruStain FcX? Fc (Biolegend) for 10 minutes at 4? C., after which cells were washed and resuspended in Cell Staining Buffer (Biolegend, #420201). Cells from different subjects were then stained with different Totalseq C antibodies (Biolegend): 1 (TotalSeq?-C0251 anti-human Hashtag 1 Antibody), 2 (TotalSeq?-C0252 anti-human Hashtag 2 Antibody), 3 (TotalSeq?-C0253 anti-human Hashtag 3 Antibody), 4 (TotalSeq?-C0254 anti-human Hashtag 4 Antibody), 6 (TotalSeq?-C0256 anti-human Hashtag 6 Antibody), 7 (TotalSeq?-C0257 anti-human Hashtag 7 Antibody), 8 (TotalSeq?-C0258 anti-human Hashtag 8 Antibody), 10 (TotalSeq?-C0260 anti-human Hashtag 10 Antibody). After staining with hashing antibodies, cells were washed 3 times in Cell Staining Buffer (Biolegend, #420201) and then up to 7 separate samples were combined for staining of antigen binding B cells. For this, the combined samples were stained with either 1 ?g/ml biotinylated SARS-COV-2 spike trimer or 1 ?g/ml biotinylated SARS-COV-2 RBD (See below for protein expression; biotinylation was performed using avitag technology (Avidity) following the manufacturer's instructions). Cells were simultaneously stained with FITC mouse anti-human CD19 antibody (BD, 340864) and incubated for 20 minutes at 4? C. before they were washed and resuspended in PBS with 5% fetal bovine serum (FBS). Cells were then stained with streptavidin-coupled APC (Biolegend #405207) for 5 minutes at 4? C. and washed and resuspended in PBS with 5% FBS. Antigen binding B cells were then sorted using a Sony MA900 cell sorter by gating on live cells in the forward scatter and side scatter (FIGS. 1A and 1B) and on CD19-FITC and SARS-COV-2 S-APC or RBD-APC double-positive cells. After sorting, cells were washed and counted using a hemocytometer and microscopy, before resuspending up to 10,000 cells in a volume of 32 ?l for 5 single cell RNA-Seq (see below).

    [0185] 5 scRNA-seq library generation. Cells were separated into droplet emulsions using the Chromium Next GEM Single-cell 5 Solution (v1.1) and the 10? Chromium Controller. 5,000-10,000 cells were loaded per channel of the Chromium Next GEM single-cell 5 (v1.1) Chip G. Following lysis of cells, barcoded mRNA reverse transcription, and cDNA amplification, a 0.6? SPRI cleanup was performed and the supernatant was set aside for Feature Barcoding library construction as instructed by the Chromium NextGEM single-cell V(D)J v1.1 protocol. A final elution of 45 ?L was saved for further construction of libraries. Using the saved supernatant of the 0.6? cDNA cleanup, Feature Barcoding libraries were completed according to the 5 Next GEM (v1.1) Feature Barcoding library construction methods provided by 10? Genomics. Gene expression and V(D)J libraries were created according to manufacturer's instruction (10? Genomics), which includes enzymatic fragmentation, adaptor ligation, and sample index barcoding steps. The V(D)J libraries were created from the original cDNA after it was enriched for human B cells, following the Chromium NextGEM single-cell V(D)J v1.1 protocol.

    [0186] sc RNA-seq library sequencing. Gene expression, feature barcoding libraries, and BCR enriched V(D)J libraries were sequenced on a Nextseq500 (Illumina) using a high output 150 cycle flowcell, with the read configuration Read 1: 28 cycles, Read 2: 96 cycles, Index read 1: 8 cycles or sequenced on a HiSeq X (Illumina), using a 150 cycle flowcell with the read configuration: Read 1: 28 cycles, Read 2: 96 cycles, Index read 1: 8 cycles. Feature Barcoding libraries were spiked into the gene expression libraries (at 10-20% of the sample pool) prior to sequencing. All BCR enriched V(D)J libraries were pooled together and sequenced on a NextSeq500 (Illumina) using the same parameters as previously mentioned.

    [0187] Antibody production. Antibody VDJ heavy chain and VJ light chain sequences of selected antibodies were produced as minigenes and cloned into IgG1 heavy chain, IgA1 heavy chain, IgA2 heavy chain, kappa light chain or lambda light chain expression vectors as previously described (Wardemann et al., 2003) (Wang et al., 2020b). After cloning into expression vectors, matching antibody heavy chain and light chain plasmids were co-transfected into Expi293F cells following the manufacturer's instructions. In brief, heavy chain plasmid DNA and light chain plasmid DNA were diluted in 1.5 ml Opti-Plex Complexation Buffer (Invitrogen) before mixing with 80 ?l ExpiFectamine 293 Reagent (Invitrogen) diluted in 1.4 ml Opti-Plex Complexation Buffer (Invitrogen). For dimeric IgA production equal amounts of heavy chain plasmid DNA, light chain plasmid DNA and J chain plasmid DNA were used in the transfection. Mixture was incubated for 15 minutes at room temperature before adding to 25 ml of Expi293F cells at a density of 3.0?10.sup.6 viable cells/ml and incubation in a shaker incubator according to the manufacturer's instructions. ExpiFectamine 293 Transfection Enhancer 1 and 2 (150 ?l and 1.5 ml, respectively) were added 18 hours post-transfection. Antibody containing supernatants were harvested after 7 days by centrifugation of cells at 3,000g for 20 minutes and transfer of supernatants into 50 ml falcon tubes (Fisher Scientific). Prior to size exclusion chromatography (see below) IgA dimers were purified from transfection supernatants using peptide M coupled agarose beads (Invivogen) according to the manufacturer's instructions.

    [0188] IgA dimer purification through size exclusion chromatography. A pre-packed HiLoad? 16/600 Superdex? 200 pg (Cytiva, #28-9893-35) column on the Cytiva ?KTA pure Chromatography System was equilibrated with PBS. After equilibration of the column with PBS each IgA preparation was applied onto the column and the column was run at a flow rate of 1.25 ml/min. The total column volume was 120 ml. Fractions were collected in a volume of 1.5 ml per fraction. Peaks consistent with IgA multimers, IgA dimers and IgA monomers were detected at 0.3-0.4, 0.4-0.5 and 0.5-0.6 column volumes respectively (FIG. 9J). Fractions spanning all three peaks were collected and evaluated individually by running Criterion? TGX? precast gels (Biorad 5671095) under non-reducing conditions with a Precision Plus Protein? Kaleidoscope? Prestained Protein Standard (Biorad #1610375) (FIG. 9K).

    [0189] Antibody ELISA testing. Antibody concentrations were determined measuring absorbance at 280 nm using Nanodrop 2000c (Thermo Scientific) or IgG specific ELISA as previously described (Tiller et al., 2008). Antibody reactivities to SARS-COV-2 S, SARS-COV-2 RBD, SARS-COV S, SARS-COV RBD, MERS-COV S and MERS-COV RBD were determined using the same protocol with the following modifications: Antigens were coated on Corning? Costar? Brand 96-Well EIA/RIA Plates at a concentration of 5 ?g/ml. Antibody binding was then assessed at starting concentrations of 1 ?g/ml, 1.1 ?g/ml and 1.2 ?g/ml for IgG, monomeric IgA and dimeric IgA respectively in order to achieve equal Fab molar concentrations. 3 consecutive 1/4 dilutions were performed. Positive control antibodies used in these assays included antibodies BG10-19 for SARS-COV-2 S and SARS-COV-2 RBD (see above), 3B12 (Absolute Antibody #Ab01673-10.0) for MERS-COV S and MERS-COV RBD (Tang et al., 2014) and S227.14 (Absolute Antibody Ab00263-10.0) for SARS COV S and SARS COV RBD (Rockx et al., 2008). Antigen specific ELISA results are expressed as AUC using Graphpad PRISM software. Polyreactivity ELISAs were performed as previously described (Tiller et al., 2008) with the following modification: In addition to the antigens ssDNA, dsDNA, LPS and insulin (Tiller et al., 2008), streptavidin-coupled APC (Biolegend #405207) was used as a fifth antigen in order to assess potential off target binding against this reagent used for cell sorting (see above). As described previously (Tiller et al., 2008), polyreactivity is defined as reactivity to 2 or more antigens among the antigens single stranded DNA, double stranded DNA, lipopolysaccharide (LPS) or insulin. As previously described, antibodies ED38, JB40 and mGO53 (Wardemann et al., 2003) were used as strongly polyreactive, intermediately polyreactive and non-polyreactive control antibodies respectively. In ELISA assays including IgG, IgA monomers and IgA dimers, HRP-conjugated goat anti-human kappa and lambda chain antibodies (Biorad #STAR127P and #STAR129P) were used as secondary antibodies at a 1/5000 dilution.

    [0190] Off-target antibody binding to baculovirus (BV) particles generated in Sf9 insect cells was tested as previously described (Hotzel et al., 2012). A solution of 1% baculovirus in 100 mM sodium bicarbonate buffer pH 9.6 was adsorbed to a 384-well ELISA plate (Nunc Maxisorp) using a Tecan Freedom Evo2 liquid handling robot and the plate was incubated overnight at 4? C. Following blocking with 0.5% BSA in PBS, 1 ?g/ml of IgG was added to the blocked assay. Plates were incubated for 3 hours at room temperature. Antibody binding was detected using an HRP-conjugated anti-Human IgG (H&L) secondary antibody (Genscript). ELISA was developed using SuperSignal ELISA Femto Maximum Sensitivity Substrate (Thermo Scientific). Anti-HIV antibodies NIH45-46 (Scheid et al., 2011) and 45-46m2 (Diskin et al., 2013) were used as positive controls and antibody 3BNC117 (Scheid et al., 2011) was used as negative control. Measurements were performed in quadruplicate and OD values within 1.5-fold the negative control were considered to be negative.

    [0191] Neutralization activity of antibodies against authentic SARS-COV-2. Vero E6-TMPRSS2 were seeded at 10,000 per well the day prior to infection in CellCarrier-384 ultra microplate (Perkin Elmer). Monoclonal antibody samples were tested in 4-fold 9-point dilution spots starting at a highest concentration of 100 ?g/mL. Serial diluted antibodies were mixed separately with diluted SARS-COV-2 virus and incubated at 37 C with 5% CO.sub.2 for 1 hour. Antibody-virus complexes were added to the cells in triplicate. Plates were incubated at 37 C with 5% CO.sub.2 for 48 hours. After that, plates were fixed and inactivated using 4% paraformaldehyde in PBS for 2 hours at room temperature. Plates were then washed and incubated with diluted anti-SARS-COV/SARS-COV-2 nucleoprotein mouse antibody (Sino) for 1.5 hours at room temperature. Plates were subsequently incubated with Alexa488-conjugated goat anti-mouse (JacksonImmuno) for 45 mins at room temperature, followed by nuclear staining with Hoechst 33342 (ThermoFisher). The fluorescence images were recorded and analyzed using Opera Phenix? High Content Screening System. The half-maximal inhibitory concentrations (I.sub.50) were determined using four parameters logistic regression (GraphPad Prism 8.0).

    [0192] Protein expression and purification. Expression and purification of SARS-COV-2 6P stabilized S trimers (Hsieh et al., 2020) and constructs encoding the sarbecovirus RBDs were conducted as previously described (Cohen et al., 2020). Briefly, constructs were purified from supernatants of transiently transfected Expi293F cells (Gibco) by Ni2.sup.+-NTA affinity and size exclusion chromatography (SEC). Peak fractions were identified by SDS-PAGE, pooled, and stored at 4? C. IgGs were expressed, purified, and stored as described (Barnes et al., 2020b). Fabs were generated by papain digestion using crystallized papain (Sigma-Aldrich) in 50 mM sodium phosphate, 2 mM EDTA, 10 mM L-cysteine, pH 7.4 for 30-60 min at 37? C. at a 1:100 enzyme:IgG ratio. To remove undigested IgGs and Fc fragments, digested products were applied to a 1-mL HiTrap MabSelect SuRe column (GE Healthcare Life Sciences) and the flow-through containing cleaved Fabs was collected. Fabs were further purified by SEC using a Superdex 200 Increase 10/300 column (GE Healthcare Life Sciences) in TBS before concentrating and storage at 4? C.

    [0193] Cryo-EM sample preparation. Purified Fab and S 6P trimer were incubated at a 1.1:1 molar ratio per protomer on ice for 30 minutes prior to deposition on a freshly glow-discharged 300 mesh, 1.2/1.3 UltrAuFoil grid. Immediately before 3 ?l of complex was applied to the grid, fluorinated octyl-malotiside was added to the Fab-S complex to a final detergent concentration of 0.02% w/v, resulting in a final complex concentration of 3 mg/ml. Samples were vitrified in 100% liquid ethane using a Mark IV Vitrobot after blotting for 3 s with Whatman No. 1 filter paper at 22? C. and 100% humidity.

    [0194] Cryo-EM data collection and processing. Data collection and processing followed a similar workflow to what has been previously described in detail (Barnes et al., 2020a). Briefly, micrographs were collected on a Talos Arctica transmission electron microscope (Thermo Fisher) operating at 200 kV for all Fab-S complexes. Data were collected using SerialEM automated data collection software (Mastronarde, 2005) and movies were recorded with K3 camera (Gatan). Data collections parameters are summarized in Table 5. For all data sets, cryo-EM movies were patch motion corrected for beam-induced motion including dose-weighting within cryoSPARC v2.15 (Punjani et al., 2017) after binning super resolution movies. The non-dose-weighted images were used to estimate CTF parameters using cryoSPARC implementation of the Patch CTF job. Processing for all datasets was carried out in a similar fashion. Briefly, an initial set of particles was picked based on templates from 2D classification of blob picked particles on a small sub-set of images. This set was pared down through several rounds of 3D classification. An ab initio job on a small good subset of these particles revealed distinct states and junk particles. Full set of particles was heterogeneously refined against distinct states, as well as a junk class acting as a trap for bad particles. Particles from each were separately refined using non-uniform refinement in C1 symmetry. Particles from distinct states were re-extracted without binning and were further refined separately in several rounds of 3D classification. Particles were subdivided into groups based on beam-tilt, refined separately for CTF parameters and aberration correction. For all states, a soft mask (3-pixel extension, 6-pixel soft edge) was generated for the S1 subunits and Fab variable domains. The resolution at the Fab interface was modestly improved, with overall reported resolutions reported based on gold standard FSC calculations.

    [0195] Cryo-EM Structure Modeling and Refinement. Coordinates for initial complexes were generated by docking individual chains from reference structures into cryo-EM density using UCSF Chimera (Goddard et al., 2018) (see Table 5 for PDB coordinates). Models were then refined into cryo-EM maps rigid body and real space refinement with morphing in Phenix (Terwilliger et al., 2018). Sequence-updated models were built manually in Coot (Emsley et al., 2010) and then refined using iterative rounds of real-space refinement in Phenix and Coot. Glycans were modeled at potential N-linked glycosylation sites (PNGSs) in Coot using blurred maps processed with a variety of B-factors generated in cryoSPARC v2.15. Validation of model coordinates was performed using MolProbity (Chen et al., 2010) (Table 5).

    [0196] BG4-25-RBD X-ray crystallography experiments. Crystallization trials for a stoichiometric complex of BG4-25-SARS-COV2 RBD-CR3022 were carried out at room temperature using the sitting drop vapor diffusion method by mixing equal volumes of the Fab-RBD complex and reservoir using a TTP LabTech Mosquito robot and commercially-available screens (Hampton Research). Crystals were obtained in 0.05 M Citric acid, 0.05 M BIS-TRIS propane pH 5.0 and 16% polyethylene glycol 3350 and quickly cryo-protected in a solution matching the reservoir+20% glycerol. X-ray diffraction data were collected for Fab-RBD complex at the Stanford Synchrotron Radiation Lightsource (SSRL) beamline 12-2 on a Pilatus 6M pixel detector (Dectris). Data from a single crystal were indexed and integrated in XDS (Kabsch, 2010) and merged using AIMLESS in CCP4 (Winn et al., 2011) (Table 6). The Fab-RBD complex structure was determined by molecular replacement in PHASER (McCoy et al., 2007) using Fab and RBD coordinates from individual components of PDB 6XC3 (CC12.1 Fab-CR3022 Fab-SARS-COV2 RBD) as search models after trimming heavy chain and light chain CDR loops for CC12.1 Fab. Coordinates were refined using rigid body and B-group refinement in Phenix (Adams et al., 2010) followed by cycles of manual building in Coot (Emsley et al., 2010) (Table 6).

    [0197] Structural Analyses. CDR lengths and Kabot numbering were calculated based on IMGT definitions (Lefranc et al., 2015). Structure figures were made with UCSF ChimeraX. Local resolution maps were calculated using cryoSPARC v 2.15. Buried surface areas were calculated using PDBePISA (Krissinel and Henrick, 2007) and a 1.4 ? probe. Potential hydrogen bonds were assigned as interactions that were <4.0 ? and with A-D-H angle >90?. Potential van der Waals interactions between atoms were assigned as interactions that were <4.0 ?. Hydrogen bond and van der Waals interaction assignments are tentative due to resolution limitations.

    [0198] Surface Plasmon Resonance (SPR) binding experiments. SPR experiments were performed using a Biacore T200 instrument (GE Healthcare). ACE2 microbody (Tada et al., 2020) was immobilized on a CM5 chip by primary amine chemistry at pH 4.5 to a final response level of ?1000 resonance units (RUS). Fabs were complexed with 100 nM SARS2 S 6P or SARS2 RBD at a 10:1 molar ratio and incubated for a minimum of 1 hour. Antigen or Fab-antigen complex was injected over immobilized ACE2 microbody surface at a flow rate of 30 ?L/min for a contact time of 300 seconds. Sensorgrams were buffer corrected using an injection of 0.01 M HEPES pH 7.4, 0.15 M NaCl, 3 mM EDTA, 0.005% v/v surfactant P20 buffer.

    [0199] SARS-COV-2 mutant RBD and sarbecovirus RBD ELISA binding assay. Binding of Fabs to SARS-COV-2 RBDs containing single mutations or to sarbecovirus RBDs was evaluated by ELISA. RBD antigens (mutant or wild-type) were adsorbed to 384-well Nunc MaxiSorp plates (Sigma) at a concentration of 2 ?g/mL overnight. Plates were blocked with 3% BSA in TBS-T (TBS with 0.05% Tween20) for 1 h at room temperature, then 5-fold serial dilutions starting at 10 ?g/mL of Fab were added. Plates were washed with TBS-T and bound Fab was detected using an HRP-conjugated secondary Ab (Genscript) and SuperSignal ELISA Femto Substrate (Thermo Scientific). AUC for each Fab-antigen pair was calculated using Graphpad PRISM software. Fold decrease in AUC was calculated relative to SARS-COV2 RBD AUC for the same Fab. Data shown are representative of two independent experiments.

    [0200] SARS-COV-2 mutant pseudotyped reporter virus and mutant pseudotyped virus neutralization assay. SARS-COV-2 pseudotyped particles were generated as previously described (Robbiani et al., 2020; Schmidt et al., 2020). Briefly, 293T cells were transfected with pNL4-3 Env-nanoluc and pSARS-COV-2-S.sub.?19. For generation of RBD-mutant pseudoviruses, pSARS-CoV-2-S.sub.?19 carrying indicated spike mutations was used instead. Particles were harvested 48 hpt, filtered and stored at ?80? C.

    [0201] Fourfold serially diluted monoclonal antibodies were incubated with SARS-COV-2 pseudotyped virus for 1 h at 37? C. The mixture was subsequently incubated with HT1080.sub.Ace2 cl14 cells (Schmidt et al., 2020) for 48 h after which cells were washed with PBS and lysed with Luciferase Cell Culture Lysis 5? reagent (Promega). Nanoluc Luciferase activity in lysates was measured using the Nano-Glo Luciferase Assay System (Promega) with the Glomax Navigator (Promega). The obtained relative luminescence units were normalized to those derived from cells infected with SARS-COV-2 pseudotyped virus in the absence of monoclonal antibodies. The half-maximal and 90% inhibitory concentrations (IC50 and IC90) were determined using four-parameter nonlinear regression (least squares regression method without weighting; constraints: top=1, bottom=0) (GraphPad Prism).

    [0202] Antibody resistance selection experiments. 293T/ACE2.cl22 (Schmidt et al., 2020) were cultured in Dulbecco's Modified Eagle Medium (DMEM) supplemented with 10% fetal bovine serum (FBS) at 37? C. and 5% CO.sub.2. Cells have been tested negative for contamination with mycoplasma. rVSV/SARS-COV-2/GFP chimeric virus stocks were generated by infecting 293T/ACE2.cl22 cells. Supernatant was harvested 1 day post infection (dpi), cleared from cellular debris, aliquoted and stored at ?80? C. Two plaque purified variants designated rVSV/SARS-COV-2/GFP1D7 and rVSV/SARS-COV-2/GFP2E1 that encode F157S/R685M (1D7) and D215G/R683G (2E1) substitutions were used in these studies (Schmidt et al., 2020). For BG10-19 selection experiments, the virus was passaged multiple times in the presence of 1 ?g/ml or 5 ?g/ml antibody. At passage 4, virus was allowed to replicate in the presence of antibodies until all the cells were infected then harvested. The virus was then passaged in the presence of antibodies for a fifth and final time before supernatant was harvested for further analysis. To isolate individual mutants, the supernatants of passage 5 were serially diluted and individual viral foci were isolated by limiting dilution in 96-well plates.

    [0203] For the identification of putative antibody resistance mutations, RNA was isolated from aliquots of supernatant containing selected viral populations and isolates using NucleoSpin 96 Virus Core Kit (Macherey-Nagel). The purified RNA was subjected to reverse transcription using SuperScript VILO cDNA Synthesis Kit (Thermo Fisher Scientific). The cDNA was amplified using KOD Xtreme Hot Start DNA Polymerase (Millipore Sigma) and primers flanking the entire S-encoding sequence. The PCR products were purified and sequenced using Sanger-sequencing.

    [0204] To measure neutralizing activity, 40 ?g/ml antibody was five-fold serially diluted in 96-well plates over 7 dilutions. Thereafter, approximately 5?10.sup.4 infectious units of rVSV/SARS-CoV-2/GFP WT or mutant isolates were mixed with BG10-19 at a 1:1 ratio and incubated for 1 hr at 37? C. in a 96-well plate. The mixture was then added to 293T/ACE2.cl22 target cells plated at 1?10.sup.4 cells/well in 100 ?l medium in 96-well plates the previous day. Thus, the final starting dilution was 10 ?g/ml. Cells were then cultured for 16 hr, then harvested for flow cytometry.

    [0205] scRNA-seq analysis. mRNA and VDJ sequence reads were mapped to the reference human genome GRCh38-3.0.0 with the cloud-based Cumulus workflows (Li et al., 2020), using the CellRanger 3.0.2 software pipeline. Cells with both high-quality VDJ sequence and transcriptome information were kept for the downstream analysis by filtering out the cells which had less than 300 detected genes or which had poor quality VDJ contig information defined by i) being non-productive by 10? standards, ii) having more than four productive VDJ contigs, iii) having less than three filtered UMIs. For the transcriptome analysis, batch effects were removed with the ComBat algorithm (Johnson et al., 2007) implemented in SVA R Package version 3.38.0. For the transcriptome mRNA count normalization, dimensionality reduction, clustering, cell cycle scoring, cluster marker genes detection and differential gene expression analysis steps Seurat R package (Butler et al., 2018) (Stuart et al., 2019) was employed. For the normalization step gene expression counts for each cell were divided by the total counts for that cell and multiplied by 1e6, which was then log-transformed using log1p. Dimensionality reduction was done by PCA with selecting 50 first principal components.

    [0206] For clustering of the cells into transcriptome clusters, first the k-nearest neighbor (kNN) graph of the cells was constructed. Second, this kNN graph was used to generate the shared nearest neighbor (sNN) graph by calculating Jaccard index between every cell and its k nearest neighbors. Third, the leiden algorithm (Traag et al., 2019) was used to find the clusters of the cells based on the generated sNN graph.

    [0207] Cell cycle scoring was done by calculating the module scores of the cell cycle genes defined in (Tirosh et al., 2016). Positive cluster marker genes and differentially expressed genes were detected with a log-fold change threshold of 0.25, where only the genes that were detected in a minimum fraction of 20% in either of the six transcriptome populations were considered. Expression levels of immunoglobulin genes were discarded during the clustering and differential gene expression analysis steps.

    [0208] Antibody Repertoire Analysis. 10?V(D)J contig assembly algorithm takes many forms of noise specific to scRNA-seq data into account while generating the assembled V(D)J sequences (support. 10?genomics.com/single-cell-vdj/software/pipelines/latest/algorithms/assembly). Nevertheless, only the cells with high-quality V(D)J contig sequences were selected and V(D)J gene annotations were assigned by using IGBLAST (version 1.14.0) software with the Change-O R package (Gupta et al., 2015). Donor specific B cell clones were identified by the Change-O R package (Gupta et al., 2015), where the appropriate threshold for trimming the hierarchical clustering into B cell clones was found by inspecting the bimodal distribution of the distance between each sequence in the data and its nearest-neighbor.

    [0209] Mutation inference based on the scRNA-seq VDJ sequences of the donor and the control cells (Rubelt et al., 2012) was performed by the Shazam R Package (Yaari et al., 2012) where the region definition parameter was set to be IMGT_V_BY_SEGMENTS which provides no subdivisons and treats the entire V segment as a single region.

    [0210] CDRH3 length was defined based on IMGT definition (Lefranc et al., 2015) with the addition of two conserved amino acid residues that were added to assist in clonal analysis (Nouri and Kleinstein, 2018). This addition was corrected for all analyses involving specific CDRH3 length, such as selection of VH3-53/3-66 antibodies with CDRH3 shorter than 14 amino acid length.

    [0211] CDRH3 amino acid charges were calculated by the Alakazam R package (Gupta et al., 2015) using the method of Moore (Moore, 1985) excluding the N-terminus and C-terminus charges, and normalizing by the number of informative positions.

    [0212] Hydrophobicity scores were calculated with the Alakazam R package using the method of Kyte and Doolittle (Kyte and Doolittle, 1982).

    [0213] Shannon entropy values were calculated using Alakazam R package. For each donor the transcriptome cluster specific Hill diversity index, proposed in (Hill, 1973), improved by (Chao et al., 2014; Chao et al., 2015) was calculated by setting the diversity order equal to 1 with Alakazam R package. For each run the number of bootstrap realizations is set to be 400, and the minimum number of observations to sample is set to be 10.

    [0214] Mutational analysis of VH3-53/3-66 antibodies. Inferred somatic mutations in the V gene segment of VH3-53/VH3-66 antibodies were counted for the IgG.sup.+ antibodies with CDRH3 lengths less than 14 amino acids from SARS-COV-2 binding B cells across 14 subjects, listing only those sites where the frequency was >10% in either the IgG.sup.+ set or in the repertoire comparison. The repertoire comparison set of human VH3-53/VH3-66 sequences was taken from the sequence read archive of (Rubelt et al., 2012).

    [0215] Table 8A-8B. The Table lists the nucleotide sequence (SEQ ID NOS: 447-12672), the bait that was used to sort the respective cell and the sequence name. The sequence name includes the donor (e.g., BG1, BG10) and whether the sequence is a light chain or heavy chain (e.g., LC, HC). The nucleotide sequences can be converted to amino acid sequence by one skilled in the art. 8A. Full list of nucleotide sequences for heavy and light chains identified in B cells bound to bait proteins from the 14 donors. 8B. For patients BG1, BG4, BG7 and BG10 there is an additional column that shows the antibody names for the antibodies produced from the nucleotide sequences in that line.

    TABLE-US-00008 TABLE8A SEQ IDNO BAIT SEQUENCENAME 447 RBD BG1NUC-HC1 448 2F BG1NUC-HC2 449 RBD BG1NUC-HC3 450 2F BG1NUC-HC4 451 RBD BG1NUC-HC5 452 2F BG1NUC-HC6 453 RBD BG1NUC-HC7 454 RBD BG1NUC-HC8 455 RBD BG1NUC-HC9 456 RBD BG1NUC-HC10 457 RBD BG1NUC-HC11 458 2F BG1NUC-HC12 459 RBD BG1NUC-HC13 460 RBD BG1NUC-HC14 461 RBD BG1NUC-HC15 462 RBD BG1NUC-HC16 463 RBD BG1NUC-HC17 464 2P BG1NUC-HC18 465 2P BG1NUC-HC19 466 RBD BG1NUC-HC20 467 2P BG1NUC-HC21 468 2P BG1NUC-HC22 469 2P BG1NUC-HC23 470 2P BG1NUC-HC24 471 RBD BG1NUC-HC25 472 2P BG1NUC-HC26 473 RBD BG1NUC-HC27 474 2P BG1NUC-HC28 475 RBD BG1NUC-HC29 476 2P BG1NUC-HC30 477 RBD BG1NUC-HC31 478 RBD BG1NUC-HC32 479 2P BG1NUC-HC33 480 2P BG1NUC-HC34 481 RBD BG1NUC-HC35 482 2P BG1NUC-HC36 483 RBD BG1NUC-HC37 484 RBD BG1NUC-HC38 485 2P BG1NUC-HC39 486 RBD BG1NUC-HC40 487 RBD BG1NUC-HC41 488 2P BG1NUC-HC42 489 2P BG1NUC-HC43 490 RBD BG1NUC-HC44 491 RBD BG1NUC-HC45 492 RBD BG1NUC-HC46 493 2P BG1NUC-HC47 494 RBD BG1NUC-HC48 495 RBD BG1NUC-HC49 496 RBD BG1NUC-HC50 497 2P BG1NUC-HC51 498 2P BG1NUC-HC52 499 RBD BG1NUC-HC53 500 2P BG1NUC-HC54 501 2P BG1NUC-HC55 502 RBD BG1NUC-HC56 503 2P BG1NUC-HC57 504 2P BG1NUC-HC58 505 2P BG1NUC-HC59 506 RBD BG1NUC-HC60 507 RBD BG1NUC-HC61 508 RBD BG1NUC-HC62 509 2P BG1NUC-HC63 510 2P BG1NUC-HC64 511 2P BG1NUC-HC65 512 2P BG1NUC-HC66 513 RBD BG1NUC-HC67 514 RBD BG1NUC-HC68 515 2P BG1NUC-HC69 516 2P BG1NUC-HC70 517 2P BG1NUC-HC71 518 RBD BG1NUC-HC72 519 RBD BG1NUC-HC73 520 RBD BG1NUC-HC74 521 2P BG1NUC-HC75 522 RBD BG1NUC-HC76 523 2P BG1NUC-HC77 524 2P BG1NUC-HC78 525 2P BG1NUC-HC79 526 RBD BG1NUC-HC80 527 RBD BG1NUC-HC81 528 2P BG1NUC-HC82 529 RBD BG1NUC-HC83 530 2P BG1NUC-HC84 531 2P BG1NUC-HC85 532 2P BG1NUC-HC86 533 RBD BG1NUC-HC87 534 2P BG1NUC-HC88 535 RBD BG1NUC-HC89 536 RBD BG1NUC-HC90 537 RBD BG1NUC-HC91 538 RBD BG1NUC-HC92 539 RBD BG1NUC-HC93 540 RBD BG1NUC-HC94 541 RBD BG1NUC-HC95 542 RBD BG1NUC-HC96 543 2P BG1NUC-HC97 544 2P BG1NUC-HC98 545 2P BG1NUC-HC99 546 RBD BG1NUC-HC100 547 2P BG1NUC-HC101 548 RBD BG1NUC-HC102 549 2P BG1NUC-HC103 550 2P BG1NUC-HC104 551 2F BG1NUC-HC105 552 2P BG1NUC-HC106 553 RBD BG1NUC-HC107 554 RBD BG1NUC-HC108 555 2P BG1NUC-HC109 556 2P BG1NUC-HC110 557 2P BG1NUC-HC111 558 2P BG1NUC-HC112 559 2P BG1NUC-HC113 560 RBD BG1NUC-HC114 561 RBD BG1NUC-HC115 562 RBD BG1NUC-HC116 563 RBD BG1NUC-HC117 564 2P BG1NUC-HC118 565 2P BG1NUC-HC119 566 RBD BG1NUC-HC120 567 2P BG1NUC-HC121 568 2P BG1NUC-HC122 569 2P BG1NUC-HC123 570 RBD BG1NUC-HC124 571 RBD BG1NUC-HC125 572 RBD BG1NUC-HC126 573 RBD BG1NUC-HC127 574 RBD BG1NUC-HC128 575 RBD BG1NUC-HC129 576 RBD BG1NUC-HC130 577 RBD BG1NUC-HC131 578 RBD BG1NUC-HC132 579 RBD BG1NUC-HC133 580 2P BG1NUC-HC134 581 2P BG1NUC-HC135 582 RBD BG1NUC-HC136 583 RBD BG1NUC-HC137 584 RBD BG1NUC-HC138 585 RBD BG1NUC-HC139 586 2P BG1NUC-HC140 587 2P BG1NUC-HC141 588 2P BG1NUC-HC142 589 2P BG1NUC-HC143 590 2P BG1NUC-HC144 591 2P BG1NUC-HC145 592 2P BG1NUC-HC146 593 2P BG1NUC-HC147 594 2P BG1NUC-HC148 595 2P BG1NUC-HC149 596 RBD BG1NUC-HC150 597 2P BG1NUC-HC151 598 RBD BG1NUC-HC152 599 RBD BG1NUC-HC153 600 2P BG1NUC-HC154 601 2P BG1NUC-HC155 602 RBD BG1NUC-HC156 603 2P BG1NUC-HC157 604 2P BG1NUC-HC158 605 2F BG1NUC-HC159 606 2P BG1NUC-HC160 607 RBD BG1NUC-HC161 608 2P BG1NUC-HC162 609 RBD BG1NUC-HC163 610 RBD BG1NUC-HC164 611 RBD BG1NUC-HC165 612 RBD BG1NUC-HC166 613 2P BG1NUC-HC167 614 RBD BG1NUC-HC168 615 RBD BG1NUC-HC169 616 2P BG1NUC-HC170 617 2P BG1NUC-HC171 618 2P BG1NUC-HC172 619 RBD BG1NUC-HC173 620 RBD BG1NUC-HC174 621 RBD BG1NUC-HC175 622 2P BG1NUC-HC176 623 RBD BG1NUC-HC177 624 RBD BG1NUC-HC178 625 2P BG1NUC-HC179 626 RBD BG1NUC-HC180 627 RBD BG1NUC-HC181 628 RBD BG1NUC-HC182 629 RBD BG1NUC-HC183 630 2P BG1NUC-HC184 631 RBD BG1NUC-HC185 632 RBD BG1NUC-HC186 633 RBD BG1NUC-HC187 634 RBD BG1NUC-HC188 635 2P BG1NUC-HC189 636 RBD BG1NUC-HC190 637 2P BG1NUC-HC191 638 2P BG1NUC-HC192 639 2P BG1NUC-HC193 640 2P BG1NUC-HC194 641 2P BG1NUC-HC195 642 2P BG1NUC-HC196 643 2P BG1NUC-HC197 644 2P BG1NUC-HC198 645 2P BG1NUC-HC199 646 RBD BG1NUC-HC200 647 RBD BG1NUC-HC201 648 RBD BG1NUC-HC202 649 2P BG1NUC-HC203 650 2P BG1NUC-HC204 651 2P BG1NUC-HC205 652 RBD BG1NUC-HC206 653 2P BG1NUC-HC207 654 2P BG1NUC-HC208 655 2P BG1NUC-HC209 656 RBD BG1NUC-HC210 657 RBD BG1NUC-HC211 658 2P BG1NUC-HC212 659 2P BG1NUC-HC213 660 2P BG1NUC-HC214 661 2P BG1NUC-HC215 662 RBD BG1NUC-HC216 663 2P BG1NUC-HC217 664 2P BG1NUC-HC218 665 RBD BG1NUC-HC219 666 2P BG1NUC-HC220 667 2P BG1NUC-HC221 668 2P BG1NUC-HC222 669 2P BG1NUC-HC223 670 RBD BG1NUC-HC224 671 RBD BG1NUC-HC225 672 2P BG1NUC-HC226 673 2P BG1NUC-HC227 674 2P BG1NUC-HC228 675 RBD BG1NUC-HC229 676 RBD BG1NUC-HC230 677 RBD BG1NUC-HC231 678 2P BG1NUC-HC232 679 RBD BG1NUC-HC233 680 RBD BG1NUC-HC234 681 2P BG1NUC-HC235 682 2P BG1NUC-HC236 683 2P BG1NUC-HC237 684 2P BG1NUC-HC238 685 RBD BG1NUC-HC239 686 RBD BG1NUC-HC240 687 2P BG1NUC-HC241 688 2P BG1NUC-HC242 689 2P BG1NUC-HC243 690 RBD BG1NUC-HC244 691 RBD BG1NUC-HC245 692 RBD BG1NUC-HC246 693 2P BG1NUC-HC247 694 2P BG1NUC-HC248 695 2P BG1NUC-HC249 696 RBD BG1NUC-HC250 697 RBD BG1NUC-HC251 698 2P BG1NUC-HC252 699 RBD BG1NUC-HC253 700 RBD BG1NUC-HC254 701 RBD BG1NUC-HC255 702 2P BG1NUC-HC256 703 2P BG1NUC-HC257 704 2P BG1NUC-HC258 705 2P BG1NUC-HC259 706 RBD BG1NUC-HC260 707 RBD BG1NUC-HC261 708 2P BG1NUC-HC262 709 2P BG1NUC-HC263 710 2P BG1NUC-HC264 711 RBD BG1NUC-HC265 712 2P BG1NUC-HC266 713 2P BG1NUC-HC267 714 2P BG1NUC-HC268 715 RBD BG1NUC-HC269 716 RBD BG1NUC-HC270 717 RBD BG1NUC-HC271 718 RBD BG1NUC-HC272 719 RBD BG1NUC-HC273 720 2P BG1NUC-HC274 721 2P BG1NUC-HC275 722 2P BG1NUC-HC276 723 RBD BG1NUC-HC277 724 2P BG1NUC-HC278 725 2P BG1NUC-HC279 726 2P BG1NUC-HC280 727 2P BG1NUC-HC281 728 2P BG1NUC-HC282 729 2P BG1NUC-HC283 730 RBD BG1NUC-HC284 731 2P BG1NUC-HC285 732 2P BG1NUC-HC286 733 2P BG1NUC-HC287 734 2P BG1NUC-HC288 735 2P BG1NUC-HC289 736 2P BG1NUC-HC290 737 2P BG1NUC-HC291 738 RBD BG1NUC-HC292 739 RBD BG1NUC-HC293 740 RBD BG1NUC-HC294 741 RBD BG1NUC-HC295 742 RBD BG1NUC-HC296 743 RBD BG1NUC-HC297 744 2P BG1NUC-HC298 745 2P BG1NUC-HC299 746 RBD BG1NUC-HC300 747 RBD BG1NUC-HC301 748 RBD BG1NUC-HC302 749 RBD BG1NUC-HC303 750 RBD BG1NUC-HC304 751 2P BG1NUC-HC305 752 RBD BG1NUC-HC306 753 RBD BG1NUC-HC307 754 2P BG1NUC-HC308 755 RBD BG1NUC-LC1 756 2P BG1NUC-LC2 757 RBD BG1NUC-LC3 758 2P BG1NUC-LC4 759 RBD BG1NUC-LC5 760 2P BG1NUC-LC6 761 RBD BG1NUC-LC7 762 RBD BG1NUC-LC8 763 RBD BG1NUC-LC9 764 RBD BG1NUC-LC10 765 RBD BG1NUC-LC11 766 2P BG1NUC-LC12 767 RBD BG1NUC-LC13 768 RBD BG1NUC-LC14 769 RBD BG1NUC-LC15 770 RBD BG1NUC-LC16 771 RBD BG1NUC-LC17 772 2P BG1NUC-LC18 773 2P BG1NUC-LC19 774 RBD BG1NUC-LC20 775 2P BG1NUC-LC21 776 2P BG1NUC-LC22 777 2P BG1NUC-LC23 778 2P BG1NUC-LC24 779 RBD BG1NUC-LC25 780 2P BG1NUC-LC26 781 RBD BG1NUC-LC27 782 2P BG1NUC-LC28 783 RBD BG1NUC-LC29 784 2P BG1NUC-LC30 785 RBD BG1NUC-LC31 786 RBD BG1NUC-LC32 787 2P BG1NUC-LC33 788 2P BG1NUC-LC34 789 RBD BG1NUC-LC35 790 2P BG1NUC-LC36 791 RBD BG1NUC-LC37 792 RBD BG1NUC-LC38 793 2P BG1NUC-LC39 794 RBD BG1NUC-LC40 795 RBD BG1NUC-LC41 796 2P BG1NUC-LC42 797 2P BG1NUC-LC43 798 RBD BG1NUC-LC44 799 RBD BG1NUC-LC45 800 RBD BG1NUC-LC46 801 2P BG1NUC-LC47 802 RBD BG1NUC-LC48 803 RBD BG1NUC-LC49 804 RBD BG1NUC-LC50 805 2P BG1NUC-LC51 806 2P BG1NUC-LC52 807 RBD BG1NUC-LC53 808 2P BG1NUC-LC54 809 2P BG1NUC-LC55 810 RBD BG1NUC-LC56 811 2P BG1NUC-LC57 812 2P BG1NUC-LC58 813 2P BG1NUC-LC59 814 RBD BG1NUC-LC60 815 RBD BG1NUC-LC61 816 RBD BG1NUC-LC62 817 2P BG1NUC-LC63 818 2P BG1NUC-LC64 819 2P BG1NUC-LC65 820 2P BG1NUC-LC66 821 RBD BG1NUC-LC67 822 RBD BG1NUC-LC68 823 2P BG1NUC-LC69 824 2P BG1NUC-LC70 825 2P BG1NUC-LC71 826 RBD BG1NUC-LC72 827 RBD BG1NUC-LC73 828 RBD BG1NUC-LC74 829 2P BG1NUC-LC75 830 RBD BG1NUC-LC76 831 2P BG1NUC-LC77 832 2P BG1NUC-LC78 833 2P BG1NUC-LC79 834 RBD BG1NUC-LC80 835 RBD BG1NUC-LC81 836 2P BG1NUC-LC82 837 RBD BG1NUC-LC83 838 2P BG1NUC-LC84 839 2P BG1NUC-LC85 840 2P BG1NUC-LC86 841 RBD BG1NUC-LC87 842 2P BG1NUC-LC88 843 RBD BG1NUC-LC89 844 RBD BG1NUC-LC90 845 RBD BG1NUC-LC91 846 RBD BG1NUC-LC92 847 RBD BG1NUC-LC93 848 RBD BG1NUC-LC94 849 RBD BG1NUC-LC95 850 RBD BG1NUC-LC96 851 2P BG1NUC-LC97 852 2P BG1NUC-LC98 853 2P BG1NUC-LC99 854 RBD BG1NUC-LC100 855 2P BG1NUC-LC101 856 RBD BG1NUC-LC102 857 2P BG1NUC-LC103 858 2P BG1NUC-LC104 859 2P BG1NUC-LC105 860 2P BG1NUC-LC106 861 RBD BG1NUC-LC107 862 RBD BG1NUC-LC108 863 2P BG1NUC-LC109 864 2P BG1NUC-LC110 865 2P BG1NUC-LC111 866 2P BG1NUC-LC112 867 2P BG1NUC-LC113 868 RBD BG1NUC-LC114 869 RBD BG1NUC-LC115 870 RBD BG1NUC-LC116 871 RBD BG1NUC-LC117 872 2P BG1NUC-LC118 873 2P BG1NUC-LC119 874 RBD BG1NUC-LC120 875 2P BG1NUC-LC121 876 2P BG1NUC-LC122 877 2P BG1NUC-LC123 878 RBD BG1NUC-LC124 879 RBD BG1NUC-LC125 880 RBD BG1NUC-LC126 881 RBD BG1NUC-LC127 882 RBD BG1NUC-LC128 883 RBD BG1NUC-LC129 884 RBD BG1NUC-LC130 885 RBD BG1NUC-LC131 886 RBD BG1NUC-LC132 887 RBD BG1NUC-LC133 888 2P BG1NUC-LC134 889 2P BG1NUC-LC135 890 RBD BG1NUC-LC136 891 RBD BG1NUC-LC137 892 RBD BG1NUC-LC138 893 RBD BG1NUC-LC139 894 2P BG1NUC-LC140 895 2P BG1NUC-LC141 896 2P BG1NUC-LC142 897 2P BG1NUC-LC143 898 2P BG1NUC-LC144 899 2P BG1NUC-LC145 900 2P BG1NUC-LC146 901 2P BG1NUC-LC147 902 2P BG1NUC-LC148 903 2P BG1NUC-LC149 904 RBD BG1NUC-LC150 905 2F BG1NUC-LC151 906 RBD BG1NUC-LC152 907 RBD BG1NUC-LC153 908 2P BG1NUC-LC154 909 2F BG1NUC-LC155 910 RBD BG1NUC-LC156 911 2P BG1NUC-LC157 912 2P BG1NUC-LC158 913 2P BG1NUC-LC159 914 2P BG1NUC-LC160 915 RBD BG1NUC-LC161 916 2P BG1NUC-LC162 917 RBD BG1NUC-LC163 918 RBD BG1NUC-LC164 919 RBD BG1NUC-LC165 920 RBD BG1NUC-LC166 921 2P BG1NUC-LC167 922 RBD BG1NUC-LC168 923 RBD BG1NUC-LC169 924 2P BG1NUC-LC170 925 2P BG1NUC-LC171 926 2P BG1NUC-LC172 927 RBD BG1NUC-LC173 928 RBD BG1NUC-LC174 929 RBD BG1NUC-LC175 930 2P BG1NUC-LC176 931 RBD BG1NUC-LC177 932 RBD BG1NUC-LC178 933 2P BG1NUC-LC179 934 RBD BG1NUC-LC180 935 RBD BG1NUC-LC181 936 RBD BG1NUC-LC182 937 RBD BG1NUC-LC183 938 2F BG1NUC-LC184 939 RBD BG1NUC-LC185 940 RBD BG1NUC-LC186 941 RBD BG1NUC-LC187 942 RBD BG1NUC-LC188 943 2P BG1NUC-LC189 944 RBD BG1NUC-LC190 945 2P BG1NUC-LC191 946 2P BG1NUC-LC192 947 2P BG1NUC-LC193 948 2P BG1NUC-LC194 949 2P BG1NUC-LC195 950 2P BG1NUC-LC196 951 2P BG1NUC-LC197 952 2P BG1NUC-LC198 953 2P BG1NUC-LC199 954 RBD BG1NUC-LC200 955 RBD BG1NUC-LC201 956 RBD BG1NUC-LC202 957 2P BG1NUC-LC203 958 2P BG1NUC-LC204 959 2P BG1NUC-LC205 960 RBD BG1NUC-LC206 961 2P BG1NUC-LC207 962 2P BG1NUC-LC208 963 2P BG1NUC-LC209 964 RBD BG1NUC-LC210 965 RBD BG1NUC-LC211 966 2P BG1NUC-LC212 967 2P BG1NUC-LC213 968 2P BG1NUC-LC214 969 2F BG1NUC-LC215 970 RBD BG1NUC-LC216 971 2P BG1NUC-LC217 972 2P BG1NUC-LC218 973 RBD BG1NUC-LC219 974 2P BG1NUC-LC220 975 2P BG1NUC-LC221 976 2P BG1NUC-LC222 977 2P BG1NUC-LC223 978 RBD BG1NUC-LC224 979 RBD BG1NUC-LC225 980 2P BG1NUC-LC226 981 2P BG1NUC-LC227 982 2P BG1NUC-LC228 983 RBD BG1NUC-LC229 984 RBD BG1NUC-LC230 985 RBD BG1NUC-LC231 986 2P BG1NUC-LC232 987 RBD BG1NUC-LC233 988 RBD BG1NUC-LC234 989 2P BG1NUC-LC235 990 2P BG1NUC-LC236 991 2P BG1NUC-LC237 992 2P BG1NUC-LC238 993 RBD BG1NUC-LC239 994 RBD BG1NUC-LC240 995 2P BG1NUC-LC241 996 2P BG1NUC-LC242 997 2P BG1NUC-LC243 998 RBD BG1NUC-LC244 999 RBD BG1NUC-LC245 1000 RBD BG1NUC-LC246 1001 2P BG1NUC-LC247 1002 2P BG1NUC-LC248 1003 2P BG1NUC-LC249 1004 RBD BG1NUC-LC250 1005 RBD BG1NUC-LC251 1006 2P BG1NUC-LC252 1007 RBD BG1NUC-LC253 1008 RBD BG1NUC-LC254 1009 RBD BG1NUC-LC255 1010 2P BG1NUC-LC256 1011 2P BG1NUC-LC257 1012 2P BG1NUC-LC258 1013 2P BG1NUC-LC259 1014 RBD BG1NUC-LC260 1015 RBD BG1NUC-LC261 1016 2P BG1NUC-LC262 1017 2P BG1NUC-LC263 1018 2P BG1NUC-LC264 1019 RBD BG1NUC-LC265 1020 2P BG1NUC-LC266 1021 2P BG1NUC-LC267 1022 2P BG1NUC-LC268 1023 RBD BG1NUC-LC269 1024 RBD BG1NUC-LC270 1025 RBD BG1NUC-LC271 1026 RBD BG1NUC-LC272 1027 RBD BG1NUC-LC273 1028 2P BG1NUC-LC274 1029 2P BG1NUC-LC275 1030 2P BG1NUC-LC276 1031 RBD BG1NUC-LC277 1032 2P BG1NUC-LC278 1033 2P BG1NUC-LC279 1034 2P BG1NUC-LC280 1035 2P BG1NUC-LC281 1036 2P BG1NUC-LC282 1037 2P BG1NUC-LC283 1038 RBD BG1NUC-LC284 1039 2P BG1NUC-LC285 1040 2P BG1NUC-LC286 1041 2P BG1NUC-LC287 1042 2P BG1NUC-LC288 1043 2P BG1NUC-LC289 1044 2P BG1NUC-LC290 1045 2P BG1NUC-LC291 1046 RBD BG1NUC-LC292 1047 RBD BG1NUC-LC293 1048 RBD BG1NUC-LC294 1049 RBD BG1NUC-LC295 1050 RBD BG1NUC-LC296 1051 RBD BG1NUC-LC297 1052 2P BG1NUC-LC298 1053 2P BG1NUC-LC299 1054 RBD BG1NUC-LC300 1055 RBD BG1NUC-LC301 1056 RBD BG1NUC-LC302 1057 RBD BG1NUC-LC303 1058 RBD BG1NUC-LC304 1059 2P BG1NUC-LC305 1060 RBD BG1NUC-LC306 1061 RBD BG1NUC-LC307 1062 2P BG1NUC-LC308 1063 RBD BG2NUC-HC1 1064 RBD BG2NUC-HC2 1065 2P BG2NUC-HC3 1066 RBD BG2NUC-HC4 1067 RBD BG2NUC-HC5 1068 RBD BG2NUC-HC6 1069 RBD BG2NUC-HC7 1070 RBD BG2NUC-HC8 1071 2P BG2NUC-HC9 1072 RBD BG2NUC-HC10 1073 2P BG2NUC-HC11 1074 RBD BG2NUC-HC12 1075 RBD BG2NUC-HC13 1076 RBD BG2NUC-HC14 1077 RBD BG2NUC-HC15 1078 RBD BG2NUC-HC16 1079 RBD BG2NUC-HC17 1080 RBD BG2NUC-HC18 1081 RBD BG2NUC-HC19 1082 RBD BG2NUC-HC20 1083 RBD BG2NUC-HC21 1084 2P BG2NUC-HC22 1085 RBD BG2NUC-HC23 1086 RBD BG2NUC-HC24 1087 RBD BG2NUC-HC25 1088 RBD BG2NUC-HC26 1089 RBD BG2NUC-HC27 1090 RBD BG2NUC-HC28 1091 RBD BG2NUC-HC29 1092 2P BG2NUC-HC30 1093 RBD BG2NUC-HC31 1094 RBD BG2NUC-HC32 1095 RBD BG2NUC-HC33 1096 RBD BG2NUC-HC34 1097 2P BG2NUC-HC35 1098 RBD BG2NUC-HC36 1099 2P BG2NUC-HC37 1100 RBD BG2NUC-HC38 1101 RBD BG2NUC-HC39 1102 RBD BG2NUC-HC40 1103 RBD BG2NUC-HC41 1104 RBD BG2NUC-HC42 1105 RBD BG2NUC-HC43 1106 RBD BG2NUC-HC44 1107 RBD BG2NUC-HC45 1108 RBD BG2NUC-HC46 1109 2P BG2NUC-HC47 1110 2P BG2NUC-HC48 1111 RBD BG2NUC-HC49 1112 RBD BG2NUC-HC50 1113 2P BG2NUC-HC51 1114 RBD BG2NUC-HC52 1115 RBD BG2NUC-HC53 1116 2P BG2NUC-HC54 1117 RBD BG2NUC-HC55 1118 RBD BG2NUC-HC56 1119 2P BG2NUC-HC57 1120 RBD BG2NUC-HC58 1121 2P BG2NUC-HC59 1122 RBD BG2NUC-HC60 1123 RBD BG2NUC-HC61 1124 2P BG2NUC-HC62 1125 2F BG2NUC-HC63 1126 2F BG2NUC-HC64 1127 2P BG2NUC-HC65 1128 2P BG2NUC-HC66 1129 2P BG2NUC-HC67 1130 2P BG2NUC-HC68 1131 2P BG2NUC-HC69 1132 2P BG2NUC-HC70 1133 RBD BG2NUC-HC71 1134 RBD BG2NUC-HC72 1135 RBD BG2NUC-HC73 1136 2F BG2NUC-HC74 1137 RBD BG2NUC-HC75 1138 RBD BG2NUC-HC76 1139 2P BG2NUC-HC77 1140 2P BG2NUC-HC78 1141 RBD BG2NUC-HC79 1142 2P BG2NUC-HC80 1143 RBD BG2NUC-HC81 1144 2P BG2NUC-HC82 1145 2P BG2NUC-HC83 1146 RBD BG2NUC-HC84 1147 RBD BG2NUC-HC85 1148 2P BG2NUC-HC86 1149 RBD BG2NUC-HC87 1150 2P BG2NUC-HC88 1151 RBD BG2NUC-HC89 1152 RBD BG2NUC-HC90 1153 2P BG2NUC-HC91 1154 2P BG2NUC-HC92 1155 2P BG2NUC-HC93 1156 2F BG2NUC-HC94 1157 2P BG2NUC-HC95 1158 2P BG2NUC-HC96 1159 RBD BG2NUC-HC97 1160 2P BG2NUC-HC98 1161 2P BG2NUC-HC99 1162 RBD BG2NUC-HC100 1163 RBD BG2NUC-HC101 1164 RBD BG2NUC-HC102 1165 RBD BG2NUC-HC103 1166 RBD BG2NUC-HC104 1167 2P BG2NUC-HC105 1168 RBD BG2NUC-HC106 1169 RBD BG2NUC-HC107 1170 RBD BG2NUC-HC108 1171 2P BG2NUC-HC109 1172 RBD BG2NUC-HC110 1173 RBD BG2NUC-HC111 1174 RBD BG2NUC-HC112 1175 2P BG2NUC-HC113 1176 2P BG2NUC-HC114 1177 RBD BG2NUC-HC115 1178 RBD BG2NUC-HC116 1179 2P BG2NUC-HC117 1180 2P BG2NUC-HC118 1181 2F BG2NUC-HC119 1182 2F BG2NUC-HC120 1183 RBD BG2NUC-HC121 1184 RBD BG2NUC-HC122 1185 2P BG2NUC-HC123 1186 2P BG2NUC-HC124 1187 RBD BG2NUC-HC125 1188 RBD BG2NUC-HC126 1189 2P BG2NUC-HC127 1190 2P BG2NUC-HC128 1191 2P BG2NUC-HC129 1192 2P BG2NUC-HC130 1193 2P BG2NUC-HC131 1194 2P BG2NUC-HC132 1195 2P BG2NUC-HC133 1196 2P BG2NUC-HC134 1197 RBD BG2NUC-HC135 1198 RBD BG2NUC-HC136 1199 RBD BG2NUC-HC137 1200 2P BG2NUC-HC138 1201 2P BG2NUC-HC139 1202 2P BG2NUC-HC140 1203 2P BG2NUC-HC141 1204 2P BG2NUC-HC142 1205 2P BG2NUC-HC143 1206 2P BG2NUC-HC144 1207 RBD BG2NUC-HC145 1208 RBD BG2NUC-HC146 1209 2P BG2NUC-HC147 1210 RBD BG2NUC-HC148 1211 2P BG2NUC-HC149 1212 2P BG2NUC-HC150 1213 2P BG2NUC-HC151 1214 2P BG2NUC-HC152 1215 2P BG2NUC-HC153 1216 2P BG2NUC-HC154 1217 2P BG2NUC-HC155 1218 2P BG2NUC-HC156 1219 RBD BG2NUC-HC157 1220 2P BG2NUC-HC158 1221 2P BG2NUC-HC159 1222 RBD BG2NUC-HC160 1223 2P BG2NUC-HC161 1224 2P BG2NUC-HC162 1225 RBD BG2NUC-HC163 1226 2P BG2NUC-HC164 1227 RBD BG2NUC-HC165 1228 RBD BG2NUC-HC166 1229 2P BG2NUC-HC167 1230 2P BG2NUC-HC168 1231 2P BG2NUC-HC169 1232 2P BG2NUC-HC170 1233 RBD BG2NUC-HC171 1234 2P BG2NUC-HC172 1235 2P BG2NUC-HC173 1236 2P BG2NUC-HC174 1237 RBD BG2NUC-HC175 1238 2P BG2NUC-HC176 1239 RBD BG2NUC-HC177 1240 RBD BG2NUC-HC178 1241 RBD BG2NUC-HC179 1242 2P BG2NUC-HC180 1243 RBD BG2NUC-HC181 1244 RBD BG2NUC-HC182 1245 2P BG2NUC-HC183 1246 2P BG2NUC-HC184 1247 RBD BG2NUC-HC185 1248 2P BG2NUC-HC186 1249 RBD BG2NUC-HC187 1250 2P BG2NUC-HC188 1251 2P BG2NUC-HC189 1252 2P BG2NUC-HC190 1253 2P BG2NUC-HC191 1254 RBD BG2NUC-HC192 1255 2P BG2NUC-HC193 1256 RBD BG2NUC-HC194 1257 2P BG2NUC-HC195 1258 2P BG2NUC-HC196 1259 RBD BG2NUC-HC197 1260 RBD BG2NUC-HC198 1261 2P BG2NUC-HC199 1262 2P BG2NUC-HC200 1263 RBD BG2NUC-HC201 1264 2P BG2NUC-HC202 1265 RBD BG2NUC-HC203 1266 2P BG2NUC-HC204 1267 RBD BG2NUC-HC205 1268 2P BG2NUC-HC206 1269 RBD BG2NUC-HC207 1270 2P BG2NUC-HC208 1271 2P BG2NUC-HC209 1272 2P BG2NUC-HC210 1273 RBD BG2NUC-HC211 1274 2P BG2NUC-HC212 1275 RBD BG2NUC-HC213 1276 2P BG2NUC-HC214 1277 RBD BG2NUC-HC215 1278 2F BG2NUC-HC216 1279 RBD BG2NUC-HC217 1280 RBD BG2NUC-HC218 1281 RBD BG2NUC-HC219 1282 2P BG2NUC-HC220 1283 RBD BG2NUC-HC221 1284 RBD BG2NUC-HC222 1285 RBD BG2NUC-HC223 1286 2P BG2NUC-HC224 1287 RBD BG2NUC-HC225 1288 2P BG2NUC-HC226 1289 2P BG2NUC-HC227 1290 2P BG2NUC-HC228 1291 RBD BG2NUC-HC229 1292 2P BG2NUC-HC230 1293 RBD BG2NUC-HC231 1294 2P BG2NUC-HC232 1295 2P BG2NUC-HC233 1296 2P BG2NUC-HC234 1297 RBD BG2NUC-HC235 1298 RBD BG2NUC-HC236 1299 2P BG2NUC-HC237 1300 RBD BG2NUC-HC238 1301 2P BG2NUC-HC239 1302 2P BG2NUC-HC240 1303 2P BG2NUC-HC241 1304 RBD BG2NUC-HC242 1305 2P BG2NUC-HC243 1306 RBD BG2NUC-HC244 1307 RBD BG2NUC-HC245 1308 2P BG2NUC-HC246 1309 RBD BG2NUC-HC247 1310 RBD BG2NUC-HC248 1311 2P BG2NUC-HC249 1312 2P BG2NUC-HC250 1313 2P BG2NUC-HC251 1314 RBD BG2NUC-HC252 1315 2P BG2NUC-HC253 1316 RBD BG2NUC-HC254 1317 2P BG2NUC-HC255 1318 RBD BG2NUC-HC256 1319 2P BG2NUC-HC257 1320 2P BG2NUC-HC258 1321 2P BG2NUC-HC259 1322 2P BG2NUC-HC260 1323 2P BG2NUC-HC261 1324 RBD BG2NUC-HC262 1325 2P BG2NUC-HC263 1326 RBD BG2NUC-HC264 1327 2P BG2NUC-HC265 1328 2P BG2NUC-HC266 1329 2P BG2NUC-HC267 1330 2P BG2NUC-HC268 1331 RBD BG2NUC-HC269 1332 2P BG2NUC-HC270 1333 2P BG2NUC-HC271 1334 2P BG2NUC-HC272 1335 2P BG2NUC-HC273 1336 2P BG2NUC-HC274 1337 2P BG2NUC-HC275 1338 2P BG2NUC-HC276 1339 2P BG2NUC-HC277 1340 2P BG2NUC-HC278 1341 2P BG2NUC-HC279 1342 RBD BG2NUC-HC280 1343 RBD BG2NUC-HC281 1344 RBD BG2NUC-HC282 1345 2P BG2NUC-HC283 1346 2P BG2NUC-HC284 1347 2P BG2NUC-HC285 1348 2P BG2NUC-HC286 1349 RBD BG2NUC-HC287 1350 2P BG2NUC-HC288 1351 2P BG2NUC-HC289 1352 RBD BG2NUC-HC290 1353 2P BG2NUC-HC291 1354 2P BG2NUC-HC292 1355 2P BG2NUC-HC293 1356 2P BG2NUC-HC294 1357 RBD BG2NUC-HC295 1358 2P BG2NUC-HC296 1359 2P BG2NUC-HC297 1360 RBD BG2NUC-HC298 1361 2P BG2NUC-HC299 1362 2P BG2NUC-HC300 1363 2P BG2NUC-HC301 1364 2P BG2NUC-HC302 1365 2P BG2NUC-HC303 1366 2P BG2NUC-HC304 1367 RBD BG2NUC-HC305 1368 2P BG2NUC-HC306 1369 2P BG2NUC-HC307 1370 2P BG2NUC-HC308 1371 2P BG2NUC-HC309 1372 RBD BG2NUC-HC310 1373 RBD BG2NUC-HC311 1374 RBD BG2NUC-HC312 1375 RBD BG2NUC-HC313 1376 RBD BG2NUC-HC314 1377 RBD BG2NUC-HC315 1378 2P BG2NUC-HC316 1379 RBD BG2NUC-HC317 1380 2P BG2NUC-HC318 1381 2P BG2NUC-HC319 1382 2P BG2NUC-HC320 1383 2P BG2NUC-HC321 1384 RBD BG2NUC-HC322 1385 RBD BG2NUC-HC323 1386 RBD BG2NUC-HC324 1387 RBD BG2NUC-HC325 1388 RBD BG2NUC-HC326 1389 2P BG2NUC-HC327 1390 2P BG2NUC-HC328 1391 2P BG2NUC-HC329 1392 2P BG2NUC-HC330 1393 2P BG2NUC-HC331 1394 2P BG2NUC-HC332 1395 2P BG2NUC-HC333 1396 RBD BG2NUC-HC334 1397 2P BG2NUC-HC335 1398 2P BG2NUC-HC336 1399 RBD BG2NUC-HC337 1400 2P BG2NUC-HC338 1401 2P BG2NUC-HC339 1402 2P BG2NUC-HC340 1403 2P BG2NUC-HC341 1404 2P BG2NUC-HC342 1405 2P BG2NUC-HC343 1406 2P BG2NUC-HC344 1407 RBD BG2NUC-HC345 1408 2P BG2NUC-HC346 1409 2P BG2NUC-HC347 1410 2P BG2NUC-HC348 1411 RBD BG2NUC-HC349 1412 RBD BG2NUC-HC350 1413 2P BG2NUC-HC351 1414 RBD BG2NUC-HC352 1415 RBD BG2NUC-HC353 1416 2P BG2NUC-HC354 1417 2P BG2NUC-HC355 1418 2P BG2NUC-HC356 1419 2P BG2NUC-HC357 1420 2P BG2NUC-HC358 1421 2P BG2NUC-HC359 1422 2P BG2NUC-HC360 1423 2P BG2NUC-HC361 1424 2P BG2NUC-HC362 1425 2P BG2NUC-HC363 1426 RBD BG2NUC-HC364 1427 2P BG2NUC-HC365 1428 2P BG2NUC-HC366 1429 2P BG2NUC-HC367 1430 RBD BG2NUC-HC368 1431 2P BG2NUC-HC369 1432 2P BG2NUC-HC370 1433 2P BG2NUC-HC371 1434 2P BG2NUC-HC372 1435 2P BG2NUC-HC373 1436 2P BG2NUC-HC374 1437 2P BG2NUC-HC375 1438 2P BG2NUC-HC376 1439 2P BG2NUC-HC377 1440 2P BG2NUC-HC378 1441 2P BG2NUC-HC379 1442 2P BG2NUC-HC380 1443 RBD BG2NUC-LC1 1444 RBD BG2NUC-LC2 1445 2P BG2NUC-LC3 1446 RBD BG2NUC-LC4 1447 RBD BG2NUC-LC5 1448 RBD BG2NUC-LC6 1449 RBD BG2NUC-LC7 1450 RBD BG2NUC-LC8 1451 2P BG2NUC-LC9 1452 RBD BG2NUC-LC10 1453 2P BG2NUC-LC11 1454 RBD BG2NUC-LC12 1455 RBD BG2NUC-LC13 1456 RBD BG2NUC-LC14 1457 RBD BG2NUC-LC15 1458 RBD BG2NUC-LC16 1459 RBD BG2NUC-LC17 1460 RBD BG2NUC-LC18 1461 RBD BG2NUC-LC19 1462 RBD BG2NUC-LC20 1463 RBD BG2NUC-LC21 1464 2P BG2NUC-LC22 1465 RBD BG2NUC-LC23 1466 RBD BG2NUC-LC24 1467 RBD BG2NUC-LC25 1468 RBD BG2NUC-LC26 1469 RBD BG2NUC-LC27 1470 RBD BG2NUC-LC28 1471 RBD BG2NUC-LC29 1472 2P BG2NUC-LC30 1473 RBD BG2NUC-LC31 1474 RBD BG2NUC-LC32 1475 RBD BG2NUC-LC33 1476 RBD BG2NUC-LC34 1477 2P BG2NUC-LC35 1478 RBD BG2NUC-LC36 1479 2P BG2NUC-LC37 1480 RBD BG2NUC-LC38 1481 RBD BG2NUC-LC39 1482 RBD BG2NUC-LC40 1483 RBD BG2NUC-LC41 1484 RBD BG2NUC-LC42 1485 RBD BG2NUC-LC43 1486 RBD BG2NUC-LC44 1487 RBD BG2NUC-LC45 1488 RBD BG2NUC-LC46 1489 2P BG2NUC-LC47 1490 2P BG2NUC-LC48 1491 RBD BG2NUC-LC49 1492 RBD BG2NUC-LC50 1493 2P BG2NUC-LC51 1494 RBD BG2NUC-LC52 1495 RBD BG2NUC-LC53 1496 2P BG2NUC-LC54 1497 RBD BG2NUC-LC55 1498 RBD BG2NUC-LC56 1499 2P BG2NUC-LC57 1500 RBD BG2NUC-LC58 1501 2P BG2NUC-LC59 1502 RBD BG2NUC-LC60 1503 RBD BG2NUC-LC61 1504 2P BG2NUC-LC62 1505 2P BG2NUC-LC63 1506 2P BG2NUC-LC64 1507 2P BG2NUC-LC65 1508 2P BG2NUC-LC66 1509 2P BG2NUC-LC67 1510 2P BG2NUC-LC68 1511 2P BG2NUC-LC69 1512 2P BG2NUC-LC70 1513 RBD BG2NUC-LC71 1514 RBD BG2NUC-LC72 1515 RBD BG2NUC-LC73 1516 2P BG2NUC-LC74 1517 RBD BG2NUC-LC75 1518 RBD BG2NUC-LC76 1519 2P BG2NUC-LC77 1520 2P BG2NUC-LC78 1521 RBD BG2NUC-LC79 1522 2P BG2NUC-LC80 1523 RBD BG2NUC-LC81 1524 2P BG2NUC-LC82 1525 2P BG2NUC-LC83 1526 RBD BG2NUC-LC84 1527 RBD BG2NUC-LC85 1528 2P BG2NUC-LC86 1529 RBD BG2NUC-LC87 1530 2P BG2NUC-LC88 1531 RBD BG2NUC-LC89 1532 RBD BG2NUC-LC90 1533 2P BG2NUC-LC91 1534 2P BG2NUC-LC92 1535 2P BG2NUC-LC93 1536 2P BG2NUC-LC94 1537 2P BG2NUC-LC95 1538 2P BG2NUC-LC96 1539 RBD BG2NUC-LC97 1540 2P BG2NUC-LC98 1541 2P BG2NUC-LC99 1542 RBD BG2NUC-LC100 1543 RBD BG2NUC-LC101 1544 RBD BG2NUC-LC102 1545 RBD BG2NUC-LC103 1546 RBD BG2NUC-LC104 1547 2P BG2NUC-LC105 1548 RBD BG2NUC-LC106 1549 RBD BG2NUC-LC107 1550 RBD BG2NUC-LC108 1551 2P BG2NUC-LC109 1552 RBD BG2NUC-LC110 1553 RBD BG2NUC-LC111 1554 RBD BG2NUC-LC112 1555 2P BG2NUC-LC113 1556 2P BG2NUC-LC114 1557 RBD BG2NUC-LC115 1558 RBD BG2NUC-LC116 1559 2P BG2NUC-LC117 1560 2P BG2NUC-LC118 1561 2P BG2NUC-LC119 1562 2P BG2NUC-LC120 1563 RBD BG2NUC-LC121 1564 RBD BG2NUC-LC122 1565 2P BG2NUC-LC123 1566 2P BG2NUC-LC124 1567 RBD BG2NUC-LC125 1568 RBD BG2NUC-LC126 1569 2P BG2NUC-LC127 1570 2P BG2NUC-LC128 1571 2P BG2NUC-LC129 1572 2P BG2NUC-LC130 1573 2P BG2NUC-LC131 1574 2P BG2NUC-LC132 1575 2P BG2NUC-LC133 1576 2P BG2NUC-LC134 1577 RBD BG2NUC-LC135 1578 RBD BG2NUC-LC136 1579 RBD BG2NUC-LC137 1580 2P BG2NUC-LC138 1581 2P BG2NUC-LC139 1582 2P BG2NUC-LC140 1583 2P BG2NUC-LC141 1584 2P BG2NUC-LC142 1585 2P BG2NUC-LC143 1586 2P BG2NUC-LC144 1587 RBD BG2NUC-LC145 1588 RBD BG2NUC-LC146 1589 2P BG2NUC-LC147 1590 RBD BG2NUC-LC148 1591 2P BG2NUC-LC149 1592 2P BG2NUC-LC150 1593 2P BG2NUC-LC151 1594 2P BG2NUC-LC152 1595 2P BG2NUC-LC153 1596 2P BG2NUC-LC154 1597 2P BG2NUC-LC155 1598 2P BG2NUC-LC156 1599 RBD BG2NUC-LC157 1600 2P BG2NUC-LC158 1601 2P BG2NUC-LC159 1602 RBD BG2NUC-LC160 1603 2P BG2NUC-LC161 1604 2P BG2NUC-LC162 1605 RBD BG2NUC-LC163 1606 2P BG2NUC-LC164 1607 RBD BG2NUC-LC165 1608 RBD BG2NUC-LC166 1609 2P BG2NUC-LC167 1610 2P BG2NUC-LC168 1611 2P BG2NUC-LC169 1612 2P BG2NUC-LC170 1613 RBD BG2NUC-LC171 1614 2P BG2NUC-LC172 1615 2P BG2NUC-LC173 1616 2P BG2NUC-LC174 1617 RBD BG2NUC-LC175 1618 2P BG2NUC-LC176 1619 RBD BG2NUC-LC177 1620 RBD BG2NUC-LC178 1621 RBD BG2NUC-LC179 1622 2P BG2NUC-LC180 1623 RBD BG2NUC-LC181 1624 RBD BG2NUC-LC182 1625 2P BG2NUC-LC183 1626 2P BG2NUC-LC184 1627 RBD BG2NUC-LC185 1628 2P BG2NUC-LC186 1629 RBD BG2NUC-LC187 1630 2P BG2NUC-LC188 1631 2P BG2NUC-LC189 1632 2P BG2NUC-LC190 1633 2P BG2NUC-LC191 1634 RBD BG2NUC-LC192 1635 2P BG2NUC-LC193 1636 RBD BG2NUC-LC194 1637 2P BG2NUC-LC195 1638 2P BG2NUC-LC196 1639 RBD BG2NUC-LC197 1640 RBD BG2NUC-LC198 1641 2P BG2NUC-LC199 1642 2P BG2NUC-LC200 1643 RBD BG2NUC-LC201 1644 2P BG2NUC-LC202 1645 RBD BG2NUC-LC203 1646 2P BG2NUC-LC204 1647 RBD BG2NUC-LC205 1648 2P BG2NUC-LC206 1649 RBD BG2NUC-LC207 1650 2P BG2NUC-LC208 1651 2P BGZNUC-LC209 1652 2P BG2NUC-LC210 1653 RBD BG2NUC-LC211 1654 2P BG2NUC-LC212 1655 RBD BG2NUC-LC213 1656 2P BG2NUC-LC214 1657 RBD BG2NUC-LC215 1658 2P BG2NUC-LC216 1659 RBD BG2NUC-LC217 1660 RBD BG2NUC-LC218 1661 RBD BG2NUC-LC219 1662 2P BG2NUC-LC220 1663 RBD BG2NUC-LC221 1664 RBD BG2NUC-LC222 1665 RBD BG2NUC-LC223 1666 2P BG2NUC-LC224 1667 RBD BG2NUC-LC225 1668 2P BG2NUC-LC226 1669 2P BG2NUC-LC227 1670 2P BG2NUC-LC228 1671 RBD BG2NUC-LC229 1672 2P BG2NUC-LC230 1673 RBD BG2NUC-LC231 1674 2P BG2NUC-LC232 1675 2P BG2NUC-LC233 1676 2P BG2NUC-LC234 1677 RBD BG2NUC-LC235 1678 RBD BG2NUC-LC236 1679 2P BG2NUC-LC237 1680 RBD BG2NUC-LC238 1681 2P BG2NUC-LC239 1682 2P BG2NUC-LC240 1683 2P BG2NUC-LC241 1684 RBD BG2NUC-LC242 1685 2P BG2NUC-LC243 1686 RBD BG2NUC-LC244 1687 RBD BG2NUC-LC245 1688 2P BG2NUC-LC246 1689 RBD BG2NUC-LC247 1690 RBD BG2NUC-LC248 1691 2P BG2NUC-LC249 1692 2P BG2NUC-LC250 1693 2P BG2NUC-LC251 1694 RBD BG2NUC-LC252 1695 2P BG2NUC-LC253 1696 RBD BG2NUC-LC254 1697 2P BG2NUC-LC255 1698 RBD BG2NUC-LC256 1699 2P BG2NUC-LC257 1700 2P BG2NUC-LC258 1701 2P BG2NUC-LC259 1702 2P BG2NUC-LC260 1703 2P BG2NUC-LC261 1704 RBD BG2NUC-LC262 1705 2P BG2NUC-LC263 1706 RBD BG2NUC-LC264 1707 2P BG2NUC-LC265 1708 2P BG2NUC-LC266 1709 2P BG2NUC-LC267 1710 2P BG2NUC-LC268 1711 RBD BG2NUC-LC269 1712 2P BG2NUC-LC270 1713 2P BG2NUC-LC271 1714 2P BG2NUC-LC272 1715 2P BG2NUC-LC273 1716 2P BG2NUC-LC274 1717 2P BG2NUC-LC275 1718 2P BG2NUC-LC276 1719 2P BG2NUC-LC277 1720 2P BG2NUC-LC278 1721 2P BG2NUC-LC279 1722 RBD BG2NUC-LC280 1723 RBD BG2NUC-LC281 1724 RBD BG2NUC-LC282 1725 2P BG2NUC-LC283 1726 2P BG2NUC-LC284 1727 2P BG2NUC-LC285 1728 2P BG2NUC-LC286 1729 RBD BG2NUC-LC287 1730 2P BG2NUC-LC288 1731 2P BG2NUC-LC289 1732 RBD BG2NUC-LC290 1733 2P BG2NUC-LC291 1734 2P BG2NUC-LC292 1735 2P BG2NUC-LC293 1736 2P BG2NUC-LC294 1737 RBD BG2NUC-LC295 1738 2P BG2NUC-LC296 1739 2F BG2NUC-LC297 1740 RBD BG2NUC-LC298 1741 2P BG2NUC-LC299 1742 2P BG2NUC-LC300 1743 2P BG2NUC-LC301 1744 2P BG2NUC-LC302 1745 2P BG2NUC-LC303 1746 2P BG2NUC-LC304 1747 RBD BG2NUC-LC305 1748 2P BG2NUC-LC306 1749 2P BG2NUC-LC307 1750 2P BG2NUC-LC308 1751 2P BG2NUC-LC309 1752 RBD BG2NUC-LC310 1753 RBD BG2NUC-LC311 1754 RBD BG2NUC-LC312 1755 RBD BG2NUC-LC313 1756 RBD BG2NUC-LC314 1757 RBD BG2NUC-LC315 1758 2P BG2NUC-LC316 1759 RBD BG2NUC-LC317 1760 2P BG2NUC-LC318 1761 2P BG2NUC-LC319 1762 2P BG2NUC-LC320 1763 2P BG2NUC-LC321 1764 RBD BG2NUC-LC322 1765 RBD BG2NUC-LC323 1766 RBD BG2NUC-LC324 1767 RBD BG2NUC-LC325 1768 RBD BG2NUC-LC326 1769 2P BG2NUC-LC327 1770 2P BG2NUC-LC328 1771 2P BG2NUC-LC329 1772 2P BG2NUC-LC330 1773 2P BG2NUC-LC331 1774 2P BG2NUC-LC332 1775 2P BG2NUC-LC333 1776 RBD BG2NUC-LC334 1777 2P BG2NUC-LC335 1778 2P BG2NUC-LC336 1779 RBD BG2NUC-LC337 1780 2P BG2NUC-LC338 1781 2P BG2NUC-LC339 1782 2P BG2NUC-LC340 1783 2P BG2NUC-LC341 1784 2P BG2NUC-LC342 1785 2P BG2NUC-LC343 1786 2P BG2NUC-LC344 1787 RBD BG2NUC-LC345 1788 2P BG2NUC-LC346 1789 2P BG2NUC-LC347 1790 2P BG2NUC-LC348 1791 RBD BG2NUC-LC349 1792 RBD BG2NUC-LC350 1793 2P BG2NUC-LC351 1794 RBD BG2NUC-LC352 1795 RBD BG2NUC-LC353 1796 2P BG2NUC-LC354 1797 2P BG2NUC-LC355 1798 2P BG2NUC-LC356 1799 2P BG2NUC-LC357 1800 2P BG2NUC-LC358 1801 2P BG2NUC-LC359 1802 2P BG2NUC-LC360 1803 2P BG2NUC-LC361 1804 2P BG2NUC-LC362 1805 2P BG2NUC-LC363 1806 RBD BG2NUC-LC364 1807 2P BG2NUC-LC365 1808 2P BG2NUC-LC366 1809 2P BG2NUC-LC367 1810 RBD BG2NUC-LC368 1811 2P BG2NUC-LC369 1812 2P BG2NUC-LC370 1813 2P BG2NUC-LC371 1814 2P BG2NUC-LC372 1815 2P BG2NUC-LC373 1816 2P BG2NUC-LC374 1817 2P BG2NUC-LC375 1818 2P BG2NUC-LC376 1819 2P BG2NUC-LC377 1820 2P BG2NUC-LC378 1821 2P BG2NUC-LC379 1822 2P BG2NUC-LC380 1823 2P BG4NUC-HC1 1824 2P BG4NUC-HC2 1825 2P BG4NUC-HC3 1826 2P BG4NUC-HC4 1827 2P BG4NUC-HC5 1828 2P BG4NUC-HC6 1829 2P BG4NUC-HC7 1830 2P BG4NUC-HC8 1831 2P BG4NUC-HC9 1832 2P BG4NUC-HC10 1833 2P BG4NUC-HC11 1834 2P BG4NUC-HC12 1835 2P BG4NUC-HC13 1836 2P BG4NUC-HC14 1837 RBD BG4NUC-HC15 1838 2P BG4NUC-HC16 1839 2P BG4NUC-HC17 1840 2P BG4NUC-HC18 1841 RBD BG4NUC-HC19 1842 2P BG4NUC-HC20 1843 2P BG4NUC-HC21 1844 RBD BG4NUC-HC22 1845 RBD BG4NUC-HC23 1846 2P BG4NUC-HC24 1847 RBD BG4NUC-HC25 1848 RBD BG4NUC-HC26 1849 RBD BG4NUC-HC27 1850 RBD BG4NUC-HC28 1851 RBD BG4NUC-HC29 1852 RBD BG4NUC-HC30 1853 RBD BG4NUC-HC31 1854 RBD BG4NUC-HC32 1855 RBD BG4NUC-HC33 1856 RBD BG4NUC-HC34 1857 2P BG4NUC-HC35 1858 RBD BG4NUC-HC36 1859 RBD BG4NUC-HC37 1860 RBD BG4NUC-HC38 1861 2P BG4NUC-HC39 1862 2P BG4NUC-HC40 1863 2P BG4NUC-HC41 1864 RBD BG4NUC-HC42 1865 2P BG4NUC-HC43 1866 2P BG4NUC-HC44 1867 RBD BG4NUC-HC45 1868 2P BG4NUC-HC46 1869 2P BG4NUC-HC47 1870 RBD BG4NUC-HC48 1871 RBD BG4NUC-HC49 1872 2P BG4NUC-HC50 1873 RBD BG4NUC-HC51 1874 2P BG4NUC-HC52 1875 2P BG4NUC-HC53 1876 RBD BG4NUC-HC54 1877 2P BG4NUC-HC55 1878 2P BG4NUC-HC56 1879 2P BG4NUC-HC57 1880 RBD BG4NUC-HC58 1881 RBD BG4NUC-HC59 1882 2P BG4NUC-HC60 1883 2P BG4NUC-HC61 1884 2P BG4NUC-HC62 1885 RBD BG4NUC-HC63 1886 RBD BG4NUC-HC64 1887 RBD BG4NUC-HC65 1888 2P BG4NUC-HC66 1889 2P BG4NUC-HC67 1890 2P BG4NUC-HC68 1891 RBD BG4NUC-HC69 1892 2P BG4NUC-HC70 1893 RBD BG4NUC-HC71 1894 2P BG4NUC-HC72 1895 RBD BG4NUC-HC73 1896 2P BG4NUC-HC74 1897 RBD BG4NUC-HC75 1898 2P BG4NUC-HC76 1899 2P BG4NUC-HC77 1900 2P BG4NUC-HC78 1901 2P BG4NUC-HC79 1902 RBD BG4NUC-HC80 1903 RBD BG4NUC-HC81 1904 RBD BG4NUC-HC82 1905 RBD BG4NUC-HC83 1906 2P BG4NUC-HC84 1907 2P BG4NUC-HC85 1908 2P BG4NUC-HC86 1909 2P BG4NUC-HC87 1910 2P BG4NUC-HC88 1911 RBD BG4NUC-HC89 1912 RBD BG4NUC-HC90 1913 2P BG4NUC-HC91 1914 2P BG4NUC-HC92 1915 2P BG4NUC-HC93 1916 RBD BG4NUC-HC94 1917 2P BG4NUC-HC95 1918 RBD BG4NUC-HC96 1919 RBD BG4NUC-HC97 1920 RBD BG4NUC-HC98 1921 2P BG4NUC-HC99 1922 2P BG4NUC-HC100 1923 2P BG4NUC-HC101 1924 RBD BG4NUC-HC102 1925 2P BG4NUC-HC103 1926 2P BG4NUC-HC104 1927 2P BG4NUC-HC105 1928 2P BG4NUC-HC106 1929 2P BG4NUC-HC107 1930 2P BG4NUC-HC108 1931 2P BG4NUC-HC109 1932 2P BG4NUC-HC110 1933 2P BG4NUC-HC111 1934 2P BG4NUC-HC112 1935 RBD BG4NUC-HC113 1936 RBD BG4NUC-HC114 1937 RBD BG4NUC-HC115 1938 2P BG4NUC-HC116 1939 RBD BG4NUC-HC117 1940 2P BG4NUC-HC118 1941 2P BG4NUC-HC119 1942 2P BG4NUC-HC120 1943 RBD BG4NUC-HC121 1944 2P BG4NUC-HC122 1945 RBD BG4NUC-HC123 1946 2P BG4NUC-HC124 1947 RBD BG4NUC-HC125 1948 RBD BG4NUC-HC126 1949 2P BG4NUC-HC127 1950 RBD BG4NUC-HC128 1951 RBD BG4NUC-HC129 1952 2P BG4NUC-HC130 1953 2P BG4NUC-HC131 1954 2P BG4NUC-HC132 1955 2P BG4NUC-HC133 1956 RBD BG4NUC-HC134 1957 2P BG4NUC-HC135 1958 2P BG4NUC-HC136 1959 2P BG4NUC-HC137 1960 2P BG4NUC-HC138 1961 2P BG4NUC-HC139 1962 2P BG4NUC-HC140 1963 2P BG4NUC-HC141 1964 2P BG4NUC-HC142 1965 2P BG4NUC-HC143 1966 RBD BG4NUC-HC144 1967 2P BG4NUC-HC145 1968 2P BG4NUC-HC146 1969 2P BG4NUC-HC147 1970 2P BG4NUC-HC148 1971 2P BG4NUC-HC149 1972 2P BG4NUC-HC150 1973 2P BG4NUC-HC151 1974 2P BG4NUC-HC152 1975 2P BG4NUC-HC153 1976 2P BG4NUC-HC154 1977 2P BG4NUC-HC155 1978 RBD BG4NUC-HC156 1979 2P BG4NUC-HC157 1980 RBD BG4NUC-HC158 1981 2P BG4NUC-HC159 1982 RBD BG4NUC-HC160 1983 RBD BG4NUC-HC161 1984 RBD BG4NUC-HC162 1985 2P BG4NUC-HC163 1986 RBD BG4NUC-HC164 1987 RBD BG4NUC-HC165 1988 RBD BG4NUC-HC166 1989 RBD BG4NUC-HC167 1990 2P BG4NUC-HC168 1991 2P BG4NUC-HC169 1992 2P BG4NUC-HC170 1993 RBD BG4NUC-HC171 1994 2P BG4NUC-HC172 1995 2P BG4NUC-HC173 1996 RBD BG4NUC-HC174 1997 2P BG4NUC-HC175 1998 RBD BG4NUC-HC176 1999 2P BG4NUC-HC177 2000 2P BG4NUC-HC178 2001 2P BG4NUC-HC179 2002 RBD BG4NUC-HC180 2003 2P BG4NUC-HC181 2004 RBD BG4NUC-HC182 2005 2P BG4NUC-HC183 2006 2P BG4NUC-HC184 2007 2P BG4NUC-HC185 2008 2P BG4NUC-HC186 2009 2P BG4NUC-HC187 2010 2P BG4NUC-HC188 2011 2P BG4NUC-HC189 2012 2P BG4NUC-HC190 2013 2P BG4NUC-HC191 2014 2P BG4NUC-HC192 2015 RBD BG4NUC-HC193 2016 2P BG4NUC-HC194 2017 RBD BG4NUC-HC195 2018 RBD BG4NUC-HC196 2019 RBD BG4NUC-HC197 2020 2P BG4NUC-HC198 2021 2P BG4NUC-HC199 2022 2P BG4NUC-HC200 2023 2P BG4NUC-HC201 2024 2P BG4NUC-HC202 2025 2P BG4NUC-HC203 2026 2P BG4NUC-HC204 2027 2P BG4NUC-HC205 2028 2P BG4NUC-HC206 2029 2P BG4NUC-HC207 2030 2P BG4NUC-HC208 2031 2P BG4NUC-HC209 2032 RBD BG4NUC-HC210 2033 RBD BG4NUC-HC211 2034 RBD BG4NUC-HC212 2035 2P BG4NUC-HC213 2036 2P BG4NUC-HC214 2037 2P BG4NUC-HC215 2038 2P BG4NUC-HC216 2039 RBD BG4NUC-HC217 2040 2P BG4NUC-HC218 2041 RBD BG4NUC-HC219 2042 RBD BG4NUC-HC220 2043 2P BG4NUC-HC221 2044 RBD BG4NUC-HC222 2045 RBD BG4NUC-HC223 2046 2P BG4NUC-HC224 2047 RBD BG4NUC-HC225 2048 RBD BG4NUC-HC226 2049 2P BG4NUC-HC227 2050 RBD BG4NUC-HC228 2051 2P BG4NUC-HC229 2052 2P BG4NUC-HC230 2053 RBD BG4NUC-HC231 2054 2P BG4NUC-HC232 2055 2P BG4NUC-HC233 2056 2P BG4NUC-HC234 2057 RBD BG4NUC-HC235 2058 RBD BG4NUC-HC236 2059 2P BG4NUC-HC237 2060 2P BG4NUC-HC238 2061 2P BG4NUC-HC239 2062 2P BG4NUC-HC240 2063 2P BG4NUC-HC241 2064 2P BG4NUC-HC242 2065 2P BG4NUC-HC243 2066 2P BG4NUC-HC244 2067 2P BG4NUC-HC245 2068 2P BG4NUC-HC246 2069 RBD BG4NUC-HC247 2070 RBD BG4NUC-HC248 2071 RBD BG4NUC-HC249 2072 RBD BG4NUC-HC250 2073 2P BG4NUC-HC251 2074 2P BG4NUC-HC252 2075 2F BG4NUC-HC253 2076 RBD BG4NUC-HC254 2077 2P BG4NUC-HC255 2078 RBD BG4NUC-HC256 2079 RBD BG4NUC-HC257 2080 RBD BG4NUC-HC258 2081 2P BG4NUC-HC259 2082 RBD BG4NUC-HC260 2083 2F BG4NUC-HC261 2084 RBD BG4NUC-HC262 2085 RBD BG4NUC-HC263 2086 RBD BG4NUC-HC264 2087 2F BG4NUC-HC265 2088 RBD BG4NUC-HC266 2089 2P BG4NUC-HC267 2090 2P BG4NUC-HC268 2091 RBD BG4NUC-HC269 2092 RBD BG4NUC-HC270 2093 RBD BG4NUC-HC271 2094 2P BG4NUC-HC272 2095 RBD BG4NUC-HC273 2096 2P BG4NUC-HC274 2097 2P BG4NUC-HC275 2098 RBD BG4NUC-HC276 2099 RBD BG4NUC-HC277 2100 RBD BG4NUC-HC278 2101 2P BG4NUC-HC279 2102 RBD BG4NUC-HC280 2103 RBD BG4NUC-HC281 2104 2P BG4NUC-HC282 2105 2P BG4NUC-HC283 2106 2P BG4NUC-HC284 2107 RBD BG4NUC-HC285 2108 2P BG4NUC-HC286 2109 2P BG4NUC-HC287 2110 RBD BG4NUC-HC288 2111 2P BG4NUC-HC289 2112 2P BG4NUC-HC290 2113 RBD BG4NUC-HC291 2114 2P BG4NUC-HC292 2115 RBD BG4NUC-HC293 2116 2P BG4NUC-HC294 2117 RBD BG4NUC-HC295 2118 2P BG4NUC-HC296 2119 RBD BG4NUC-HC297 2120 2P BG4NUC-HC298 2121 2P BG4NUC-HC299 2122 2P BG4NUC-HC300 2123 2P BG4NUC-HC301 2124 2P BG4NUC-HC302 2125 2P BG4NUC-HC303 2126 2F BG4NUC-HC304 2127 2P BG4NUC-HC305 2128 RBD BG4NUC-HC306 2129 2P BG4NUC-HC307 2130 2P BG4NUC-HC308 2131 2P BG4NUC-HC309 2132 2P BG4NUC-HC310 2133 RBD BG4NUC-HC311 2134 2P BG4NUC-HC312 2135 2F BG4NUC-HC313 2136 2P BG4NUC-HC314 2137 2P BG4NUC-HC315 2138 2F BG4NUC-HC316 2139 RBD BG4NUC-HC317 2140 RBD BG4NUC-HC318 2141 2P BG4NUC-HC319 2142 2P BG4NUC-HC320 2143 2P BG4NUC-HC321 2144 RBD BG4NUC-HC322 2145 2P BG4NUC-HC323 2146 RBD BG4NUC-HC324 2147 2P BG4NUC-HC325 2148 RBD BG4NUC-HC326 2149 RBD BG4NUC-HC327 2150 RBD BG4NUC-HC328 2151 2P BG4NUC-HC329 2152 2P BG4NUC-HC330 2153 RBD BG4NUC-HC331 2154 2P BG4NUC-HC332 2155 2P BG4NUC-HC333 2156 2P BG4NUC-HC334 2157 2P BG4NUC-HC335 2158 RBD BG4NUC-HC336 2159 2P BG4NUC-HC337 2160 RBD BG4NUC-HC338 2161 2P BG4NUC-HC339 2162 RBD BG4NUC-HC340 2163 2P BG4NUC-HC341 2164 RBD BG4NUC-HC342 2165 RBD BG4NUC-HC343 2166 RBD BG4NUC-HC344 2167 2P BG4NUC-HC345 2168 RBD BG4NUC-HC346 2169 2P BG4NUC-HC347 2170 RBD BG4NUC-HC348 2171 2P BG4NUC-HC349 2172 2P BG4NUC-HC350 2173 2P BG4NUC-HC351 2174 2P BG4NUC-HC352 2175 RBD BG4NUC-HC353 2176 RBD BG4NUC-HC354 2177 RBD BG4NUC-HC355 2178 2P BG4NUC-HC356 2179 2P BG4NUC-HC357 2180 RBD BG4NUC-HC358 2181 RBD BG4NUC-HC359 2182 RBD BG4NUC-HC360 2183 RBD BG4NUC-HC361 2184 RBD BG4NUC-HC362 2185 2P BG4NUC-HC363 2186 2P BG4NUC-HC364 2187 RBD BG4NUC-HC365 2188 2P BG4NUC-HC366 2189 2P BG4NUC-HC367 2190 2P BG4NUC-HC368 2191 2P BG4NUC-HC369 2192 2P BG4NUC-HC370 2193 2P BG4NUC-HC371 2194 2P BG4NUC-HC372 2195 2P BG4NUC-HC373 2196 2P BG4NUC-HC374 2197 RBD BG4NUC-HC375 2198 2P BG4NUC-HC376 2199 2P BG4NUC-HC377 2200 2P BG4NUC-HC378 2201 RBD BG4NUC-HC379 2202 2P BG4NUC-HC380 2203 2P BG4NUC-HC381 2204 2P BG4NUC-HC382 2205 2P BG4NUC-HC383 2206 2P BG4NUC-HC384 2207 2P BG4NUC-HC385 2208 RBD BG4NUC-HC386 2209 RBD BG4NUC-HC387 2210 2P BG4NUC-HC388 2211 2P BG4NUC-HC389 2212 2P BG4NUC-HC390 2213 2P BG4NUC-HC391 2214 2P BG4NUC-HC392 2215 2P BG4NUC-HC393 2216 RBD BG4NUC-HC394 2217 2P BG4NUC-HC395 2218 2P BG4NUC-HC396 2219 2P BG4NUC-HC397 2220 2P BG4NUC-HC398 2221 2P BG4NUC-HC399 2222 RBD BG4NUC-HC400 2223 RBD BG4NUC-HC401 2224 2P BG4NUC-HC402 2225 2P BG4NUC-HC403 2226 2F BG4NUC-HC404 2227 RBD BG4NUC-HC405 2228 2P BG4NUC-HC406 2229 RBD BG4NUC-HC407 2230 2P BG4NUC-HC408 2231 2P BG4NUC-HC409 2232 2P BG4NUC-LC1 2233 2P BG4NUC-LC2 2234 2P BG4NUC-LC3 2235 2P BG4NUC-LC4 2236 2P BG4NUC-LC5 2237 2P BG4NUC-LC6 2238 2P BG4NUC-LC7 2239 2F BG4NUC-LC8 2240 2F BG4NUC-LC9 2241 2P BG4NUC-LC10 2242 2P BG4NUC-LC11 2243 2P BG4NUC-LC12 2244 2F BG4NUC-LC13 2245 2P BG4NUC-LC14 2246 RBD BG4NUC-LC15 2247 2P BG4NUC-LC16 2248 2P BG4NUC-LC17 2249 2P BG4NUC-LC18 2250 RBD BG4NUC-LC19 2251 2P BG4NUC-LC20 2252 2P BG4NUC-LC21 2253 RBD BG4NUC-LC22 2254 RBD BG4NUC-LC23 2255 2P BG4NUC-LC24 2256 RBD BG4NUC-LC25 2257 RBD BG4NUC-LC26 2258 RBD BG4NUC-LC27 2259 RBD BG4NUC-LC28 2260 RBD BG4NUC-LC29 2261 RBD BG4NUC-LC30 2262 RBD BG4NUC-LC31 2263 RBD BG4NUC-LC32 2264 RBD BG4NUC-LC33 2265 RBD BG4NUC-LC34 2266 2P BG4NUC-LC35 2267 RBD BG4NUC-LC36 2268 RBD BG4NUC-LC37 2269 RBD BG4NUC-LC38 2270 2P BG4NUC-LC39 2271 2P BG4NUC-LC40 2272 2P BG4NUC-LC41 2273 RBD BG4NUC-LC42 2274 2P BG4NUC-LC43 2275 2P BG4NUC-LC44 2276 RBD BG4NUC-LC45 2277 2P BG4NUC-LC46 2278 2P BG4NUC-LC47 2279 RBD BG4NUC-LC48 2280 RBD BG4NUC-LC49 2281 2P BG4NUC-LC50 2282 RBD BG4NUC-LC51 2283 2P BG4NUC-LC52 2284 2P BG4NUC-LC53 2285 RBD BG4NUC-LC54 2286 2P BG4NUC-LC55 2287 2P BG4NUC-LC56 2288 2P BG4NUC-LC57 2289 RBD BG4NUC-LC58 2290 RBD BG4NUC-LC59 2291 2P BG4NUC-LC60 2292 2P BG4NUC-LC61 2293 2P BG4NUC-LC62 2294 RBD BG4NUC-LC63 2295 RBD BG4NUC-LC64 2296 RBD BG4NUC-LC65 2297 2P BG4NUC-LC66 2298 2P BG4NUC-LC67 2299 2P BG4NUC-LC68 2300 RBD BG4NUC-LC69 2301 2P BG4NUC-LC70 2302 RBD BG4NUC-LC71 2303 2P BG4NUC-LC72 2304 RBD BG4NUC-LC73 2305 2P BG4NUC-LC74 2306 RBD BG4NUC-LC75 2307 2P BG4NUC-LC76 2308 2P BG4NUC-LC77 2309 2P BG4NUC-LC78 2310 2P BG4NUC-LC79 2311 RBD BG4NUC-LC80 2312 RBD BG4NUC-LC81 2313 RBD BG4NUC-LC82 2314 RBD BG4NUC-LC83 2315 2P BG4NUC-LC84 2316 2P BG4NUC-LC85 2317 2P BG4NUC-LC86 2318 2P BG4NUC-LC87 2319 2P BG4NUC-LC88 2320 RBD BG4NUC-LC89 2321 RBD BG4NUC-LC90 2322 2P BG4NUC-LC91 2323 2P BG4NUC-LC92 2324 2P BG4NUC-LC93 2325 RBD BG4NUC-LC94 2326 2P BG4NUC-LC95 2327 RBD BG4NUC-LC96 2328 RBD BG4NUC-LC97 2329 RBD BG4NUC-LC98 2330 2P BG4NUC-LC99 2331 2P BG4NUC-LC100 2332 2P BG4NUC-LC101 2333 RBD BG4NUC-LC102 2334 2P BG4NUC-LC103 2335 2P BG4NUC-LC104 2336 2P BG4NUC-LC105 2337 2P BG4NUC-LC106 2338 2P BG4NUC-LC107 2339 2P BG4NUC-LC108 2340 2P BG4NUC-LC109 2341 2P BG4NUC-LC110 2342 2P BG4NUC-LC111 2343 2P BG4NUC-LC112 2344 RBD BG4NUC-LC113 2345 RBD BG4NUC-LC114 2346 RBD BG4NUC-LC115 2347 2P BG4NUC-LC116 2348 RBD BG4NUC-LC117 2349 2P BG4NUC-LC118 2350 2P BG4NUC-LC119 2351 2P BG4NUC-LC120 2352 RBD BG4NUC-LC121 2353 2P BG4NUC-LC122 2354 RBD BG4NUC-LC123 2355 2P BG4NUC-LC124 2356 RBD BG4NUC-LC125 2357 RBD BG4NUC-LC126 2358 2P BG4NUC-LC127 2359 RBD BG4NUC-LC128 2360 RBD BG4NUC-LC129 2361 2P BG4NUC-LC130 2362 2P BG4NUC-LC131 2363 2P BG4NUC-LC132 2364 2P BG4NUC-LC133 2365 RBD BG4NUC-LC134 2366 2P BG4NUC-LC135 2367 2P BG4NUC-LC136 2368 2P BG4NUC-LC137 2369 2P BG4NUC-LC138 2370 2P BG4NUC-LC139 2371 2P BG4NUC-LC140 2372 2P BG4NUC-LC141 2373 2P BG4NUC-LC142 2374 2P BG4NUC-LC143 2375 RBD BG4NUC-LC144 2376 2P BG4NUC-LC145 2377 2P BG4NUC-LC146 2378 2P BG4NUC-LC147 2379 2P BG4NUC-LC148 2380 2P BG4NUC-LC149 2381 2P BG4NUC-LC150 2382 2P BG4NUC-LC151 2383 2P BG4NUC-LC152 2384 2P BG4NUC-LC153 2385 2P BG4NUC-LC154 2386 2P BG4NUC-LC155 2387 RBD BG4NUC-LC156 2388 2P BG4NUC-LC157 2389 RBD BG4NUC-LC158 2390 2P BG4NUC-LC159 2391 RBD BG4NUC-LC160 2392 RBD BG4NUC-LC161 2393 RBD BG4NUC-LC162 2394 2P BG4NUC-LC163 2395 RBD BG4NUC-LC164 2396 RBD BG4NUC-LC165 2397 RBD BG4NUC-LC166 2398 RBD BG4NUC-LC167 2399 2P BG4NUC-LC168 2400 2P BG4NUC-LC169 2401 2P BG4NUC-LC170 2402 RBD BG4NUC-LC171 2403 2P BG4NUC-LC172 2404 2P BG4NUC-LC173 2405 RBD BG4NUC-LC174 2406 2P BG4NUC-LC175 2407 RBD BG4NUC-LC176 2408 2P BG4NUC-LC177 2409 2P BG4NUC-LC178 2410 2P BG4NUC-LC179 2411 RBD BG4NUC-LC180 2412 2P BG4NUC-LC181 2413 RBD BG4NUC-LC182 2414 2P BG4NUC-LC183 2415 2P BG4NUC-LC184 2416 2P BG4NUC-LC185 2417 2P BG4NUC-LC186 2418 2P BG4NUC-LC187 2419 2P BG4NUC-LC188 2420 2P BG4NUC-LC189 2421 2P BG4NUC-LC190 2422 2P BG4NUC-LC191 2423 2P BG4NUC-LC192 2424 RBD BG4NUC-LC193 2425 2P BG4NUC-LC194 2426 RBD BG4NUC-LC195 2427 RBD BG4NUC-LC196 2428 RBD BG4NUC-LC197 2429 2P BG4NUC-LC198 2430 2P BG4NUC-LC199 2431 2P BG4NUC-LC200 2432 2P BG4NUC-LC201 2433 2P BG4NUC-LC202 2434 2P BG4NUC-LC203 2435 2P BG4NUC-LC204 2436 2P BG4NUC-LC205 2437 2P BG4NUC-LC206 2438 2P BG4NUC-LC207 2439 2P BG4NUC-LC208 2440 2P BG4NUC-LC209 2441 RBD BG4NUC-LC210 2442 RBD BG4NUC-LC211 2443 RBD BG4NUC-LC212 2444 2P BG4NUC-LC213 2445 2P BG4NUC-LC214 2446 2P BG4NUC-LC215 2447 2P BG4NUC-LC216 2448 RBD BG4NUC-LC217 2449 2P BG4NUC-LC218 2450 RBD BG4NUC-LC219 2451 RBD BG4NUC-LC220 2452 2P BG4NUC-LC221 2453 RBD BG4NUC-LC222 2454 RBD BG4NUC-LC223 2455 2P BG4NUC-LC224 2456 RBD BG4NUC-LC225 2457 RBD BG4NUC-LC226 2458 2P BG4NUC-LC227 2459 RBD BG4NUC-LC228 2460 2P BG4NUC-LC229 2461 2P BG4NUC-LC230 2462 RBD BG4NUC-LC231 2463 2P BG4NUC-LC232 2464 2P BG4NUC-LC233 2465 2P BG4NUC-LC234 2466 RBD BG4NUC-LC235 2467 RBD BG4NUC-LC236 2468 2P BG4NUC-LC237 2469 2P BG4NUC-LC238 2470 2P BG4NUC-LC239 2471 2P BG4NUC-LC240 2472 2P BG4NUC-LC241 2473 2P BG4NUC-LC242 2474 2P BG4NUC-LC243 2475 2P BG4NUC-LC244 2476 2P BG4NUC-LC245 2477 2P BG4NUC-LC246 2478 RBD BG4NUC-LC247 2479 RBD BG4NUC-LC248 2480 RBD BG4NUC-LC249 2481 RBD BG4NUC-LC250 2482 2P BG4NUC-LC251 2483 2P BG4NUC-LC252 2484 2P BG4NUC-LC253 2485 RBD BG4NUC-LC254 2486 2P BG4NUC-LC255 2487 RBD BG4NUC-LC256 2488 RBD BG4NUC-LC257 2489 RBD BG4NUC-LC258 2490 2P BG4NUC-LC259 2491 RBD BG4NUC-LC260 2492 2P BG4NUC-LC261 2493 RBD BG4NUC-LC262 2494 RBD BG4NUC-LC263 2495 RBD BG4NUC-LC264 2496 2P BG4NUC-LC265 2497 RBD BG4NUC-LC266 2498 2P BG4NUC-LC267 2499 2P BG4NUC-LC268 2500 RBD BG4NUC-LC269 2501 RBD BG4NUC-LC270 2502 RBD BG4NUC-LC271 2503 2P BG4NUC-LC272 2504 RBD BG4NUC-LC273 2505 2P BG4NUC-LC274 2506 2P BG4NUC-LC275 2507 RBD BG4NUC-LC276 2508 RBD BG4NUC-LC277 2509 RBD BG4NUC-LC278 2510 2P BG4NUC-LC279 2511 RBD BG4NUC-LC280 2512 RBD BG4NUC-LC281 2513 2P BG4NUC-LC282 2514 2P BG4NUC-LC283 2515 2P BG4NUC-LC284 2516 RBD BG4NUC-LC285 2517 2P BG4NUC-LC286 2518 2P BG4NUC-LC287 2519 RBD BG4NUC-LC288 2520 2P BG4NUC-LC289 2521 2P BG4NUC-LC290 2522 RBD BG4NUC-LC291 2523 2F BG4NUC-LC292 2524 RBD BG4NUC-LC293 2525 2P BG4NUC-LC294 2526 RBD BG4NUC-LC295 2527 2P BG4NUC-LC296 2528 RBD BG4NUC-LC297 2529 2P BG4NUC-LC298 2530 2P BG4NUC-LC299 2531 2P BG4NUC-LC300 2532 2P BG4NUC-LC301 2533 2P BG4NUC-LC302 2534 2P BG4NUC-LC303 2535 2P BG4NUC-LC304 2536 2P BG4NUC-LC305 2537 RBD BG4NUC-LC306 2538 2P BG4NUC-LC307 2539 2P BG4NUC-LC308 2540 2P BG4NUC-LC309 2541 2P BG4NUC-LC310 2542 RBD BG4NUC-LC311 2543 2P BG4NUC-LC312 2544 2P BG4NUC-LC313 2545 2P BG4NUC-LC314 2546 2P BG4NUC-LC315 2547 2P BG4NUC-LC316 2548 RBD BG4NUC-LC317 2549 RBD BG4NUC-LC318 2550 2P BG4NUC-LC319 2551 2P BG4NUC-LC320 2552 2P BG4NUC-LC321 2553 RBD BG4NUC-LC322 2554 2P BG4NUC-LC323 2555 RBD BG4NUC-LC324 2556 2P BG4NUC-LC325 2557 RBD BG4NUC-LC326 2558 RBD BG4NUC-LC327 2559 RBD BG4NUC-LC328 2560 2P BG4NUC-LC329 2561 2P BG4NUC-LC330 2562 RBD BG4NUC-LC331 2563 2P BG4NUC-LC332 2564 2P BG4NUC-LC333 2565 2P BG4NUC-LC334 2566 2F BG4NUC-LC335 2567 RBD BG4NUC-LC336 2568 2P BG4NUC-LC337 2569 RBD BG4NUC-LC338 2570 2P BG4NUC-LC339 2571 RBD BG4NUC-LC340 2572 2P BG4NUC-LC341 2573 RBD BG4NUC-LC342 2574 RBD BG4NUC-LC343 2575 RBD BG4NUC-LC344 2576 2P BG4NUC-LC345 2577 RBD BG4NUC-LC346 2578 2P BG4NUC-LC347 2579 RBD BG4NUC-LC348 2580 2P BG4NUC-LC349 2581 2P BG4NUC-LC350 2582 2P BG4NUC-LC351 2583 2P BG4NUC-LC352 2584 RBD BG4NUC-LC353 2585 RBD BG4NUC-LC354 2586 RBD BG4NUC-LC355 2587 2P BG4NUC-LC356 2588 2P BG4NUC-LC357 2589 RBD BG4NUC-LC358 2590 RBD BG4NUC-LC359 2591 RBD BG4NUC-LC360 2592 RBD BG4NUC-LC361 2593 RBD BG4NUC-LC362 2594 2P BG4NUC-LC363 2595 2P BG4NUC-LC364 2596 RBD BG4NUC-LC365 2597 2P BG4NUC-LC366 2598 2P BG4NUC-LC367 2599 2P BG4NUC-LC368 2600 2P BG4NUC-LC369 2601 2P BG4NUC-LC370 2602 2P BG4NUC-LC371 2603 2P BG4NUC-LC372 2604 2P BG4NUC-LC373 2605 2P BG4NUC-LC374 2606 RBD BG4NUC-LC375 2607 2P BG4NUC-LC376 2608 2P BG4NUC-LC377 2609 2P BG4NUC-LC378 2610 RBD BG4NUC-LC379 2611 2P BG4NUC-LC380 2612 2P BG4NUC-LC381 2613 2P BG4NUC-LC382 2614 2P BG4NUC-LC383 2615 2P BG4NUC-LC384 2616 2P BG4NUC-LC385 2617 RBD BG4NUC-LC386 2618 RBD BG4NUC-LC387 2619 2P BG4NUC-LC388 2620 2P BG4NUC-LC389 2621 2P BG4NUC-LC390 2622 2P BG4NUC-LC391 2623 2P BG4NUC-LC392 2624 2P BG4NUC-LC393 2625 RBD BG4NUC-LC394 2626 2P BG4NUC-LC395 2627 2P BG4NUC-LC396 2628 2P BG4NUC-LC397 2629 2P BG4NUC-LC398 2630 2P BG4NUC-LC399 2631 RBD BG4NUC-LC400 2632 RBD BG4NUC-LC401 2633 2P BG4NUC-LC402 2634 2P BG4NUC-LC403 2635 2P BG4NUC-LC404 2636 RBD BG4NUC-LC405 2637 2P BG4NUC-LC406 2638 RBD BG4NUC-LC407 2639 2P BG4NUC-LC408 2640 2P BG4NUC-LC409 2641 2P BG5NUC-HC1 2642 RBD BG5NUC-HC2 2643 RBD BG5NUC-HC3 2644 2P BG5NUC-HC4 2645 RBD BG5NUC-HC5 2646 2P BG5NUC-HC6 2647 RBD BG5NUC-HC7 2648 2P BG5NUC-HC8 2649 RBD BG5NUC-HC9 2650 2P BG5NUC-HC10 2651 RBD BG5NUC-HC11 2652 2P BG5NUC-HC12 2653 2P BG5NUC-HC13 2654 2P BG5NUC-HC14 2655 2P BG5NUC-HC15 2656 RBD BG5NUC-HC16 2657 RBD BG5NUC-HC17 2658 2P BG5NUC-HC18 2659 RBD BG5NUC-HC19 2660 RBD BG5NUC-HC20 2661 2P BG5NUC-HC21 2662 RBD BG5NUC-HC22 2663 2P BG5NUC-HC23 2664 RBD BG5NUC-HC24 2665 RBD BG5NUC-HC25 2666 2F BG5NUC-HC26 2667 RBD BG5NUC-HC27 2668 RBD BG5NUC-HC28 2669 RBD BG5NUC-HC29 2670 RBD BG5NUC-HC30 2671 RBD BG5NUC-HC31 2672 2P BG5NUC-HC32 2673 RBD BG5NUC-HC33 2674 RBD BG5NUC-HC34 2675 2P BG5NUC-HC35 2676 RBD BG5NUC-HC36 2677 RBD BG5NUC-HC37 2678 2P BG5NUC-HC38 2679 2P BG5NUC-HC39 2680 2P BG5NUC-HC40 2681 2P BG5NUC-HC41 2682 2P BG5NUC-HC42 2683 2P BG5NUC-HC43 2684 RBD BG5NUC-HC44 2685 2P BG5NUC-HC45 2686 2P BG5NUC-HC46 2687 RBD BG5NUC-HC47 2688 RBD BG5NUC-HC48 2689 RBD BG5NUC-HC49 2690 RBD BG5NUC-HC50 2691 2P BG5NUC-HC51 2692 2P BG5NUC-HC52 2693 2P BG5NUC-HC53 2694 2P BG5NUC-HC54 2695 2P BG5NUC-HC55 2696 2P BG5NUC-HC56 2697 2P BG5NUC-HC57 2698 2P BG5NUC-HC58 2699 2P BG5NUC-HC59 2700 2P BG5NUC-HC60 2701 RBD BG5NUC-HC61 2702 RBD BG5NUC-HC62 2703 RBD BG5NUC-HC63 2704 RBD BG5NUC-HC64 2705 RBD BG5NUC-HC65 2706 RBD BG5NUC-HC66 2707 RBD BG5NUC-HC67 2708 RBD BG5NUC-HC68 2709 RBD BG5NUC-HC69 2710 RBD BG5NUC-HC70 2711 2P BG5NUC-HC71 2712 RBD BG5NUC-HC72 2713 2P BG5NUC-HC73 2714 2P BG5NUC-HC74 2715 2P BG5NUC-HC75 2716 2P BG5NUC-HC76 2717 2P BG5NUC-HC77 2718 2P BG5NUC-HC78 2719 2P BG5NUC-HC79 2720 2P BG5NUC-HC80 2721 2P BG5NUC-HC81 2722 2P BG5NUC-HC82 2723 2P BG5NUC-HC83 2724 2P BG5NUC-HC84 2725 2P BG5NUC-HC85 2726 2P BG5NUC-HC86 2727 2P BG5NUC-HC87 2728 2P BG5NUC-HC88 2729 2P BG5NUC-HC89 2730 2P BG5NUC-HC90 2731 2P BG5NUC-HC91 2732 2P BG5NUC-HC92 2733 2P BG5NUC-HC93 2734 2P BG5NUC-HC94 2735 2P BG5NUC-HC95 2736 2P BG5NUC-HC96 2737 RBD BG5NUC-HC97 2738 RBD BG5NUC-HC98 2739 RBD BG5NUC-HC99 2740 RBD BG5NUC-HC100 2741 2P BG5NUC-HC101 2742 2P BG5NUC-HC102 2743 2P BG5NUC-HC103 2744 2P BG5NUC-HC104 2745 RBD BG5NUC-HC105 2746 RBD BG5NUC-HC106 2747 2P BG5NUC-HC107 2748 RBD BG5NUC-HC108 2749 2P BG5NUC-HC109 2750 RBD BG5NUC-HC110 2751 2P BG5NUC-HC111 2752 RBD BG5NUC-HC112 2753 2P BG5NUC-HC113 2754 2P BG5NUC-HC114 2755 2P BG5NUC-HC115 2756 2P BG5NUC-HC116 2757 RBD BG5NUC-HC117 2758 2P BG5NUC-HC118 2759 2P BG5NUC-HC119 2760 2P BG5NUC-HC120 2761 RBD BG5NUC-HC121 2762 RBD BG5NUC-HC122 2763 2P BG5NUC-HC123 2764 2P BG5NUC-HC124 2765 2P BG5NUC-HC125 2766 2P BG5NUC-HC126 2767 2P BG5NUC-HC127 2768 2P BG5NUC-HC128 2769 RBD BG5NUC-HC129 2770 2P BG5NUC-HC130 2771 RBD BG5NUC-HC131 2772 2P BG5NUC-HC132 2773 RBD BG5NUC-HC133 2774 RBD BG5NUC-HC134 2775 2P BG5NUC-HC135 2776 2P BG5NUC-HC136 2777 2P BG5NUC-HC137 2778 2P BG5NUC-HC138 2779 2P BG5NUC-HC139 2780 2P BG5NUC-HC140 2781 2P BG5NUC-HC141 2782 2P BG5NUC-HC142 2783 2P BG5NUC-HC143 2784 RBD BG5NUC-HC144 2785 2P BG5NUC-HC145 2786 2P BG5NUC-HC146 2787 2P BG5NUC-HC147 2788 2P BG5NUC-HC148 2789 2P BG5NUC-HC149 2790 2P BG5NUC-HC150 2791 2P BG5NUC-HC151 2792 2P BG5NUC-HC152 2793 2P BG5NUC-HC153 2794 2P BG5NUC-HC154 2795 2P BG5NUC-HC155 2796 RBD BG5NUC-HC156 2797 RBD BG5NUC-HC157 2798 2P BG5NUC-HC158 2799 2P BG5NUC-HC159 2800 2P BG5NUC-HC160 2801 2P BG5NUC-HC161 2802 2P BG5NUC-HC162 2803 RBD BG5NUC-HC163 2804 2P BG5NUC-HC164 2805 2P BG5NUC-HC165 2806 RBD BG5NUC-HC166 2807 2P BG5NUC-HC167 2808 2P BG5NUC-HC168 2809 2P BG5NUC-HC169 2810 RBD BG5NUC-HC170 2811 RBD BG5NUC-HC171 2812 RBD BG5NUC-HC172 2813 2P BG5NUC-HC173 2814 2P BG5NUC-HC174 2815 2P BG5NUC-HC175 2816 2P BG5NUC-HC176 2817 2P BG5NUC-HC177 2818 2P BG5NUC-HC178 2819 RBD BG5NUC-HC179 2820 RBD BG5NUC-HC180 2821 2P BG5NUC-HC181 2822 2P BG5NUC-HC182 2823 2P BG5NUC-HC183 2824 2P BG5NUC-HC184 2825 2P BG5NUC-HC185 2826 2P BG5NUC-HC186 2827 2P BG5NUC-HC187 2828 2P BG5NUC-HC188 2829 2P BG5NUC-HC189 2830 2P BG5NUC-HC190 2831 2P BG5NUC-HC191 2832 2P BG5NUC-HC192 2833 2P BG5NUC-HC193 2834 2P BG5NUC-HC194 2835 2P BG5NUC-HC195 2836 2P BG5NUC-HC196 2837 RBD BG5NUC-HC197 2838 2P BG5NUC-HC198 2839 2P BG5NUC-HC199 2840 RBD BG5NUC-HC200 2841 2P BG5NUC-HC201 2842 RBD BG5NUC-HC202 2843 2P BG5NUC-HC203 2844 2P BG5NUC-HC204 2845 2P BG5NUC-HC205 2846 RBD BG5NUC-HC206 2847 2P BG5NUC-HC207 2848 RBD BG5NUC-HC208 2849 2P BG5NUC-HC209 2850 2P BG5NUC-HC210 2851 RBD BG5NUC-HC211 2852 2P BG5NUC-HC212 2853 2P BG5NUC-HC213 2854 2P BG5NUC-HC214 2855 2P BG5NUC-HC215 2856 RBD BG5NUC-HC216 2857 RBD BG5NUC-HC217 2858 2P BG5NUC-HC218 2859 RBD BG5NUC-HC219 2860 2P BG5NUC-HC220 2861 2P BG5NUC-HC221 2862 2P BG5NUC-HC222 2863 RBD BG5NUC-HC223 2864 2P BG5NUC-HC224 2865 2P BG5NUC-HC225 2866 2P BG5NUC-HC226 2867 RBD BG5NUC-HC227 2868 2P BG5NUC-HC228 2869 2P BG5NUC-HC229 2870 RBD BG5NUC-HC230 2871 RBD BG5NUC-HC231 2872 2P BG5NUC-HC232 2873 2P BG5NUC-HC233 2874 2P BG5NUC-HC234 2875 2P BG5NUC-HC235 2876 2P BG5NUC-HC236 2877 2P BG5NUC-HC237 2878 2P BG5NUC-HC238 2879 2P BG5NUC-HC239 2880 RBD BG5NUC-HC240 2881 RBD BG5NUC-HC241 2882 RBD BG5NUC-HC242 2883 RBD BG5NUC-HC243 2884 2P BG5NUC-HC244 2885 2P BG5NUC-HC245 2886 2P BG5NUC-HC246 2887 RBD BG5NUC-HC247 2888 RBD BG5NUC-HC248 2889 RBD BG5NUC-HC249 2890 2P BG5NUC-HC250 2891 2P BG5NUC-HC251 2892 2P BG5NUC-HC252 2893 2P BG5NUC-HC253 2894 2P BG5NUC-HC254 2895 2P BG5NUC-HC255 2896 RBD BG5NUC-HC256 2897 2P BG5NUC-HC257 2898 2P BG5NUC-HC258 2899 2P BG5NUC-HC259 2900 2P BG5NUC-HC260 2901 2P BG5NUC-HC261 2902 2P BG5NUC-HC262 2903 2P BG5NUC-HC263 2904 2P BG5NUC-HC264 2905 2P BG5NUC-HC265 2906 2F BG5NUC-HC266 2907 RBD BG5NUC-HC267 2908 2P BG5NUC-HC268 2909 RBD BG5NUC-HC269 2910 RBD BG5NUC-HC270 2911 2P BG5NUC-HC271 2912 2P BG5NUC-HC272 2913 RBD BG5NUC-HC273 2914 2P BG5NUC-HC274 2915 2P BG5NUC-HC275 2916 2P BG5NUC-HC276 2917 RBD BG5NUC-HC277 2918 2P BG5NUC-HC278 2919 RBD BG5NUC-HC279 2920 RBD BG5NUC-HC280 2921 2P BG5NUC-HC281 2922 2P BG5NUC-HC282 2923 RBD BG5NUC-HC283 2924 RBD BG5NUC-HC284 2925 RBD BG5NUC-HC285 2926 2P BG5NUC-HC286 2927 2P BG5NUC-HC287 2928 2P BG5NUC-HC288 2929 2P BG5NUC-HC289 2930 2P BG5NUC-HC290 2931 2P BG5NUC-HC291 2932 2P BG5NUC-HC292 2933 2P BG5NUC-HC293 2934 2P BG5NUC-HC294 2935 2P BG5NUC-HC295 2936 RBD BG5NUC-HC296 2937 RBD BG5NUC-HC297 2938 2P BG5NUC-HC298 2939 RBD BG5NUC-HC299 2940 RBD BG5NUC-HC300 2941 2P BG5NUC-HC301 2942 2P BG5NUC-HC302 2943 RBD BG5NUC-HC303 2944 2P BG5NUC-HC304 2945 RBD BG5NUC-HC305 2946 RBD BG5NUC-HC306 2947 RBD BG5NUC-HC307 2948 2P BG5NUC-HC308 2949 2P BG5NUC-HC309 2950 RBD BG5NUC-HC310 2951 2P BG5NUC-HC311 2952 2P BG5NUC-HC312 2953 2P BG5NUC-HC313 2954 2P BG5NUC-HC314 2955 RBD BG5NUC-HC315 2956 2P BG5NUC-HC316 2957 RBD BG5NUC-HC317 2958 RBD BG5NUC-HC318 2959 2P BG5NUC-HC319 2960 RBD BG5NUC-HC320 2961 RBD BG5NUC-HC321 2962 RBD BG5NUC-HC322 2963 2P BG5NUC-HC323 2964 2P BG5NUC-HC324 2965 2P BG5NUC-HC325 2966 RBD BG5NUC-HC326 2967 2P BG5NUC-HC327 2968 2P BG5NUC-HC328 2969 2P BG5NUC-HC329 2970 2P BG5NUC-HC330 2971 2P BG5NUC-HC331 2972 RBD BG5NUC-HC332 2973 RBD BG5NUC-HC333 2974 RBD BG5NUC-HC334 2975 RBD BG5NUC-HC335 2976 RBD BG5NUC-HC336 2977 RBD BG5NUC-HC337 2978 2P BG5NUC-HC338 2979 2P BG5NUC-HC339 2980 2P BG5NUC-HC340 2981 2P BG5NUC-HC341 2982 2P BG5NUC-HC342 2983 2P BG5NUC-HC343 2984 2P BG5NUC-HC344 2985 2P BG5NUC-HC345 2986 RBD BG5NUC-HC346 2987 RBD BG5NUC-HC347 2988 2P BG5NUC-HC348 2989 2F BG5NUC-HC349 2990 2P BG5NUC-HC350 2991 2P BG5NUC-HC351 2992 RBD BG5NUC-HC352 2993 2P BG5NUC-HC353 2994 RBD BG5NUC-HC354 2995 RBD BG5NUC-HC355 2996 2P BG5NUC-HC356 2997 RBD BG5NUC-HC357 2998 2P BG5NUC-HC358 2999 RBD BG5NUC-HC359 3000 2P BG5NUC-HC360 3001 2P BG5NUC-HC361 3002 2P BG5NUC-HC362 3003 RBD BG5NUC-HC363 3004 2P BG5NUC-HC364 3005 2P BG5NUC-HC365 3006 2P BG5NUC-HC366 3007 2P BG5NUC-HC367 3008 RBD BG5NUC-HC368 3009 RBD BG5NUC-HC369 3010 2P BG5NUC-HC370 3011 RBD BG5NUC-HC371 3012 2P BG5NUC-HC372 3013 RBD BG5NUC-HC373 3014 2P BG5NUC-HC374 3015 2P BG5NUC-HC375 3016 2P BG5NUC-HC376 3017 RBD BG5NUC-HC377 3018 2P BG5NUC-HC378 3019 2P BG5NUC-HC379 3020 RBD BG5NUC-HC380 3021 RBD BG5NUC-HC381 3022 RBD BG5NUC-HC382 3023 RBD BG5NUC-HC383 3024 2P BG5NUC-HC384 3025 2P BG5NUC-HC385 3026 2F BG5NUC-HC386 3027 2P BG5NUC-HC387 3028 2F BG5NUC-HC388 3029 2P BG5NUC-HC389 3030 2P BG5NUC-HC390 3031 2P BG5NUC-HC391 3032 2P BG5NUC-HC392 3033 2P BG5NUC-HC393 3034 RBD BG5NUC-HC394 3035 RBD BG5NUC-HC395 3036 RBD BG5NUC-HC396 3037 2P BG5NUC-HC397 3038 2P BG5NUC-HC398 3039 2P BG5NUC-HC399 3040 2P BG5NUC-HC400 3041 2P BG5NUC-HC401 3042 2P BG5NUC-HC402 3043 2F BG5NUC-HC403 3044 2P BG5NUC-HC404 3045 2P BG5NUC-HC405 3046 2P BG5NUC-HC406 3047 RBD BG5NUC-HC407 3048 2P BG5NUC-HC408 3049 RBD BG5NUC-HC409 3050 RBD BG5NUC-HC410 3051 2P BG5NUC-HC411 3052 2P BG5NUC-HC412 3053 2P BG5NUC-HC413 3054 2P BG5NUC-HC414 3055 2P BG5NUC-HC415 3056 RBD BG5NUC-HC416 3057 2P BG5NUC-HC417 3058 RBD BG5NUC-HC418 3059 2P BG5NUC-HC419 3060 2P BG5NUC-HC420 3061 2P BG5NUC-HC421 3062 2P BG5NUC-HC422 3063 2P BG5NUC-HC423 3064 2P BG5NUC-HC424 3065 RBD BG5NUC-HC425 3066 2P BG5NUC-HC426 3067 RBD BG5NUC-HC427 3068 2P BG5NUC-HC428 3069 2P BG5NUC-HC429 3070 2P BG5NUC-HC430 3071 2P BG5NUC-HC431 3072 2P BG5NUC-HC432 3073 2P BG5NUC-HC433 3074 RBD BG5NUC-HC434 3075 RBD BG5NUC-HC435 3076 2P BG5NUC-HC436 3077 RBD BG5NUC-HC437 3078 2P BG5NUC-HC438 3079 2P BG5NUC-HC439 3080 2P BG5NUC-HC440 3081 2P BG5NUC-HC441 3082 RBD BG5NUC-HC442 3083 2P BG5NUC-HC443 3084 2P BG5NUC-HC444 3085 2P BG5NUC-HC445 3086 2P BG5NUC-HC446 3087 2P BG5NUC-HC447 3088 RBD BG5NUC-HC448 3089 2P BG5NUC-HC449 3090 2P BG5NUC-HC450 3091 2P BG5NUC-HC451 3092 2P BG5NUC-HC452 3093 2P BG5NUC-HC453 3094 2P BG5NUC-HC454 3095 2P BG5NUC-HC455 3096 2P BG5NUC-HC456 3097 2P BG5NUC-HC457 3098 2P BG5NUC-HC458 3099 2P BG5NUC-HC459 3100 2P BG5NUC-HC460 3101 RBD BG5NUC-HC461 3102 2P BG5NUC-HC462 3103 2P BG5NUC-HC463 3104 2P BG5NUC-HC464 3105 2P BG5NUC-HC465 3106 RBD BG5NUC-HC466 3107 2P BG5NUC-HC467 3108 2P BG5NUC-HC468 3109 2P BG5NUC-HC469 3110 RBD BG5NUC-HC470 3111 RBD BG5NUC-HC471 3112 2F BG5NUC-HC472 3113 RBD BG5NUC-HC473 3114 RBD BG5NUC-HC474 3115 RBD BG5NUC-HC475 3116 2P BG5NUC-HC476 3117 2P BG5NUC-LC1 3118 RBD BG5NUC-LC2 3119 RBD BG5NUC-LC3 3120 2P BG5NUC-LC4 3121 RBD BG5NUC-LC5 3122 2P BG5NUC-LC6 3123 RBD BG5NUC-LC7 3124 2P BG5NUC-LC8 3125 RBD BG5NUC-LC9 3126 2P BG5NUC-LC10 3127 RBD BG5NUC-LC11 3128 2P BG5NUC-LC12 3129 2P BG5NUC-LC13 3130 2P BG5NUC-LC14 3131 2P BG5NUC-LC15 3132 RBD BG5NUC-LC16 3133 RBD BG5NUC-LC17 3134 2P BG5NUC-LC18 3135 RBD BG5NUC-LC19 3136 RBD BG5NUC-LC20 3137 2P BG5NUC-LC21 3138 RBD BG5NUC-LC22 3139 2P BG5NUC-LC23 3140 RBD BG5NUC-LC24 3141 RBD BG5NUC-LC25 3142 2P BG5NUC-LC26 3143 RBD BG5NUC-LC27 3144 RBD BG5NUC-LC28 3145 RBD BG5NUC-LC29 3146 RBD BG5NUC-LC30 3147 RBD BG5NUC-LC31 3148 2P BG5NUC-LC32 3149 RBD BG5NUC-LC33 3150 RBD BG5NUC-LC34 3151 2P BG5NUC-LC35 3152 RBD BG5NUC-LC36 3153 RBD BG5NUC-LC37 3154 2P BG5NUC-LC38 3155 2P BG5NUC-LC39 3156 2P BG5NUC-LC40 3157 2P BG5NUC-LC41 3158 2P BG5NUC-LC42 3159 2P BG5NUC-LC43 3160 RBD BG5NUC-LC44 3161 2P BG5NUC-LC45 3162 2P BG5NUC-LC46 3163 RBD BG5NUC-LC47 3164 RBD BG5NUC-LC48 3165 RBD BG5NUC-LC49 3166 RBD BG5NUC-LC50 3167 2P BG5NUC-LC51 3168 2P BG5NUC-LC52 3169 2P BG5NUC-LC53 3170 2P BG5NUC-LC54 3171 2P BG5NUC-LC55 3172 2P BG5NUC-LC56 3173 2P BG5NUC-LC57 3174 2P BG5NUC-LC58 3175 2P BG5NUC-LC59 3176 2P BG5NUC-LC60 3177 RBD BG5NUC-LC61 3178 RBD BG5NUC-LC62 3179 RBD BG5NUC-LC63 3180 RBD BG5NUC-LC64 3181 RBD BG5NUC-LC65 3182 RBD BG5NUC-LC66 3183 RBD BG5NUC-LC67 3184 RBD BG5NUC-LC68 3185 RBD BG5NUC-LC69 3186 RBD BG5NUC-LC70 3187 2P BG5NUC-LC71 3188 RBD BG5NUC-LC72 3189 2P BG5NUC-LC73 3190 2P BG5NUC-LC74 3191 2P BG5NUC-LC75 3192 2P BG5NUC-LC76 3193 2P BG5NUC-LC77 3194 2P BG5NUC-LC78 3195 2P BG5NUC-LC79 3196 2P BG5NUC-LC80 3197 2P BG5NUC-LC81 3198 2P BG5NUC-LC82 3199 2P BG5NUC-LC83 3200 2P BG5NUC-LC84 3201 2P BG5NUC-LC85 3202 2P BG5NUC-LC86 3203 2P BG5NUC-LC87 3204 2P BG5NUC-LC88 3205 2P BG5NUC-LC89 3206 2P BG5NUC-LC90 3207 2P BG5NUC-LC91 3208 2P BG5NUC-LC92 3209 2P BG5NUC-LC93 3210 2P BG5NUC-LC94 3211 2P BG5NUC-LC95 3212 2P BG5NUC-LC96 3213 RBD BG5NUC-LC97 3214 RBD BG5NUC-LC98 3215 RBD BG5NUC-LC99 3216 RBD BG5NUC-LC100 3217 2P BG5NUC-LC101 3218 2P BG5NUC-LC102 3219 2P BG5NUC-LC103 3220 2P BG5NUC-LC104 3221 RBD BG5NUC-LC105 3222 RBD BG5NUC-LC106 3223 2P BG5NUC-LC107 3224 RBD BG5NUC-LC108 3225 2P BG5NUC-LC109 3226 RBD BG5NUC-LC110 3227 2P BG5NUC-LC111 3228 RBD BG5NUC-LC112 3229 2P BG5NUC-LC113 3230 2P BG5NUC-LC114 3231 2P BG5NUC-LC115 3232 2P BG5NUC-LC116 3233 RBD BG5NUC-LC117 3234 2P BG5NUC-LC118 3235 2P BG5NUC-LC119 3236 2P BG5NUC-LC120 3237 RBD BG5NUC-LC121 3238 RBD BG5NUC-LC122 3239 2P BG5NUC-LC123 3240 2P BG5NUC-LC124 3241 2P BG5NUC-LC125 3242 2P BG5NUC-LC126 3243 2P BG5NUC-LC127 3244 2P BG5NUC-LC128 3245 RBD BG5NUC-LC129 3246 2P BG5NUC-LC130 3247 RBD BG5NUC-LC131 3248 2P BG5NUC-LC132 3249 RBD BG5NUC-LC133 3250 RBD BG5NUC-LC134 3251 2P BG5NUC-LC135 3252 2P BG5NUC-LC136 3253 2P BG5NUC-LC137 3254 2P BG5NUC-LC138 3255 2P BG5NUC-LC139 3256 2P BG5NUC-LC140 3257 2P BG5NUC-LC141 3258 2P BG5NUC-LC142 3259 2P BG5NUC-LC143 3260 RBD BG5NUC-LC144 3261 2P BG5NUC-LC145 3262 2P BG5NUC-LC146 3263 2P BG5NUC-LC147 3264 2P BG5NUC-LC148 3265 2P BG5NUC-LC149 3266 2P BG5NUC-LC150 3267 2P BG5NUC-LC151 3268 2P BG5NUC-LC152 3269 2P BG5NUC-LC153 3270 2P BG5NUC-LC154 3271 2P BG5NUC-LC155 3272 RBD BG5NUC-LC156 3273 RBD BG5NUC-LC157 3274 2P BG5NUC-LC158 3275 2P BG5NUC-LC159 3276 2P BG5NUC-LC160 3277 2P BG5NUC-LC161 3278 2P BG5NUC-LC162 3279 RBD BG5NUC-LC163 3280 2P BG5NUC-LC164 3281 2P BG5NUC-LC165 3282 RBD BG5NUC-LC166 3283 2P BG5NUC-LC167 3284 2P BG5NUC-LC168 3285 2P BG5NUC-LC169 3286 RBD BG5NUC-LC170 3287 RBD BG5NUC-LC171 3288 RBD BG5NUC-LC172 3289 2P BG5NUC-LC173 3290 2P BG5NUC-LC174 3291 2P BG5NUC-LC175 3292 2P BG5NUC-LC176 3293 2P BG5NUC-LC177 3294 2P BG5NUC-LC178 3295 RBD BG5NUC-LC179 3296 RBD BG5NUC-LC180 3297 2P BG5NUC-LC181 3298 2P BG5NUC-LC182 3299 2P BG5NUC-LC183 3300 2P BG5NUC-LC184 3301 2P BG5NUC-LC185 3302 2P BG5NUC-LC186 3303 2P BG5NUC-LC187 3304 2P BG5NUC-LC188 3305 2P BG5NUC-LC189 3306 2P BG5NUC-LC190 3307 2P BG5NUC-LC191 3308 2P BG5NUC-LC192 3309 2P BG5NUC-LC193 3310 2P BG5NUC-LC194 3311 2P BG5NUC-LC195 3312 2P BG5NUC-LC196 3313 RBD BG5NUC-LC197 3314 2P BG5NUC-LC198 3315 2P BG5NUC-LC199 3316 RBD BG5NUC-LC200 3317 2P BG5NUC-LC201 3318 RBD BG5NUC-LC202 3319 2P BG5NUC-LC203 3320 2P BG5NUC-LC204 3321 2P BG5NUC-LC205 3322 RBD BG5NUC-LC206 3323 2P BG5NUC-LC207 3324 RBD BG5NUC-LC208 3325 2P BG5NUC-LC209 3326 2P BG5NUC-LC210 3327 RBD BG5NUC-LC211 3328 2P BG5NUC-LC212 3329 2P BG5NUC-LC213 3330 2P BG5NUC-LC214 3331 2P BG5NUC-LC215 3332 RBD BG5NUC-LC216 3333 RBD BG5NUC-LC217 3334 2P BG5NUC-LC218 3335 RBD BG5NUC-LC219 3336 2P BG5NUC-LC220 3337 2P BG5NUC-LC221 3338 2P BG5NUC-LC222 3339 RBD BG5NUC-LC223 3340 2P BG5NUC-LC224 3341 2P BG5NUC-LC225 3342 2P BG5NUC-LC226 3343 RBD BG5NUC-LC227 3344 2P BG5NUC-LC228 3345 2P BG5NUC-LC229 3346 RBD BG5NUC-LC230 3347 RBD BG5NUC-LC231 3348 2P BG5NUC-LC232 3349 2P BG5NUC-LC233 3350 2P BG5NUC-LC234 3351 2P BG5NUC-LC235 3352 2P BG5NUC-LC236 3353 2P BG5NUC-LC237 3354 2P BG5NUC-LC238 3355 2P BG5NUC-LC239 3356 RBD BG5NUC-LC240 3357 RBD BG5NUC-LC241 3358 RBD BG5NUC-LC242 3359 RBD BG5NUC-LC243 3360 2P BG5NUC-LC244 3361 2P BG5NUC-LC245 3362 2P BG5NUC-LC246 3363 RBD BG5NUC-LC247 3364 RBD BG5NUC-LC248 3365 RBD BG5NUC-LC249 3366 2P BG5NUC-LC250 3367 2P BG5NUC-LC251 3368 2P BG5NUC-LC252 3369 2P BG5NUC-LC253 3370 2P BG5NUC-LC254 3371 2P BG5NUC-LC255 3372 RBD BG5NUC-LC256 3373 2P BG5NUC-LC257 3374 2P BG5NUC-LC258 3375 2P BG5NUC-LC259 3376 2P BG5NUC-LC260 3377 2P BG5NUC-LC261 3378 2P BG5NUC-LC262 3379 2P BG5NUC-LC263 3380 2P BG5NUC-LC264 3381 2P BG5NUC-LC265 3382 2P BG5NUC-LC266 3383 RBD BG5NUC-LC267 3384 2P BG5NUC-LC268 3385 RBD BG5NUC-LC269 3386 RBD BG5NUC-LC270 3387 2P BG5NUC-LC271 3388 2P BG5NUC-LC272 3389 RBD BG5NUC-LC273 3390 2P BG5NUC-LC274 3391 2P BG5NUC-LC275 3392 2P BG5NUC-LC276 3393 RBD BG5NUC-LC277 3394 2P BG5NUC-LC278 3395 RBD BG5NUC-LC279 3396 RBD BG5NUC-LC280 3397 2P BG5NUC-LC281 3398 2P BG5NUC-LC282 3399 RBD BG5NUC-LC283 3400 RBD BG5NUC-LC284 3401 RBD BG5NUC-LC285 3402 2P BG5NUC-LC286 3403 2P BG5NUC-LC287 3404 2P BG5NUC-LC288 3405 2P BG5NUC-LC289 3406 2P BG5NUC-LC290 3407 2P BG5NUC-LC291 3408 2P BG5NUC-LC292 3409 2P BG5NUC-LC293 3410 2P BG5NUC-LC294 3411 2P BG5NUC-LC295 3412 RBD BG5NUC-LC296 3413 RBD BG5NUC-LC297 3414 2P BG5NUC-LC298 3415 RBD BG5NUC-LC299 3416 RBD BG5NUC-LC300 3417 2P BG5NUC-LC301 3418 2P BG5NUC-LC302 3419 RBD BG5NUC-LC303 3420 2P BG5NUC-LC304 3421 RBD BG5NUC-LC305 3422 RBD BG5NUC-LC306 3423 RBD BG5NUC-LC307 3424 2P BG5NUC-LC308 3425 2P BG5NUC-LC309 3426 RBD BG5NUC-LC310 3427 2P BG5NUC-LC311 3428 2P BG5NUC-LC312 3429 2P BG5NUC-LC313 3430 2P BG5NUC-LC314 3431 RBD BG5NUC-LC315 3432 2P BG5NUC-LC316 3433 RBD BG5NUC-LC317 3434 RBD BG5NUC-LC318 3435 2P BG5NUC-LC319 3436 RBD BG5NUC-LC320 3437 RBD BG5NUC-LC321 3438 RBD BG5NUC-LC322 3439 2P BG5NUC-LC323 3440 2P BG5NUC-LC324 3441 2P BG5NUC-LC325 3442 RBD BG5NUC-LC326 3443 2P BG5NUC-LC327 3444 2P BG5NUC-LC328 3445 2P BG5NUC-LC329 3446 2P BG5NUC-LC330 3447 2P BG5NUC-LC331 3448 RBD BG5NUC-LC332 3449 RBD BG5NUC-LC333 3450 RBD BG5NUC-LC334 3451 RBD BG5NUC-LC335 3452 RBD BG5NUC-LC336 3453 RBD BG5NUC-LC337 3454 2P BG5NUC-LC338 3455 2P BG5NUC-LC339 3456 2P BG5NUC-LC340 3457 2P BG5NUC-LC341 3458 2P BG5NUC-LC342 3459 2P BG5NUC-LC343 3460 2P BG5NUC-LC344 3461 2P BG5NUC-LC345 3462 RBD BG5NUC-LC346 3463 RBD BG5NUC-LC347 3464 2P BG5NUC-LC348 3465 2P BG5NUC-LC349 3466 2P BG5NUC-LC350 3467 2P BG5NUC-LC351 3468 RBD BG5NUC-LC352 3469 2P BG5NUC-LC353 3470 RBD BG5NUC-LC354 3471 RBD BG5NUC-LC355 3472 2P BG5NUC-LC356 3473 RBD BG5NUC-LC357 3474 2P BG5NUC-LC358 3475 RBD BG5NUC-LC359 3476 2P BG5NUC-LC360 3477 2P BG5NUC-LC361 3478 2P BG5NUC-LC362 3479 RBD BG5NUC-LC363 3480 2P BG5NUC-LC364 3481 2P BG5NUC-LC365 3482 2P BG5NUC-LC366 3483 2P BG5NUC-LC367 3484 RBD BG5NUC-LC368 3485 RBD BG5NUC-LC369 3486 2P BG5NUC-LC370 3487 RBD BG5NUC-LC371 3488 2P BG5NUC-LC372 3489 RBD BG5NUC-LC373 3490 2P BG5NUC-LC374 3491 2P BG5NUC-LC375 3492 2P BG5NUC-LC376 3493 RBD BG5NUC-LC377 3494 2P BG5NUC-LC378 3495 2P BG5NUC-LC379 3496 RBD BG5NUC-LC380 3497 RBD BG5NUC-LC381 3498 RBD BG5NUC-LC382 3499 RBD BG5NUC-LC383 3500 2P BG5NUC-LC384 3501 2P BG5NUC-LC385 3502 2P BG5NUC-LC386 3503 2P BG5NUC-LC387 3504 2P BG5NUC-LC388 3505 2P BG5NUC-LC389 3506 2P BG5NUC-LC390 3507 2P BG5NUC-LC391 3508 2P BG5NUC-LC392 3509 2P BG5NUC-LC393 3510 RBD BG5NUC-LC394 3511 RBD BG5NUC-LC395 3512 RBD BG5NUC-LC396 3513 2P BG5NUC-LC397 3514 2P BG5NUC-LC398 3515 2P BG5NUC-LC399 3516 2P BG5NUC-LC400 3517 2P BG5NUC-LC401 3518 2P BG5NUC-LC402 3519 2P BG5NUC-LC403 3520 2P BG5NUC-LC404 3521 2P BG5NUC-LC405 3522 2P BG5NUC-LC406 3523 RBD BG5NUC-LC407 3524 2P BG5NUC-LC408 3525 RBD BG5NUC-LC409 3526 RBD BG5NUC-LC410 3527 2P BG5NUC-LC411 3528 2P BG5NUC-LC412 3529 2P BG5NUC-LC413 3530 2P BG5NUC-LC414 3531 2P BG5NUC-LC415 3532 RBD BG5NUC-LC416 3533 2P BG5NUC-LC417 3534 RBD BG5NUC-LC418 3535 2P BG5NUC-LC419 3536 2P BG5NUC-LC420 3537 2P BG5NUC-LC421 3538 2P BG5NUC-LC422 3539 2P BG5NUC-LC423 3540 2P BG5NUC-LC424 3541 RBD BG5NUC-LC425 3542 2P BG5NUC-LC426 3543 RBD BG5NUC-LC427 3544 2P BG5NUC-LC428 3545 2P BG5NUC-LC429 3546 2P BG5NUC-LC430 3547 2P BG5NUC-LC431 3548 2P BG5NUC-LC432 3549 2P BG5NUC-LC433 3550 RBD BG5NUC-LC434 3551 RBD BG5NUC-LC435 3552 2P BG5NUC-LC436 3553 RBD BG5NUC-LC437 3554 2P BG5NUC-LC438 3555 2P BG5NUC-LC439 3556 2P BG5NUC-LC440 3557 2P BG5NUC-LC441 3558 RBD BG5NUC-LC442 3559 2P BG5NUC-LC443 3560 2P BG5NUC-LC444 3561 2P BG5NUC-LC445 3562 2P BG5NUC-LC446 3563 2P BG5NUC-LC447 3564 RBD BG5NUC-LC448 3565 2P BG5NUC-LC449 3566 2P BG5NUC-LC450 3567 2P BG5NUC-LC451 3568 2P BG5NUC-LC452 3569 2P BG5NUC-LC453 3570 2P BG5NUC-LC454 3571 2P BG5NUC-LC455 3572 2P BG5NUC-LC456 3573 2P BG5NUC-LC457 3574 2P BG5NUC-LC458 3575 2P BG5NUC-LC459 3576 2P BG5NUC-LC460 3577 RBD BG5NUC-LC461 3578 2P BG5NUC-LC462 3579 2P BG5NUC-LC463 3580 2P BG5NUC-LC464 3581 2P BG5NUC-LC465 3582 RBD BG5NUC-LC466 3583 2P BG5NUC-LC467 3584 2P BG5NUC-LC468 3585 2P BG5NUC-LC469 3586 RBD BG5NUC-LC470 3587 RBD BG5NUC-LC471 3588 2P BG5NUC-LC472 3589 RBD BG5NUC-LC473 3590 RBD BG5NUC-LC474 3591 RBD BG5NUC-LC475 3592 2P BG5NUC-LC476 3593 RBD BG6NUC-HC1 3594 2P BG6NUC-HC2 3595 RBD BG6NUC-HC3 3596 RBD BG6NUC-HC4 3597 RBD BG6NUC-HC5 3598 RBD BG6NUC-HC6 3599 2P BG6NUC-HC7 3600 2P BG6NUC-HC8 3601 RBD BG6NUC-HC9 3602 RBD BG6NUC-HC10 3603 RBD BG6NUC-HC11 3604 2P BG6NUC-HC12 3605 2P BG6NUC-HC13 3606 2P BG6NUC-HC14 3607 2P BG6NUC-HC15 3608 2P BG6NUC-HC16 3609 2P BG6NUC-HC17 3610 2P BG6NUC-HC18 3611 2P BG6NUC-HC19 3612 2P BG6NUC-HC20 3613 2P BG6NUC-HC21 3614 2P BG6NUC-HC22 3615 2P BG6NUC-HC23 3616 2P BG6NUC-HC24 3617 RBD BG6NUC-HC25 3618 2P BG6NUC-HC26 3619 2F BG6NUC-HC27 3620 2P BG6NUC-HC28 3621 2F BG6NUC-HC29 3622 RBD BG6NUC-HC30 3623 RBD BG6NUC-HC31 3624 RBD BG6NUC-HC32 3625 RBD BG6NUC-HC33 3626 2P BG6NUC-HC34 3627 RBD BG6NUC-HC35 3628 RBD BG6NUC-HC36 3629 2P BG6NUC-HC37 3630 2P BG6NUC-HC38 3631 2P BG6NUC-HC39 3632 RBD BG6NUC-HC40 3633 2P BG6NUC-HC41 3634 RBD BG6NUC-HC42 3635 2P BG6NUC-HC43 3636 2P BG6NUC-HC44 3637 RBD BG6NUC-HC45 3638 RBD BG6NUC-HC46 3639 2P BG6NUC-HC47 3640 2F BG6NUC-HC48 3641 RBD BG6NUC-HC49 3642 RBD BG6NUC-HC50 3643 2P BG6NUC-HC51 3644 2P BG6NUC-HC52 3645 RBD BG6NUC-HC53 3646 2P BG6NUC-HC54 3647 RBD BG6NUC-HC55 3648 2P BG6NUC-HC56 3649 2P BG6NUC-HC57 3650 2P BG6NUC-HC58 3651 2P BG6NUC-HC59 3652 2P BG6NUC-HC60 3653 RBD BG6NUC-HC61 3654 2P BG6NUC-HC62 3655 RBD BG6NUC-HC63 3656 2P BG6NUC-HC64 3657 2P BG6NUC-HC65 3658 RBD BG6NUC-HC66 3659 2P BG6NUC-HC67 3660 2P BG6NUC-HC68 3661 RBD BG6NUC-HC69 3662 2P BG6NUC-HC70 3663 2F BG6NUC-HC71 3664 2P BG6NUC-HC72 3665 RBD BG6NUC-HC73 3666 RBD BG6NUC-HC74 3667 RBD BG6NUC-HC75 3668 RBD BG6NUC-HC76 3669 RBD BG6NUC-HC77 3670 RBD BG6NUC-HC78 3671 2P BG6NUC-HC79 3672 2P BG6NUC-HC80 3673 2P BG6NUC-HC81 3674 2P BG6NUC-HC82 3675 2P BG6NUC-HC83 3676 RBD BG6NUC-HC84 3677 2P BG6NUC-HC85 3678 RBD BG6NUC-HC86 3679 2P BG6NUC-HC87 3680 2P BG6NUC-HC88 3681 RBD BG6NUC-HC89 3682 2P BG6NUC-HC90 3683 2P BG6NUC-HC91 3684 RBD BG6NUC-HC92 3685 RBD BG6NUC-HC93 3686 2P BG6NUC-HC94 3687 2P BG6NUC-HC95 3688 2P BG6NUC-HC96 3689 2P BG6NUC-HC97 3690 RBD BG6NUC-HC98 3691 2P BG6NUC-HC99 3692 RBD BG6NUC-HC100 3693 2P BG6NUC-HC101 3694 2P BG6NUC-HC102 3695 2P BG6NUC-HC103 3696 2P BG6NUC-HC104 3697 2P BG6NUC-HC105 3698 RBD BG6NUC-HC106 3699 RBD BG6NUC-HC107 3700 RBD BG6NUC-HC108 3701 RBD BG6NUC-HC109 3702 2P BG6NUC-HC110 3703 2P BG6NUC-HC111 3704 RBD BG6NUC-HC112 3705 2P BG6NUC-HC113 3706 RBD BG6NUC-HC114 3707 RBD BG6NUC-HC115 3708 RBD BG6NUC-HC116 3709 RBD BG6NUC-HC117 3710 2P BG6NUC-HC118 3711 RBD BG6NUC-HC119 3712 2P BG6NUC-HC120 3713 2P BG6NUC-HC121 3714 2P BG6NUC-HC122 3715 2P BG6NUC-HC123 3716 RBD BG6NUC-HC124 3717 RBD BG6NUC-HC125 3718 2P BG6NUC-HC126 3719 RBD BG6NUC-HC127 3720 2P BG6NUC-HC128 3721 2P BG6NUC-HC129 3722 2P BG6NUC-HC130 3723 2P BG6NUC-HC131 3724 RBD BG6NUC-HC132 3725 2P BG6NUC-HC133 3726 2P BG6NUC-HC134 3727 RBD BG6NUC-HC135 3728 RBD BG6NUC-HC136 3729 RBD BG6NUC-HC137 3730 2P BG6NUC-HC138 3731 2P BG6NUC-HC139 3732 2P BG6NUC-HC140 3733 2P BG6NUC-HC141 3734 RBD BG6NUC-HC142 3735 2P BG6NUC-HC143 3736 2P BG6NUC-HC144 3737 2P BG6NUC-HC145 3738 RBD BG6NUC-HC146 3739 RBD BG6NUC-HC147 3740 2P BG6NUC-HC148 3741 2P BG6NUC-HC149 3742 RBD BG6NUC-HC150 3743 RBD BG6NUC-HC151 3744 2P BG6NUC-HC152 3745 2P BG6NUC-HC153 3746 RBD BG6NUC-HC154 3747 RBD BG6NUC-HC155 3748 RBD BG6NUC-HC156 3749 2P BG6NUC-HC157 3750 RBD BG6NUC-HC158 3751 2P BG6NUC-HC159 3752 2P BG6NUC-HC160 3753 2P BG6NUC-HC161 3754 2P BG6NUC-HC162 3755 2P BG6NUC-HC163 3756 RBD BG6NUC-HC164 3757 2P BG6NUC-HC165 3758 RBD BG6NUC-HC166 3759 RBD BG6NUC-HC167 3760 2P BG6NUC-HC168 3761 RBD BG6NUC-HC169 3762 2P BG6NUC-HC170 3763 2P BG6NUC-HC171 3764 2P BG6NUC-HC172 3765 2P BG6NUC-HC173 3766 RBD BG6NUC-HC174 3767 2P BG6NUC-HC175 3768 RBD BG6NUC-HC176 3769 RBD BG6NUC-HC177 3770 2P BG6NUC-HC178 3771 2P BG6NUC-HC179 3772 2P BG6NUC-HC180 3773 RBD BG6NUC-HC181 3774 RBD BG6NUC-HC182 3775 2P BG6NUC-HC183 3776 2F BG6NUC-HC184 3777 2P BG6NUC-HC185 3778 2P BG6NUC-HC186 3779 RBD BG6NUC-HC187 3780 2P BG6NUC-HC188 3781 RBD BG6NUC-HC189 3782 2P BG6NUC-HC190 3783 RBD BG6NUC-HC191 3784 RBD BG6NUC-HC192 3785 2P BG6NUC-HC193 3786 RBD BG6NUC-HC194 3787 2P BG6NUC-HC195 3788 2P BG6NUC-HC196 3789 2P BG6NUC-HC197 3790 2P BG6NUC-HC198 3791 2F BG6NUC-HC199 3792 2P BG6NUC-HC200 3793 RBD BG6NUC-HC201 3794 RBD BG6NUC-HC202 3795 2P BG6NUC-HC203 3796 RBD BG6NUC-HC204 3797 RBD BG6NUC-HC205 3798 2P BG6NUC-HC206 3799 2P BG6NUC-HC207 3800 2P BG6NUC-HC208 3801 RBD BG6NUC-HC209 3802 2P BG6NUC-HC210 3803 RBD BG6NUC-HC211 3804 2P BG6NUC-HC212 3805 2P BG6NUC-HC213 3806 2P BG6NUC-HC214 3807 2P BG6NUC-HC215 3808 2P BG6NUC-HC216 3809 2P BG6NUC-HC217 3810 2P BG6NUC-HC218 3811 RBD BG6NUC-HC219 3812 RBD BG6NUC-HC220 3813 2P BG6NUC-HC221 3814 2P BG6NUC-HC222 3815 RBD BG6NUC-HC223 3816 RBD BG6NUC-HC224 3817 RBD BG6NUC-HC225 3818 2P BG6NUC-HC226 3819 2P BG6NUC-HC227 3820 RBD BG6NUC-HC228 3821 RBD BG6NUC-HC229 3822 RBD BG6NUC-HC230 3823 RBD BG6NUC-HC231 3824 2P BG6NUC-HC232 3825 RBD BG6NUC-HC233 3826 2P BG6NUC-HC234 3827 RBD BG6NUC-HC235 3828 RBD BG6NUC-HC236 3829 RBD BG6NUC-HC237 3830 2P BG6NUC-HC238 3831 2P BG6NUC-HC239 3832 RBD BG6NUC-HC240 3833 2P BG6NUC-HC241 3834 2P BG6NUC-HC242 3835 RBD BG6NUC-HC243 3836 2P BG6NUC-HC244 3837 2P BG6NUC-HC245 3838 2P BG6NUC-HC246 3839 RBD BG6NUC-LC1 3840 2P BG6NUC-LC2 3841 RBD BG6NUC-LC3 3842 RBD BG6NUC-LC4 3843 RBD BG6NUC-LC5 3844 RBD BG6NUC-LC6 3845 2P BG6NUC-LC7 3846 2P BG6NUC-LC8 3847 RBD BG6NUC-LC9 3848 RBD BG6NUC-LC10 3849 RBD BG6NUC-LC11 3850 2P BG6NUC-LC12 3851 2P BG6NUC-LC13 3852 2P BG6NUC-LC14 3853 2P BG6NUC-LC15 3854 2P BG6NUC-LC16 3855 2P BG6NUC-LC17 3856 2P BG6NUC-LC18 3857 2P BG6NUC-LC19 3858 2P BG6NUC-LC20 3859 2P BG6NUC-LC21 3860 2P BG6NUC-LC22 3861 2P BG6NUC-LC23 3862 2P BG6NUC-LC24 3863 RBD BG6NUC-LC25 3864 2P BG6NUC-LC26 3865 2P BG6NUC-LC27 3866 2P BG6NUC-LC28 3867 2P BG6NUC-LC29 3868 RBD BG6NUC-LC30 3869 RBD BG6NUC-LC31 3870 RBD BG6NUC-LC32 3871 RBD BG6NUC-LC33 3872 2P BG6NUC-LC34 3873 RBD BG6NUC-LC35 3874 RBD BG6NUC-LC36 3875 2P BG6NUC-LC37 3876 2P BG6NUC-LC38 3877 2P BG6NUC-LC39 3878 RBD BG6NUC-LC40 3879 2P BG6NUC-LC41 3880 RBD BG6NUC-LC42 3881 2P BG6NUC-LC43 3882 2P BG6NUC-LC44 3883 RBD BG6NUC-LC45 3884 RBD BG6NUC-LC46 3885 2P BG6NUC-LC47 3886 2P BG6NUC-LC48 3887 RBD BG6NUC-LC49 3888 RBD BG6NUC-LC50 3889 2P BG6NUC-LC51 3890 2P BG6NUC-LC52 3891 RBD BG6NUC-LC53 3892 2P BG6NUC-LC54 3893 RBD BG6NUC-LC55 3894 2F BG6NUC-LC56 3895 2F BG6NUC-LC57 3896 2P BG6NUC-LC58 3897 2P BG6NUC-LC59 3898 2P BG6NUC-LC60 3899 RBD BG6NUC-LC61 3900 2F BG6NUC-LC62 3901 RBD BG6NUC-LC63 3902 2P BG6NUC-LC64 3903 2P BG6NUC-LC65 3904 RBD BG6NUC-LC66 3905 2P BG6NUC-LC67 3906 2P BG6NUC-LC68 3907 RBD BG6NUC-LC69 3908 2P BG6NUC-LC70 3909 2P BG6NUC-LC71 3910 2P BG6NUC-LC72 3911 RBD BG6NUC-LC73 3912 RBD BG6NUC-LC74 3913 RBD BG6NUC-LC75 3914 RBD BG6NUC-LC76 3915 RBD BG6NUC-LC77 3916 RBD BG6NUC-LC78 3917 2P BG6NUC-LC79 3918 2P BG6NUC-LC80 3919 2P BG6NUC-LC81 3920 2P BG6NUC-LC82 3921 2P BG6NUC-LC83 3922 RBD BG6NUC-LC84 3923 2P BG6NUC-LC85 3924 RBD BG6NUC-LC86 3925 2P BG6NUC-LC87 3926 2P BG6NUC-LC88 3927 RBD BG6NUC-LC89 3928 2P BG6NUC-LC90 3929 2P BG6NUC-LC91 3930 RBD BG6NUC-LC92 3931 RBD BG6NUC-LC93 3932 2P BG6NUC-LC94 3933 2P BG6NUC-LC95 3934 2P BG6NUC-LC96 3935 2P BG6NUC-LC97 3936 RBD BG6NUC-LC98 3937 2P BG6NUC-LC99 3938 RBD BG6NUC-LC100 3939 2P BG6NUC-LC101 3940 2P BG6NUC-LC102 3941 2P BG6NUC-LC103 3942 2P BG6NUC-LC104 3943 2P BG6NUC-LC105 3944 RBD BG6NUC-LC106 3945 RBD BG6NUC-LC107 3946 RBD BG6NUC-LC108 3947 RBD BG6NUC-LC109 3948 2P BG6NUC-LC110 3949 2P BG6NUC-LC111 3950 RBD BG6NUC-LC112 3951 2F BG6NUC-LC113 3952 RBD BG6NUC-LC114 3953 RBD BG6NUC-LC115 3954 RBD BG6NUC-LC116 3955 RBD BG6NUC-LC117 3956 2P BG6NUC-LC118 3957 RBD BG6NUC-LC119 3958 2P BG6NUC-LC120 3959 2P BG6NUC-LC121 3960 2P BG6NUC-LC122 3961 2P BG6NUC-LC123 3962 RBD BG6NUC-LC124 3963 RBD BG6NUC-LC125 3964 2P BG6NUC-LC126 3965 RBD BG6NUC-LC127 3966 2P BG6NUC-LC128 3967 2P BG6NUC-LC129 3968 2P BG6NUC-LC130 3969 2P BG6NUC-LC131 3970 RBD BG6NUC-LC132 3971 2P BG6NUC-LC133 3972 2P BG6NUC-LC134 3973 RBD BG6NUC-LC135 3974 RBD BG6NUC-LC136 3975 RBD BG6NUC-LC137 3976 2P BG6NUC-LC138 3977 2P BG6NUC-LC139 3978 2P BG6NUC-LC140 3979 2P BG6NUC-LC141 3980 RBD BG6NUC-LC142 3981 2P BG6NUC-LC143 3982 2P BG6NUC-LC144 3983 2P BG6NUC-LC145 3984 RBD BG6NUC-LC146 3985 RBD BG6NUC-LC147 3986 2P BG6NUC-LC148 3987 2P BG6NUC-LC149 3988 RBD BG6NUC-LC150 3989 RBD BG6NUC-LC151 3990 2P BG6NUC-LC152 3991 2P BG6NUC-LC153 3992 RBD BG6NUC-LC154 3993 RBD BG6NUC-LC155 3994 RBD BG6NUC-LC156 3995 2P BG6NUC-LC157 3996 RBD BG6NUC-LC158 3997 2P BG6NUC-LC159 3998 2P BG6NUC-LC160 3999 2P BG6NUC-LC161 4000 2P BG6NUC-LC162 4001 2P BG6NUC-LC163 4002 RBD BG6NUC-LC164 4003 2P BG6NUC-LC165 4004 RBD BG6NUC-LC166 4005 RBD BG6NUC-LC167 4006 2P BG6NUC-LC168 4007 RBD BG6NUC-LC169 4008 2P BG6NUC-LC170 4009 2P BG6NUC-LC171 4010 2P BG6NUC-LC172 4011 2P BG6NUC-LC173 4012 RBD BG6NUC-LC174 4013 2P BG6NUC-LC175 4014 RBD BG6NUC-LC176 4015 RBD BG6NUC-LC177 4016 2P BG6NUC-LC178 4017 2P BG6NUC-LC179 4018 2P BG6NUC-LC180 4019 RBD BG6NUC-LC181 4020 RBD BG6NUC-LC182 4021 2P BG6NUC-LC183 4022 2P BG6NUC-LC184 4023 2P BG6NUC-LC185 4024 2P BG6NUC-LC186 4025 RBD BG6NUC-LC187 4026 2F BG6NUC-LC188 4027 RBD BG6NUC-LC189 4028 2P BG6NUC-LC190 4029 RBD BG6NUC-LC191 4030 RBD BG6NUC-LC192 4031 2P BG6NUC-LC193 4032 RBD BG6NUC-LC194 4033 2P BG6NUC-LC195 4034 2P BG6NUC-LC196 4035 2P BG6NUC-LC197 4036 2P BG6NUC-LC198 4037 2P BG6NUC-LC199 4038 2P BG6NUC-LC200 4039 RBD BG6NUC-LC201 4040 RBD BG6NUC-LC202 4041 2P BG6NUC-LC203 4042 RBD BG6NUC-LC204 4043 RBD BG6NUC-LC205 4044 2P BG6NUC-LC206 4045 2P BG6NUC-LC207 4046 2P BG6NUC-LC208 4047 RBD BG6NUC-LC209 4048 2P BG6NUC-LC210 4049 RBD BG6NUC-LC211 4050 2P BG6NUC-LC212 4051 2P BG6NUC-LC213 4052 2P BG6NUC-LC214 4053 2P BG6NUC-LC215 4054 2P BG6NUC-LC216 4055 2P BG6NUC-LC217 4056 2P BG6NUC-LC218 4057 RBD BG6NUC-LC219 4058 RBD BG6NUC-LC220 4059 2P BG6NUC-LC221 4060 2P BG6NUC-LC222 4061 RBD BG6NUC-LC223 4062 RBD BG6NUC-LC224 4063 RBD BG6NUC-LC225 4064 2P BG6NUC-LC226 4065 2P BG6NUC-LC227 4066 RBD BG6NUC-LC228 4067 RBD BG6NUC-LC229 4068 RBD BG6NUC-LC230 4069 RBD BG6NUC-LC231 4070 2P BG6NUC-LC232 4071 RBD BG6NUC-LC233 4072 2P BG6NUC-LC234 4073 RBD BG6NUC-LC235 4074 RBD BG6NUC-LC236 4075 RBD BG6NUC-LC237 4076 2P BG6NUC-LC238 4077 2P BG6NUC-LC239 4078 RBD BG6NUC-LC240 4079 2P BG6NUC-LC241 4080 2P BG6NUC-LC242 4081 RBD BG6NUC-LC243 4082 2P BG6NUC-LC244 4083 2P BG6NUC-LC245 4084 2P BG6NUC-LC246 4085 2P BG7NUC-HC1 4086 2P BG7NUC-HC2 4087 2P BG7NUC-HC3 4088 2P BG7NUC-HC4 4089 2P BG7NUC-HC5 4090 2P BG7NUC-HC6 4091 2P BG7NUC-HC7 4092 2P BG7NUC-HC8 4093 2P BG7NUC-HC9 4094 2P BG7NUC-HC10 4095 2P BG7NUC-HC11 4096 2P BG7NUC-HC12 4097 2P BG7NUC-HC13 4098 2P BG7NUC-HC14 4099 2P BG7NUC-HC15 4100 2P BG7NUC-HC16 4101 2P BG7NUC-HC17 4102 2P BG7NUC-HC18 4103 2P BG7NUC-HC19 4104 2P BG7NUC-HC20 4105 2P BG7NUC-HC21 4106 2P BG7NUC-HC22 4107 2P BG7NUC-HC23 4108 2P BG7NUC-HC24 4109 2P BG7NUC-HC25 4110 2P BG7NUC-HC26 4111 2P BG7NUC-HC27 4112 2P BG7NUC-HC28 4113 2P BG7NUC-HC29 4114 2P BG7NUC-HC30 4115 2P BG7NUC-HC31 4116 2P BG7NUC-HC32 4117 RBD BG7NUC-HC33 4118 RBD BG7NUC-HC34 4119 RBD BG7NUC-HC35 4120 RBD BG7NUC-HC36 4121 2P BG7NUC-HC37 4122 2P BG7NUC-HC38 4123 2P BG7NUC-HC39 4124 2P BG7NUC-HC40 4125 2P BG7NUC-HC41 4126 2P BG7NUC-HC42 4127 2P BG7NUC-HC43 4128 2P BG7NUC-HC44 4129 2P BG7NUC-HC45 4130 2P BG7NUC-HC46 4131 2P BG7NUC-HC47 4132 2P BG7NUC-HC48 4133 2P BG7NUC-HC49 4134 2P BG7NUC-HC50 4135 2P BG7NUC-HC51 4136 2P BG7NUC-HC52 4137 2P BG7NUC-HC53 4138 2P BG7NUC-HC54 4139 2P BG7NUC-HC55 4140 2P BG7NUC-HC56 4141 2P BG7NUC-HC57 4142 2P BG7NUC-HC58 4143 2P BG7NUC-HC59 4144 2P BG7NUC-HC60 4145 RBD BG7NUC-HC61 4146 2P BG7NUC-HC62 4147 2P BG7NUC-HC63 4148 RBD BG7NUC-HC64 4149 RBD BG7NUC-HC65 4150 RBD BG7NUC-HC66 4151 RBD BG7NUC-HC67 4152 RBD BG7NUC-HC68 4153 2P BG7NUC-HC69 4154 2P BG7NUC-HC70 4155 2P BG7NUC-HC71 4156 2P BG7NUC-HC72 4157 2P BG7NUC-HC73 4158 2P BG7NUC-HC74 4159 2P BG7NUC-HC75 4160 2P BG7NUC-HC76 4161 2P BG7NUC-HC77 4162 2P BG7NUC-HC78 4163 2P BG7NUC-HC79 4164 2P BG7NUC-HC80 4165 2P BG7NUC-HC81 4166 2P BG7NUC-HC82 4167 2P BG7NUC-HC83 4168 2P BG7NUC-HC84 4169 2P BG7NUC-HC85 4170 2P BG7NUC-HC86 4171 2P BG7NUC-HC87 4172 2P BG7NUC-HC88 4173 2P BG7NUC-HC89 4174 2P BG7NUC-HC90 4175 2P BG7NUC-HC91 4176 2P BG7NUC-HC92 4177 2P BG7NUC-HC93 4178 2P BG7NUC-HC94 4179 2P BG7NUC-HC95 4180 2P BG7NUC-HC96 4181 2P BG7NUC-HC97 4182 2P BG7NUC-HC98 4183 2P BG7NUC-HC99 4184 2P BG7NUC-HC100 4185 2P BG7NUC-HC101 4186 2P BG7NUC-HC102 4187 2P BG7NUC-HC103 4188 2P BG7NUC-HC104 4189 2P BG7NUC-HC105 4190 2P BG7NUC-HC106 4191 2P BG7NUC-HC107 4192 2P BG7NUC-HC108 4193 2P BG7NUC-HC109 4194 2P BG7NUC-HC110 4195 2P BG7NUC-HC111 4196 2F BG7NUC-HC112 4197 2P BG7NUC-HC113 4198 2P BG7NUC-HC114 4199 2P BG7NUC-HC115 4200 2P BG7NUC-HC116 4201 2P BG7NUC-HC117 4202 2P BG7NUC-HC118 4203 2P BG7NUC-HC119 4204 2P BG7NUC-HC120 4205 2P BG7NUC-HC121 4206 2P BG7NUC-HC122 4207 2P BG7NUC-HC123 4208 2P BG7NUC-HC124 4209 2P BG7NUC-HC125 4210 2P BG7NUC-HC126 4211 2P BG7NUC-HC127 4212 2P BG7NUC-HC128 4213 2P BG7NUC-HC129 4214 2P BG7NUC-HC130 4215 2P BG7NUC-HC131 4216 2P BG7NUC-HC132 4217 2P BG7NUC-HC133 4218 2P BG7NUC-HC134 4219 2P BG7NUC-HC135 4220 2P BG7NUC-HC136 4221 2P BG7NUC-HC137 4222 2P BG7NUC-HC138 4223 2P BG7NUC-HC139 4224 2P BG7NUC-HC140 4225 2P BG7NUC-HC141 4226 2P BG7NUC-HC142 4227 2P BG7NUC-HC143 4228 2P BG7NUC-HC144 4229 2P BG7NUC-HC145 4230 2P BG7NUC-HC146 4231 2P BG7NUC-HC147 4232 2P BG7NUC-HC148 4233 2P BG7NUC-HC149 4234 2P BG7NUC-HC150 4235 2P BG7NUC-HC151 4236 2P BG7NUC-HC152 4237 2P BG7NUC-HC153 4238 2P BG7NUC-HC154 4239 2P BG7NUC-HC155 4240 2P BG7NUC-HC156 4241 2P BG7NUC-HC157 4242 2P BG7NUC-HC158 4243 2P BG7NUC-HC159 4244 2P BG7NUC-HC160 4245 2P BG7NUC-HC161 4246 2P BG7NUC-HC162 4247 2P BG7NUC-HC163 4248 2P BG7NUC-HC164 4249 2P BG7NUC-HC165 4250 2P BG7NUC-HC166 4251 2P BG7NUC-HC167 4252 2P BG7NUC-HC168 4253 2P BG7NUC-HC169 4254 2P BG7NUC-HC170 4255 2P BG7NUC-HC171 4256 2P BG7NUC-HC172 4257 2P BG7NUC-HC173 4258 2P BG7NUC-HC174 4259 2P BG7NUC-HC175 4260 2F BG7NUC-HC176 4261 2P BG7NUC-HC177 4262 2P BG7NUC-HC178 4263 2P BG7NUC-HC179 4264 2P BG7NUC-HC180 4265 2P BG7NUC-HC181 4266 2P BG7NUC-HC182 4267 2P BG7NUC-HC183 4268 2P BG7NUC-HC184 4269 2P BG7NUC-HC185 4270 2P BG7NUC-HC186 4271 2F BG7NUC-HC187 4272 2P BG7NUC-HC188 4273 2P BG7NUC-HC189 4274 2P BG7NUC-HC190 4275 2P BG7NUC-HC191 4276 2P BG7NUC-HC192 4277 2P BG7NUC-HC193 4278 2P BG7NUC-HC194 4279 2P BG7NUC-HC195 4280 2P BG7NUC-HC196 4281 2P BG7NUC-HC197 4282 2P BG7NUC-HC198 4283 2P BG7NUC-HC199 4284 2P BG7NUC-HC200 4285 2P BG7NUC-HC201 4286 2P BG7NUC-HC202 4287 2P BG7NUC-HC203 4288 2F BG7NUC-HC204 4289 2P BG7NUC-HC205 4290 2P BG7NUC-HC206 4291 2P BG7NUC-HC207 4292 2P BG7NUC-HC208 4293 2F BG7NUC-HC209 4294 2P BG7NUC-HC210 4295 2P BG7NUC-HC211 4296 2P BG7NUC-HC212 4297 2P BG7NUC-HC213 4298 2P BG7NUC-HC214 4299 2P BG7NUC-HC215 4300 2P BG7NUC-HC216 4301 2P BG7NUC-HC217 4302 2P BG7NUC-HC218 4303 2P BG7NUC-HC219 4304 2P BG7NUC-HC220 4305 2F BG7NUC-HC221 4306 2P BG7NUC-HC222 4307 2P BG7NUC-HC223 4308 2P BG7NUC-HC224 4309 2F BG7NUC-HC225 4310 2P BG7NUC-HC226 4311 2P BG7NUC-HC227 4312 2P BG7NUC-HC228 4313 2P BG7NUC-HC229 4314 2P BG7NUC-HC230 4315 2P BG7NUC-HC231 4316 2P BG7NUC-HC232 4317 2P BG7NUC-HC233 4318 2F BG7NUC-HC234 4319 2P BG7NUC-HC235 4320 2P BG7NUC-HC236 4321 2P BG7NUC-HC237 4322 2P BG7NUC-HC238 4323 2P BG7NUC-HC239 4324 2F BG7NUC-HC240 4325 2P BG7NUC-HC241 4326 2P BG7NUC-HC242 4327 2P BG7NUC-HC243 4328 2P BG7NUC-HC244 4329 2P BG7NUC-HC245 4330 2P BG7NUC-HC246 4331 2P BG7NUC-HC247 4332 2P BG7NUC-HC248 4333 2P BG7NUC-HC249 4334 2P BG7NUC-HC250 4335 2P BG7NUC-HC251 4336 2P BG7NUC-HC252 4337 2P BG7NUC-HC253 4338 RBD BG7NUC-HC254 4339 RBD BG7NUC-HC255 4340 RBD BG7NUC-HC256 4341 RBD BG7NUC-HC257 4342 RBD BG7NUC-HC258 4343 RBD BG7NUC-HC259 4344 RBD BG7NUC-HC260 4345 RBD BG7NUC-HC261 4346 RBD BG7NUC-HC262 4347 RBD BG7NUC-HC263 4348 RBD BG7NUC-HC264 4349 RBD BG7NUC-HC265 4350 RBD BG7NUC-HC266 4351 RBD BG7NUC-HC267 4352 RBD BG7NUC-HC268 4353 RBD BG7NUC-HC269 4354 RBD BG7NUC-HC270 4355 RBD BG7NUC-HC271 4356 RBD BG7NUC-HC272 4357 RBD BG7NUC-HC273 4358 RBD BG7NUC-HC274 4359 RBD BG7NUC-HC275 4360 RBD BG7NUC-HC276 4361 RBD BG7NUC-HC277 4362 RBD BG7NUC-HC278 4363 RBD BG7NUC-HC279 4364 RBD BG7NUC-HC280 4365 RBD BG7NUC-HC281 4366 RBD BG7NUC-HC282 4367 RBD BG7NUC-HC283 4368 RBD BG7NUC-HC284 4369 RBD BG7NUC-HC285 4370 RBD BG7NUC-HC286 4371 RBD BG7NUC-HC287 4372 RBD BG7NUC-HC288 4373 RBD BG7NUC-HC289 4374 RBD BG7NUC-HC290 4375 RBD BG7NUC-HC291 4376 RBD BG7NUC-HC292 4377 RBD BG7NUC-HC293 4378 RBD BG7NUC-HC294 4379 RBD BG7NUC-HC295 4380 RBD BG7NUC-HC296 4381 RBD BG7NUC-HC297 4382 RBD BG7NUC-HC298 4383 RBD BG7NUC-HC299 4384 RBD BG7NUC-HC300 4385 RBD BG7NUC-HC301 4386 RBD BG7NUC-HC302 4387 RBD BG7NUC-HC303 4388 RBD BG7NUC-HC304 4389 RBD BG7NUC-HC305 4390 RBD BG7NUC-HC306 4391 RBD BG7NUC-HC307 4392 RBD BG7NUC-HC308 4393 RBD BG7NUC-HC309 4394 RBD BG7NUC-HC310 4395 RBD BG7NUC-HC311 4396 RBD BG7NUC-HC312 4397 RBD BG7NUC-HC313 4398 RBD BG7NUC-HC314 4399 RBD BG7NUC-HC315 4400 RBD BG7NUC-HC316 4401 RBD BG7NUC-HC317 4402 RBD BG7NUC-HC318 4403 RBD BG7NUC-HC319 4404 RBD BG7NUC-HC320 4405 RBD BG7NUC-HC321 4406 RBD BG7NUC-HC322 4407 RBD BG7NUC-HC323 4408 RBD BG7NUC-HC324 4409 RBD BG7NUC-HC325 4410 RBD BG7NUC-HC326 4411 RBD BG7NUC-HC327 4412 RBD BG7NUC-HC328 4413 RBD BG7NUC-HC329 4414 RBD BG7NUC-HC330 4415 RBD BG7NUC-HC331 4416 RBD BG7NUC-HC332 4417 RBD BG7NUC-HC333 4418 RBD BG7NUC-HC334 4419 RBD BG7NUC-HC335 4420 RBD BG7NUC-HC336 4421 RBD BG7NUC-HC337 4422 RBD BG7NUC-HC338 4423 RBD BG7NUC-HC339 4424 RBD BG7NUC-HC340 4425 RBD BG7NUC-HC341 4426 RBD BG7NUC-HC342 4427 RBD BG7NUC-HC343 4428 RBD BG7NUC-HC344 4429 RBD BG7NUC-HC345 4430 RBD BG7NUC-HC346 4431 RBD BG7NUC-HC347 4432 RBD BG7NUC-HC348 4433 RBD BG7NUC-HC349 4434 RBD BG7NUC-HC350 4435 RBD BG7NUC-HC351 4436 RBD BG7NUC-HC352 4437 RBD BG7NUC-HC353 4438 RBD BG7NUC-HC354 4439 RBD BG7NUC-HC355 4440 RBD BG7NUC-HC356 4441 RBD BG7NUC-HC357 4442 RBD BG7NUC-HC358 4443 RBD BG7NUC-HC359 4444 RBD BG7NUC-HC360 4445 RBD BG7NUC-HC361 4446 RBD BG7NUC-HC362 4447 RBD BG7NUC-HC363 4448 RBD BG7NUC-HC364 4449 RBD BG7NUC-HC365 4450 RBD BG7NUC-HC366 4451 RBD BG7NUC-HC367 4452 RBD BG7NUC-HC368 4453 RBD BG7NUC-HC369 4454 RBD BG7NUC-HC370 4455 RBD BG7NUC-HC371 4456 RBD BG7NUC-HC372 4457 RBD BG7NUC-HC373 4458 RBD BG7NUC-HC374 4459 RBD BG7NUC-HC375 4460 RBD BG7NUC-HC376 4461 RBD BG7NUC-HC377 4462 RBD BG7NUC-HC378 4463 RBD BG7NUC-HC379 4464 RBD BG7NUC-HC380 4465 RBD BG7NUC-HC381 4466 RBD BG7NUC-HC382 4467 RBD BG7NUC-HC383 4468 RBD BG7NUC-HC384 4469 RBD BG7NUC-HC385 4470 RBD BG7NUC-HC386 4471 RBD BG7NUC-HC387 4472 RBD BG7NUC-HC388 4473 RBD BG7NUC-HC389 4474 RBD BG7NUC-HC390 4475 RBD BG7NUC-HC391 4476 RBD BG7NUC-HC392 4477 RBD BG7NUC-HC393 4478 RBD BG7NUC-HC394 4479 RBD BG7NUC-HC395 4480 RBD BG7NUC-HC396 4481 RBD BG7NUC-HC397 4482 2P BG7NUC-LC1 4483 2P BG7NUC-LC2 4484 2P BG7NUC-LC3 4485 2P BG7NUC-LC4 4486 2P BG7NUC-LC5 4487 2P BG7NUC-LC6 4488 2P BG7NUC-LC7 4489 2P BG7NUC-LC8 4490 2P BG7NUC-LC9 4491 2P BG7NUC-LC10 4492 2P BG7NUC-LC11 4493 2P BG7NUC-LC12 4494 2P BG7NUC-LC13 4495 2P BG7NUC-LC14 4496 2P BG7NUC-LC15 4497 2P BG7NUC-LC16 4498 2P BG7NUC-LC17 4499 2P BG7NUC-LC18 4500 2P BG7NUC-LC19 4501 2P BG7NUC-LC20 4502 2P BG7NUC-LC21 4503 2P BG7NUC-LC22 4504 2P BG7NUC-LC23 4505 2P BG7NUC-LC24 4506 2P BG7NUC-LC25 4507 2P BG7NUC-LC26 4508 2P BG7NUC-LC27 4509 2P BG7NUC-LC28 4510 2P BG7NUC-LC29 4511 2P BG7NUC-LC30 4512 2P BG7NUC-LC31 4513 2P BG7NUC-LC32 4514 RBD BG7NUC-LC33 4515 RBD BG7NUC-LC34 4516 RBD BG7NUC-LC35 4517 RBD BG7NUC-LC36 4518 2P BG7NUC-LC37 4519 2P BG7NUC-LC38 4520 2P BG7NUC-LC39 4521 2P BG7NUC-LC40 4522 2P BG7NUC-LC41 4523 2P BG7NUC-LC42 4524 2P BG7NUC-LC43 4525 2P BG7NUC-LC44 4526 2P BG7NUC-LC45 4527 2P BG7NUC-LC46 4528 2P BG7NUC-LC47 4529 2P BG7NUC-LC48 4530 2P BG7NUC-LC49 4531 2P BG7NUC-LC50 4532 2P BG7NUC-LC51 4533 2P BG7NUC-LC52 4534 2P BG7NUC-LC53 4535 2P BG7NUC-LC54 4536 2P BG7NUC-LC55 4537 2P BG7NUC-LC56 4538 2P BG7NUC-LC57 4539 2P BG7NUC-LC58 4540 2P BG7NUC-LC59 4541 2P BG7NUC-LC60 4542 RBD BG7NUC-LC61 4543 2P BG7NUC-LC62 4544 2P BG7NUC-LC63 4545 RBD BG7NUC-LC64 4546 RBD BG7NUC-LC65 4547 RBD BG7NUC-LC66 4548 RBD BG7NUC-LC67 4549 RBD BG7NUC-LC68 4550 2P BG7NUC-LC69 4551 2P BG7NUC-LC70 4552 2P BG7NUC-LC71 4553 2P BG7NUC-LC72 4554 2P BG7NUC-LC73 4555 2P BG7NUC-LC74 4556 2P BG7NUC-LC75 4557 2P BG7NUC-LC76 4558 2P BG7NUC-LC77 4559 2P BG7NUC-LC78 4560 2P BG7NUC-LC79 4561 2P BG7NUC-LC80 4562 2F BG7NUC-LC81 4563 2P BG7NUC-LC82 4564 2P BG7NUC-LC83 4565 2P BG7NUC-LC84 4566 2P BG7NUC-LC85 4567 2P BG7NUC-LC86 4568 2P BG7NUC-LC87 4569 2P BG7NUC-LC88 4570 2P BG7NUC-LC89 4571 2P BG7NUC-LC90 4572 2P BG7NUC-LC91 4573 2P BG7NUC-LC92 4574 2P BG7NUC-LC93 4575 2P BG7NUC-LC94 4576 2P BG7NUC-LC95 4577 2P BG7NUC-LC96 4578 2P BG7NUC-LC97 4579 2P BG7NUC-LC98 4580 2P BG7NUC-LC99 4581 2P BG7NUC-LC100 4582 2P BG7NUC-LC101 4583 2P BG7NUC-LC102 4584 2P BG7NUC-LC103 4585 2P BG7NUC-LC104 4586 2P BG7NUC-LC105 4587 2P BG7NUC-LC106 4588 2P BG7NUC-LC107 4589 2P BG7NUC-LC108 4590 2P BG7NUC-LC109 4591 2P BG7NUC-LC110 4592 2P BG7NUC-LC111 4593 2P BG7NUC-LC112 4594 2P BG7NUC-LC113 4595 2P BG7NUC-LC114 4596 2P BG7NUC-LC115 4597 2P BG7NUC-LC116 4598 2P BG7NUC-LC117 4599 2P BG7NUC-LC118 4600 2P BG7NUC-LC119 4601 2P BG7NUC-LC120 4602 2P BG7NUC-LC121 4603 2P BG7NUC-LC122 4604 2P BG7NUC-LC123 4605 2P BG7NUC-LC124 4606 2P BG7NUC-LC125 4607 2P BG7NUC-LC126 4608 2F BG7NUC-LC127 4609 2P BG7NUC-LC128 4610 2P BG7NUC-LC129 4611 2P BG7NUC-LC130 4612 2P BG7NUC-LC131 4613 2P BG7NUC-LC132 4614 2P BG7NUC-LC133 4615 2P BG7NUC-LC134 4616 2P BG7NUC-LC135 4617 2P BG7NUC-LC136 4618 2P BG7NUC-LC137 4619 2P BG7NUC-LC138 4620 2P BG7NUC-LC139 4621 2P BG7NUC-LC140 4622 2P BG7NUC-LC141 4623 2P BG7NUC-LC142 4624 2P BG7NUC-LC143 4625 2P BG7NUC-LC144 4626 2P BG7NUC-LC145 4627 2P BG7NUC-LC146 4628 2P BG7NUC-LC147 4629 2P BG7NUC-LC148 4630 2P BG7NUC-LC149 4631 2P BG7NUC-LC150 4632 2P BG7NUC-LC151 4633 2P BG7NUC-LC152 4634 2P BG7NUC-LC153 4635 2P BG7NUC-LC154 4636 2P BG7NUC-LC155 4637 2P BG7NUC-LC156 4638 2P BG7NUC-LC157 4639 2P BG7NUC-LC158 4640 2P BG7NUC-LC159 4641 2P BG7NUC-LC160 4642 2P BG7NUC-LC161 4643 2P BG7NUC-LC162 4644 2P BG7NUC-LC163 4645 2P BG7NUC-LC164 4646 2P BG7NUC-LC165 4647 2P BG7NUC-LC166 4648 2P BG7NUC-LC167 4649 2P BG7NUC-LC168 4650 2P BG7NUC-LC169 4651 2P BG7NUC-LC170 4652 2P BG7NUC-LC171 4653 2P BG7NUC-LC172 4654 2P BG7NUC-LC173 4655 2P BG7NUC-LC174 4656 2P BG7NUC-LC175 4657 2P BG7NUC-LC176 4658 2P BG7NUC-LC177 4659 2P BG7NUC-LC178 4660 2P BG7NUC-LC179 4661 2P BG7NUC-LC180 4662 2P BG7NUC-LC181 4663 2P BG7NUC-LC182 4664 2P BG7NUC-LC183 4665 2P BG7NUC-LC184 4666 2P BG7NUC-LC185 4667 2P BG7NUC-LC186 4668 2P BG7NUC-LC187 4669 2P BG7NUC-LC188 4670 2P BG7NUC-LC189 4671 2P BG7NUC-LC190 4672 2P BG7NUC-LC191 4673 2P BG7NUC-LC192 4674 2P BG7NUC-LC193 4675 2P BG7NUC-LC194 4676 2P BG7NUC-LC195 4677 2P BG7NUC-LC196 4678 2P BG7NUC-LC197 4679 2P BG7NUC-LC198 4680 2P BG7NUC-LC199 4681 2P BG7NUC-LC200 4682 2P BG7NUC-LC201 4683 2P BG7NUC-LC202 4684 2P BG7NUC-LC203 4685 2P BG7NUC-LC204 4686 2P BG7NUC-LC205 4687 2P BG7NUC-LC206 4688 2P BG7NUC-LC207 4689 2P BG7NUC-LC208 4690 2P BG7NUC-LC209 4691 2P BG7NUC-LC210 4692 2P BG7NUC-LC211 4693 2P BG7NUC-LC212 4694 2P BG7NUC-LC213 4695 2P BG7NUC-LC214 4696 2P BG7NUC-LC215 4697 2P BG7NUC-LC216 4698 2P BG7NUC-LC217 4699 2P BG7NUC-LC218 4700 2P BG7NUC-LC219 4701 2P BG7NUC-LC220 4702 2P BG7NUC-LC221 4703 2P BG7NUC-LC222 4704 2P BG7NUC-LC223 4705 2P BG7NUC-LC224 4706 2P BG7NUC-LC225 4707 2P BG7NUC-LC226 4708 2P BG7NUC-LC227 4709 2P BG7NUC-LC228 4710 2P BG7NUC-LC229 4711 2P BG7NUC-LC230 4712 2P BG7NUC-LC231 4713 2P BG7NUC-LC232 4714 2P BG7NUC-LC233 4715 2P BG7NUC-LC234 4716 2P BG7NUC-LC235 4717 2P BG7NUC-LC236 4718 2P BG7NUC-LC237 4719 2P BG7NUC-LC238 4720 2P BG7NUC-LC239 4721 2P BG7NUC-LC240 4722 2P BG7NUC-LC241 4723 2P BG7NUC-LC242 4724 2P BG7NUC-LC243 4725 2P BG7NUC-LC244 4726 2P BG7NUC-LC245 4727 2P BG7NUC-LC246 4728 2P BG7NUC-LC247 4729 2P BG7NUC-LC248 4730 2P BG7NUC-LC249 4731 2P BG7NUC-LC250 4732 2P BG7NUC-LC251 4733 2P BG7NUC-LC252 4734 2P BG7NUC-LC253 4735 RBD BG7NUC-LC254 4736 RBD BG7NUC-LC255 4737 RBD BG7NUC-LC256 4738 RBD BG7NUC-LC257 4739 RBD BG7NUC-LC258 4740 RBD BG7NUC-LC259 4741 RBD BG7NUC-LC260 4742 RBD BG7NUC-LC261 4743 RBD BG7NUC-LC262 4744 RBD BG7NUC-LC263 4745 RBD BG7NUC-LC264 4746 RBD BG7NUC-LC265 4747 RBD BG7NUC-LC266 4748 RBD BG7NUC-LC267 4749 RBD BG7NUC-LC268 4750 RBD BG7NUC-LC269 4751 RBD BG7NUC-LC270 4752 RBD BG7NUC-LC271 4753 RBD BG7NUC-LC272 4754 RBD BG7NUC-LC273 4755 RBD BG7NUC-LC274 4756 RBD BG7NUC-LC275 4757 RBD BG7NUC-LC276 4758 RBD BG7NUC-LC277 4759 RBD BG7NUC-LC278 4760 RBD BG7NUC-LC279 4761 RBD BG7NUC-LC280 4762 RBD BG7NUC-LC281 4763 RBD BG7NUC-LC282 4764 RBD BG7NUC-LC283 4765 RBD BG7NUC-LC284 4766 RBD BG7NUC-LC285 4767 RBD BG7NUC-LC286 4768 RBD BG7NUC-LC287 4769 RBD BG7NUC-LC288 4770 RBD BG7NUC-LC289 4771 RBD BG7NUC-LC290 4772 RBD BG7NUC-LC291 4773 RBD BG7NUC-LC292 4774 RBD BG7NUC-LC293 4775 RBD BG7NUC-LC294 4776 RBD BG7NUC-LC295 4777 RBD BG7NUC-LC296 4778 RBD BG7NUC-LC297 4779 RBD BG7NUC-LC298 4780 RBD BG7NUC-LC299 4781 RBD BG7NUC-LC300 4782 RBD BG7NUC-LC301 4783 RBD BG7NUC-LC302 4784 RBD BG7NUC-LC303 4785 RBD BG7NUC-LC304 4786 RBD BG7NUC-LC305 4787 RBD BG7NUC-LC306 4788 RBD BG7NUC-LC307 4789 RBD BG7NUC-LC308 4790 RBD BG7NUC-LC309 4791 RBD BG7NUC-LC310 4792 RBD BG7NUC-LC311 4793 RBD BG7NUC-LC312 4794 RBD BG7NUC-LC313 4795 RBD BG7NUC-LC314 4796 RBD BG7NUC-LC315 4797 RBD BG7NUC-LC316 4798 RBD BG7NUC-LC317 4799 RBD BG7NUC-LC318 4800 RBD BG7NUC-LC319 4801 RBD BG7NUC-LC320 4802 RBD BG7NUC-LC321 4803 RBD BG7NUC-LC322 4804 RBD BG7NUC-LC323 4805 RBD BG7NUC-LC324 4806 RBD BG7NUC-LC325 4807 RBD BG7NUC-LC326 4808 RBD BG7NUC-LC327 4809 RBD BG7NUC-LC328 4810 RBD BG7NUC-LC329 4811 RBD BG7NUC-LC330 4812 RBD BG7NUC-LC331 4813 RBD BG7NUC-LC332 4814 RBD BG7NUC-LC333 4815 RBD BG7NUC-LC334 4816 RBD BG7NUC-LC335 4817 RBD BG7NUC-LC336 4818 RBD BG7NUC-LC337 4819 RBD BG7NUC-LC338 4820 RBD BG7NUC-LC339 4821 RBD BG7NUC-LC340 4822 RBD BG7NUC-LC341 4823 RBD BG7NUC-LC342 4824 RBD BG7NUC-LC343 4825 RBD BG7NUC-LC344 4826 RBD BG7NUC-LC345 4827 RBD BG7NUC-LC346 4828 RBD BG7NUC-LC347 4829 RBD BG7NUC-LC348 4830 RBD BG7NUC-LC349 4831 RBD BG7NUC-LC350 4832 RBD BG7NUC-LC351 4833 RBD BG7NUC-LC352 4834 RBD BG7NUC-LC353 4835 RBD BG7NUC-LC354 4836 RBD BG7NUC-LC355 4837 RBD BG7NUC-LC356 4838 RBD BG7NUC-LC357 4839 RBD BG7NUC-LC358 4840 RBD BG7NUC-LC359 4841 RBD BG7NUC-LC360 4842 RBD BG7NUC-LC361 4843 RBD BG7NUC-LC362 4844 RBD BG7NUC-LC363 4845 RBD BG7NUC-LC364 4846 RBD BG7NUC-LC365 4847 RBD BG7NUC-LC366 4848 RBD BG7NUC-LC367 4849 RBD BG7NUC-LC368 4850 RBD BG7NUC-LC369 4851 RBD BG7NUC-LC370 4852 RBD BG7NUC-LC371 4853 RBD BG7NUC-LC372 4854 RBD BG7NUC-LC373 4855 RBD BG7NUC-LC374 4856 RBD BG7NUC-LC375 4857 RBD BG7NUC-LC376 4858 RBD BG7NUC-LC377 4859 RBD BG7NUC-LC378 4860 RBD BG7NUC-LC379 4861 RBD BG7NUC-LC380 4862 RBD BG7NUC-LC381 4863 RBD BG7NUC-LC382 4864 RBD BG7NUC-LC383 4865 RBD BG7NUC-LC384 4866 RBD BG7NUC-LC385 4867 RBD BG7NUC-LC386 4868 RBD BG7NUC-LC387 4869 RBD BG7NUC-LC388 4870 RBD BG7NUC-LC389 4871 RBD BG7NUC-LC390 4872 RBD BG7NUC-LC391 4873 RBD BG7NUC-LC392 4874 RBD BG7NUC-LC393 4875 RBD BG7NUC-LC394 4876 RBD BG7NUC-LC395 4877 RBD BG7NUC-LC396 4878 RBD BG7NUC-LC397 4879 2P BG9NUC-HC1 4880 2P BG9NUC-HC2 4881 2P BG9NUC-HC3 4882 2P BG9NUC-HC4 4883 2P BG9NUC-HC5 4884 2P BG9NUC-HC6 4885 2P BG9NUC-HC7 4886 RBD BG9NUC-HC8 4887 RBD BG9NUC-HC9 4888 RBD BG9NUC-HC10 4889 2P BG9NUC-HC11 4890 RBD BG9NUC-HC12 4891 RBD BG9NUC-HC13 4892 RBD BG9NUC-HC14 4893 RBD BG9NUC-HC15 4894 2P BG9NUC-HC16 4895 2P BG9NUC-HC17 4896 2P BG9NUC-HC18 4897 2P BG9NUC-HC19 4898 2P BG9NUC-HC20 4899 2P BG9NUC-HC21 4900 2P BG9NUC-HC22 4901 RBD BG9NUC-HC23 4902 2P BG9NUC-HC24 4903 RBD BG9NUC-HC25 4904 RBD BG9NUC-HC26 4905 RBD BG9NUC-HC27 4906 RBD BG9NUC-HC28 4907 2P BG9NUC-HC29 4908 2P BG9NUC-HC30 4909 RBD BG9NUC-HC31 4910 2P BG9NUC-HC32 4911 RBD BG9NUC-HC33 4912 RBD BG9NUC-HC34 4913 RBD BG9NUC-HC35 4914 RBD BG9NUC-HC36 4915 2P BG9NUC-HC37 4916 2P BG9NUC-HC38 4917 2P BG9NUC-HC39 4918 RBD BG9NUC-HC40 4919 2P BG9NUC-HC41 4920 2P BG9NUC-HC42 4921 RBD BG9NUC-HC43 4922 2P BG9NUC-HC44 4923 2P BG9NUC-HC45 4924 RBD BG9NUC-HC46 4925 2P BG9NUC-HC47 4926 2P BG9NUC-HC48 4927 RBD BG9NUC-HC49 4928 2P BG9NUC-HC50 4929 2P BG9NUC-HC51 4930 RBD BG9NUC-HC52 4931 2P BG9NUC-HC53 4932 RBD BG9NUC-HC54 4933 RBD BG9NUC-HC55 4934 2P BG9NUC-HC56 4935 2P BG9NUC-HC57 4936 RBD BG9NUC-HC58 4937 RBD BG9NUC-HC59 4938 RBD BG9NUC-HC60 4939 2P BG9NUC-HC61 4940 2P BG9NUC-HC62 4941 RBD BG9NUC-HC63 4942 2P BG9NUC-HC64 4943 2P BG9NUC-HC65 4944 2P BG9NUC-HC66 4945 2P BG9NUC-HC67 4946 2P BG9NUC-HC68 4947 RBD BG9NUC-HC69 4948 2P BG9NUC-HC70 4949 2P BG9NUC-HC71 4950 RBD BG9NUC-HC72 4951 2P BG9NUC-HC73 4952 2P BG9NUC-HC74 4953 2P BG9NUC-HC75 4954 RBD BG9NUC-HC76 4955 RBD BG9NUC-HC77 4956 RBD BG9NUC-HC78 4957 2P BG9NUC-HC79 4958 2P BG9NUC-HC80 4959 2P BG9NUC-HC81 4960 2P BG9NUC-HC82 4961 RBD BG9NUC-HC83 4962 RBD BG9NUC-HC84 4963 RBD BG9NUC-HC85 4964 RBD BG9NUC-HC86 4965 2P BG9NUC-HC87 4966 2P BG9NUC-HC88 4967 2P BG9NUC-HC89 4968 2P BG9NUC-HC90 4969 2P BG9NUC-HC91 4970 RBD BG9NUC-HC92 4971 2P BG9NUC-HC93 4972 2P BG9NUC-HC94 4973 RBD BG9NUC-HC95 4974 2P BG9NUC-HC96 4975 2P BG9NUC-HC97 4976 2P BG9NUC-HC98 4977 2P BG9NUC-HC99 4978 RBD BG9NUC-HC100 4979 RBD BG9NUC-HC101 4980 RBD BG9NUC-HC102 4981 2P BG9NUC-HC103 4982 RBD BG9NUC-HC104 4983 2P BG9NUC-HC105 4984 2P BG9NUC-HC106 4985 RBD BG9NUC-HC107 4986 RBD BG9NUC-HC108 4987 RBD BG9NUC-HC109 4988 2P BG9NUC-HC110 4989 2P BG9NUC-HC111 4990 2P BG9NUC-HC112 4991 RBD BG9NUC-HC113 4992 2P BG9NUC-HC114 4993 2P BG9NUC-HC115 4994 RBD BG9NUC-HC116 4995 RBD BG9NUC-HC117 4996 RBD BG9NUC-HC118 4997 2P BG9NUC-HC119 4998 2P BG9NUC-HC120 4999 RBD BG9NUC-HC121 5000 RBD BG9NUC-HC122 5001 2P BG9NUC-HC123 5002 2P BG9NUC-HC124 5003 2P BG9NUC-HC125 5004 2P BG9NUC-HC126 5005 RBD BG9NUC-HC127 5006 2P BG9NUC-HC128 5007 RBD BG9NUC-HC129 5008 RBD BG9NUC-HC130 5009 RBD BG9NUC-HC131 5010 RBD BG9NUC-HC132 5011 2P BG9NUC-HC133 5012 RBD BG9NUC-HC134 5013 2P BG9NUC-HC135 5014 RBD BG9NUC-HC136 5015 2P BG9NUC-HC137 5016 RBD BG9NUC-HC138 5017 2P BG9NUC-HC139 5018 2P BG9NUC-HC140 5019 2P BG9NUC-HC141 5020 2P BG9NUC-HC142 5021 2P BG9NUC-HC143 5022 2P BG9NUC-HC144 5023 2P BG9NUC-HC145 5024 2P BG9NUC-HC146 5025 RBD BG9NUC-HC147 5026 RBD BG9NUC-HC148 5027 RBD BG9NUC-HC149 5028 RBD BG9NUC-HC150 5029 2P BG9NUC-HC151 5030 2P BG9NUC-HC152 5031 RBD BG9NUC-HC153 5032 2P BG9NUC-HC154 5033 2P BG9NUC-HC155 5034 2P BG9NUC-HC156 5035 2P BG9NUC-HC157 5036 RBD BG9NUC-HC158 5037 2P BG9NUC-HC159 5038 2P BG9NUC-HC160 5039 2P BG9NUC-HC161 5040 RBD BG9NUC-HC162 5041 2P BG9NUC-HC163 5042 2P BG9NUC-HC164 5043 RBD BG9NUC-HC165 5044 2P BG9NUC-HC166 5045 RBD BG9NUC-HC167 5046 RBD BG9NUC-HC168 5047 RBD BG9NUC-HC169 5048 RBD BG9NUC-HC170 5049 RBD BG9NUC-HC171 5050 2P BG9NUC-HC172 5051 RBD BG9NUC-HC173 5052 2P BG9NUC-HC174 5053 RBD BG9NUC-HC175 5054 RBD BG9NUC-HC176 5055 2P BG9NUC-HC177 5056 RBD BG9NUC-HC178 5057 2P BG9NUC-HC179 5058 2P BG9NUC-HC180 5059 2P BG9NUC-HC181 5060 RBD BG9NUC-HC182 5061 2P BG9NUC-HC183 5062 RBD BG9NUC-HC184 5063 2P BG9NUC-HC185 5064 RBD BG9NUC-HC186 5065 2P BG9NUC-HC187 5066 2P BG9NUC-HC188 5067 2P BG9NUC-HC189 5068 2P BG9NUC-HC190 5069 2P BG9NUC-HC191 5070 RBD BG9NUC-HC192 5071 2P BG9NUC-HC193 5072 2P BG9NUC-HC194 5073 RBD BG9NUC-HC195 5074 RBD BG9NUC-HC196 5075 2P BG9NUC-HC197 5076 RBD BG9NUC-HC198 5077 2P BG9NUC-HC199 5078 2P BG9NUC-HC200 5079 RBD BG9NUC-HC201 5080 2P BG9NUC-HC202 5081 2P BG9NUC-HC203 5082 2P BG9NUC-HC204 5083 2P BG9NUC-HC205 5084 RBD BG9NUC-HC206 5085 RBD BG9NUC-HC207 5086 2P BG9NUC-HC208 5087 RBD BG9NUC-HC209 5088 RBD BG9NUC-HC210 5089 2P BG9NUC-HC211 5090 RBD BG9NUC-HC212 5091 RBD BG9NUC-HC213 5092 2P BG9NUC-HC214 5093 2P BG9NUC-HC215 5094 RBD BG9NUC-HC216 5095 2P BG9NUC-HC217 5096 2P BG9NUC-HC218 5097 RBD BG9NUC-HC219 5098 RBD BG9NUC-HC220 5099 2P BG9NUC-HC221 5100 RBD BG9NUC-HC222 5101 2P BG9NUC-HC223 5102 2P BG9NUC-HC224 5103 RBD BG9NUC-HC225 5104 2P BG9NUC-HC226 5105 RBD BG9NUC-HC227 5106 RBD BG9NUC-HC228 5107 2P BG9NUC-HC229 5108 2P BG9NUC-HC230 5109 2P BG9NUC-HC231 5110 RBD BG9NUC-HC232 5111 RBD BG9NUC-HC233 5112 RBD BG9NUC-HC234 5113 2P BG9NUC-LC1 5114 2P BG9NUC-LC2 5115 2P BG9NUC-LC3 5116 2P BG9NUC-LC4 5117 2P BG9NUC-LC5 5118 2P BG9NUC-LC6 5119 2P BG9NUC-LC7 5120 RBD BG9NUC-LC8 5121 RBD BG9NUC-LC9 5122 RBD BG9NUC-LC10 5123 2F BG9NUC-LC11 5124 RBD BG9NUC-LC12 5125 RBD BG9NUC-LC13 5126 RBD BG9NUC-LC14 5127 RBD BG9NUC-LC15 5128 2P BG9NUC-LC16 5129 2P BG9NUC-LC17 5130 2P BG9NUC-LC18 5131 2P BG9NUC-LC19 5132 2P BG9NUC-LC20 5133 2P BG9NUC-LC21 5134 2P BG9NUC-LC22 5135 RBD BG9NUC-LC23 5136 2F BG9NUC-LC24 5137 RBD BG9NUC-LC25 5138 RBD BG9NUC-LC26 5139 RBD BG9NUC-LC27 5140 RBD BG9NUC-LC28 5141 2F BG9NUC-LC29 5142 2P BG9NUC-LC30 5143 RBD BG9NUC-LC31 5144 2P BG9NUC-LC32 5145 RBD BG9NUC-LC33 5146 RBD BG9NUC-LC34 5147 RBD BG9NUC-LC35 5148 RBD BG9NUC-LC36 5149 2P BG9NUC-LC37 5150 2P BG9NUC-LC38 5151 2P BG9NUC-LC39 5152 RBD BG9NUC-LC40 5153 2P BG9NUC-LC41 5154 2P BG9NUC-LC42 5155 RBD BG9NUC-LC43 5156 2P BG9NUC-LC44 5157 2F BG9NUC-LC45 5158 RBD BG9NUC-LC46 5159 2P BG9NUC-LC47 5160 2P BG9NUC-LC48 5161 RBD BG9NUC-LC49 5162 2P BG9NUC-LC50 5163 2P BG9NUC-LC51 5164 RBD BG9NUC-LC52 5165 2P BG9NUC-LC53 5166 RBD BG9NUC-LC54 5167 RBD BG9NUC-LC55 5168 2P BG9NUC-LC56 5169 2F BG9NUC-LC57 5170 RBD BG9NUC-LC58 5171 RBD BG9NUC-LC59 5172 RBD BG9NUC-LC60 5173 2P BG9NUC-LC61 5174 2P BG9NUC-LC62 5175 RBD BG9NUC-LC63 5176 2P BG9NUC-LC64 5177 2P BG9NUC-LC65 5178 2P BG9NUC-LC66 5179 2P BG9NUC-LC67 5180 2P BG9NUC-LC68 5181 RBD BG9NUC-LC69 5182 2F BG9NUC-LC70 5183 2P BG9NUC-LC71 5184 RBD BG9NUC-LC72 5185 2P BG9NUC-LC73 5186 2P BG9NUC-LC74 5187 2P BG9NUC-LC75 5188 RBD BG9NUC-LC76 5189 RBD BG9NUC-LC77 5190 RBD BG9NUC-LC78 5191 2F BG9NUC-LC79 5192 2P BG9NUC-LC80 5193 2P BG9NUC-LC81 5194 2P BG9NUC-LC82 5195 RBD BG9NUC-LC83 5196 RBD BG9NUC-LC84 5197 RBD BG9NUC-LC85 5198 RBD BG9NUC-LC86 5199 2P BG9NUC-LC87 5200 2P BG9NUC-LC88 5201 2P BG9NUC-LC89 5202 2P BG9NUC-LC90 5203 2P BG9NUC-LC91 5204 RBD BG9NUC-LC92 5205 2P BG9NUC-LC93 5206 2P BG9NUC-LC94 5207 RBD BG9NUC-LC95 5208 2P BG9NUC-LC96 5209 2P BG9NUC-LC97 5210 2P BG9NUC-LC98 5211 2P BG9NUC-LC99 5212 RBD BG9NUC-LC100 5213 RBD BG9NUC-LC101 5214 RBD BG9NUC-LC102 5215 2P BG9NUC-LC103 5216 RBD BG9NUC-LC104 5217 2P BG9NUC-LC105 5218 2P BG9NUC-LC106 5219 RBD BG9NUC-LC107 5220 RBD BG9NUC-LC108 5221 RBD BG9NUC-LC109 5222 2P BG9NUC-LC110 5223 2P BG9NUC-LC111 5224 2P BG9NUC-LC112 5225 RBD BG9NUC-LC113 5226 2P BG9NUC-LC114 5227 2P BG9NUC-LC115 5228 RBD BG9NUC-LC116 5229 RBD BG9NUC-LC117 5230 RBD BG9NUC-LC118 5231 2P BG9NUC-LC119 5232 2P BG9NUC-LC120 5233 RBD BG9NUC-LC121 5234 RBD BG9NUC-LC122 5235 2P BG9NUC-LC123 5236 2P BG9NUC-LC124 5237 2P BG9NUC-LC125 5238 2P BG9NUC-LC126 5239 RBD BG9NUC-LC127 5240 2P BG9NUC-LC128 5241 RBD BG9NUC-LC129 5242 RBD BG9NUC-LC130 5243 RBD BG9NUC-LC131 5244 RBD BG9NUC-LC132 5245 2P BG9NUC-LC133 5246 RBD BG9NUC-LC134 5247 2P BG9NUC-LC135 5248 RBD BG9NUC-LC136 5249 2P BG9NUC-LC137 5250 RBD BG9NUC-LC138 5251 2P BG9NUC-LC139 5252 2P BG9NUC-LC140 5253 2P BG9NUC-LC141 5254 2P BG9NUC-LC142 5255 2P BG9NUC-LC143 5256 2P BG9NUC-LC144 5257 2P BG9NUC-LC145 5258 2P BG9NUC-LC146 5259 RBD BG9NUC-LC147 5260 RBD BG9NUC-LC148 5261 RBD BG9NUC-LC149 5262 RBD BG9NUC-LC150 5263 2P BG9NUC-LC151 5264 2P BG9NUC-LC152 5265 RBD BG9NUC-LC153 5266 2P BG9NUC-LC154 5267 2P BG9NUC-LC155 5268 2P BG9NUC-LC156 5269 2P BG9NUC-LC157 5270 RBD BG9NUC-LC158 5271 2P BG9NUC-LC159 5272 2P BG9NUC-LC160 5273 2P BG9NUC-LC161 5274 RBD BG9NUC-LC162 5275 2P BG9NUC-LC163 5276 2P BG9NUC-LC164 5277 RBD BG9NUC-LC165 5278 2P BG9NUC-LC166 5279 RBD BG9NUC-LC167 5280 RBD BG9NUC-LC168 5281 RBD BG9NUC-LC169 5282 RBD BG9NUC-LC170 5283 RBD BG9NUC-LC171 5284 2P BG9NUC-LC172 5285 RBD BG9NUC-LC173 5286 2P BG9NUC-LC174 5287 RBD BG9NUC-LC175 5288 RBD BG9NUC-LC176 5289 2P BG9NUC-LC177 5290 RBD BG9NUC-LC178 5291 2P BG9NUC-LC179 5292 2P BG9NUC-LC180 5293 2P BG9NUC-LC181 5294 RBD BG9NUC-LC182 5295 2P BG9NUC-LC183 5296 RBD BG9NUC-LC184 5297 2P BG9NUC-LC185 5298 RBD BG9NUC-LC186 5299 2P BG9NUC-LC187 5300 2P BG9NUC-LC188 5301 2P BG9NUC-LC189 5302 2P BG9NUC-LC190 5303 2P BG9NUC-LC191 5304 RBD BG9NUC-LC192 5305 2P BG9NUC-LC193 5306 2P BG9NUC-LC194 5307 RBD BG9NUC-LC195 5308 RBD BG9NUC-LC196 5309 2P BG9NUC-LC197 5310 RBD BG9NUC-LC198 5311 2P BG9NUC-LC199 5312 2P BG9NUC-LC200 5313 RBD BG9NUC-LC201 5314 2P BG9NUC-LC202 5315 2P BG9NUC-LC203 5316 2P BG9NUC-LC204 5317 2P BG9NUC-LC205 5318 RBD BG9NUC-LC206 5319 RBD BG9NUC-LC207 5320 2P BG9NUC-LC208 5321 RBD BG9NUC-LC209 5322 RBD BG9NUC-LC210 5323 2P BG9NUC-LC211 5324 RBD BG9NUC-LC212 5325 RBD BG9NUC-LC213 5326 2P BG9NUC-LC214 5327 2P BG9NUC-LC215 5328 RBD BG9NUC-LC216 5329 2P BG9NUC-LC217 5330 2P BG9NUC-LC218 5331 RBD BG9NUC-LC219 5332 RBD BG9NUC-LC220 5333 2P BG9NUC-LC221 5334 RBD BG9NUC-LC222 5335 2P BG9NUC-LC223 5336 2P BG9NUC-LC224 5337 RBD BG9NUC-LC225 5338 2P BG9NUC-LC226 5339 RBD BG9NUC-LC227 5340 RBD BG9NUC-LC228 5341 2P BG9NUC-LC229 5342 2P BG9NUC-LC230 5343 2P BG9NUC-LC231 5344 RBD BG9NUC-LC232 5345 RBD BG9NUC-LC233 5346 RBD BG9NUC-LC234 5347 RBD BG10NUC-HC1 5348 RBD BG10NUC-HC2 5349 RBD BG10NUC-HC3 5350 RBD BG10NUC-HC4 5351 RBD BG10NUC-HC5 5352 RBD BG10NUC-HC6 5353 RBD BG10NUC-HC7 5354 RBD BG10NUC-HC8 5355 RBD BG10NUC-HC9 5356 RBD BG10NUC-HC10 5357 RBD BG10NUC-HC11 5358 RBD BG10NUC-HC12 5359 RBD BG10NUC-HC13 5360 RBD BG10NUC-HC14 5361 RBD BG10NUC-HC15 5362 RBD BG10NUC-HC16 5363 RBD BG10NUC-HC17 5364 RBD BG10NUC-HC18 5365 RBD BG10NUC-HC19 5366 RBD BG10NUC-HC20 5367 RBD BG10NUC-HC21 5368 RBD BG10NUC-HC22 5369 RBD BG10NUC-HC23 5370 RBD BG10NUC-HC24 5371 RBD BG10NUC-HC25 5372 RBD BG10NUC-HC26 5373 RBD BG10NUC-HC27 5374 2P BG10NUC-HC28 5375 2P BG10NUC-HC29 5376 2P BG10NUC-HC30 5377 2P BG10NUC-HC31 5378 2P BG10NUC-HC32 5379 2P BG10NUC-HC33 5380 2P BG10NUC-HC34 5381 2P BG10NUC-HC35 5382 2P BG10NUC-HC36 5383 RBD BG10NUC-HC37 5384 RBD BG10NUC-HC38 5385 RBD BG10NUC-HC39 5386 RBD BG10NUC-HC40 5387 RBD BG10NUC-HC41 5388 RBD BG10NUC-HC42 5389 RBD BG10NUC-HC43 5390 RBD BG10NUC-HC44 5391 RBD BG10NUC-HC45 5392 RBD BG10NUC-HC46 5393 RBD BG10NUC-HC47 5394 RBD BG10NUC-HC48 5395 RBD BG10NUC-HC49 5396 RBD BG10NUC-HC50 5397 RBD BG10NUC-HC51 5398 RBD BG10NUC-HC52 5399 RBD BG10NUC-HC53 5400 RBD BG10NUC-HC54 5401 2P BG10NUC-HC55 5402 RBD BG10NUC-HC56 5403 RBD BG10NUC-HC57 5404 2P BG10NUC-HC58 5405 RBD BG10NUC-HC59 5406 RBD BG10NUC-HC60 5407 RBD BG10NUC-HC61 5408 RBD BG10NUC-HC62 5409 RBD BG10NUC-HC63 5410 RBD BG10NUC-HC64 5411 RBD BG10NUC-HC65 5412 RBD BG10NUC-HC66 5413 2P BG10NUC-HC67 5414 2P BG10NUC-HC68 5415 2P BG10NUC-HC69 5416 RBD BG10NUC-HC70 5417 RBD BG10NUC-HC71 5418 RBD BG10NUC-HC72 5419 RBD BG10NUC-HC73 5420 2P BG10NUC-HC74 5421 2P BG10NUC-HC75 5422 2P BG10NUC-HC76 5423 2P BG10NUC-HC77 5424 RBD BG10NUC-HC78 5425 RBD BG10NUC-HC79 5426 RBD BG10NUC-HC80 5427 RBD BG10NUC-HC81 5428 2P BG10NUC-HC82 5429 RBD BG10NUC-HC83 5430 RBD BG10NUC-HC84 5431 RBD BG10NUC-HC85 5432 RBD BG10NUC-HC86 5433 RBD BG10NUC-HC87 5434 2P BG10NUC-HC88 5435 2P BG10NUC-HC89 5436 RBD BG10NUC-HC90 5437 RBD BG10NUC-HC91 5438 2P BG10NUC-HC92 5439 RBD BG10NUC-HC93 5440 RBD BG10NUC-HC94 5441 2P BG10NUC-HC95 5442 2P BG10NUC-HC96 5443 2P BG10NUC-HC97 5444 2P BG10NUC-HC98 5445 2P BG10NUC-HC99 5446 RBD BG10NUC-HC100 5447 RBD BG10NUC-HC101 5448 2P BG10NUC-HC102 5449 2P BG10NUC-HC103 5450 RBD BG10NUC-HC104 5451 2P BG10NUC-HC105 5452 2P BG10NUC-HC106 5453 2P BG10NUC-HC107 5454 2P BG10NUC-HC108 5455 2P BG10NUC-HC109 5456 2P BG10NUC-HC110 5457 RBD BG10NUC-HC111 5458 2P BG10NUC-HC112 5459 2P BG10NUC-HC113 5460 2P BG10NUC-HC114 5461 RBD BG10NUC-HC115 5462 2P BG10NUC-HC116 5463 2P BG10NUC-HC117 5464 2P BG10NUC-HC118 5465 2P BG10NUC-HC119 5466 2P BG10NUC-HC120 5467 2P BG10NUC-HC121 5468 2P BG10NUC-HC122 5469 2P BG10NUC-HC123 5470 2P BG10NUC-HC124 5471 2P BG10NUC-HC125 5472 2P BG10NUC-HC126 5473 RBD BG10NUC-HC127 5474 RBD BG10NUC-HC128 5475 RBD BG10NUC-HC129 5476 2P BG10NUC-HC130 5477 2P BG10NUC-HC131 5478 2P BG10NUC-HC132 5479 2P BG10NUC-HC133 5480 2P BG10NUC-HC134 5481 2P BG10NUC-HC135 5482 2P BG10NUC-HC136 5483 2P BG10NUC-HC137 5484 RBD BG10NUC-HC138 5485 2P BG10NUC-HC139 5486 2P BG10NUC-HC140 5487 RBD BG10NUC-HC141 5488 RBD BG10NUC-HC142 5489 2P BG10NUC-HC143 5490 2P BG10NUC-HC144 5491 2P BG10NUC-HC145 5492 2P BG10NUC-HC146 5493 2P BG10NUC-HC147 5494 2P BG10NUC-HC148 5495 2P BG10NUC-HC149 5496 2P BG10NUC-HC150 5497 RBD BG10NUC-HC151 5498 RBD BG10NUC-HC152 5499 RBD BG10NUC-HC153 5500 RBD BG10NUC-HC154 5501 2P BG10NUC-HC155 5502 2P BG10NUC-HC156 5503 2P BG10NUC-HC157 5504 RBD BG10NUC-HC158 5505 2P BG10NUC-HC159 5506 RBD BG10NUC-HC160 5507 2P BG10NUC-HC161 5508 RBD BG10NUC-HC162 5509 RBD BG10NUC-HC163 5510 RBD BG10NUC-HC164 5511 2P BG10NUC-HC165 5512 2P BG10NUC-HC166 5513 2P BG10NUC-HC167 5514 RBD BG10NUC-HC168 5515 RBD BG10NUC-HC169 5516 RBD BG10NUC-HC170 5517 2P BG10NUC-HC171 5518 2P BG10NUC-HC172 5519 2P BG10NUC-HC173 5520 2P BG10NUC-HC174 5521 2F BG10NUC-HC175 5522 2P BG10NUC-HC176 5523 RBD BG10NUC-HC177 5524 2P BG10NUC-HC178 5525 RBD BG10NUC-HC179 5526 2P BG10NUC-HC180 5527 2P BG10NUC-HC181 5528 RBD BG10NUC-HC182 5529 2P BG10NUC-HC183 5530 2P BG10NUC-HC184 5531 2P BG10NUC-HC185 5532 2P BG10NUC-HC186 5533 2P BG10NUC-HC187 5534 2P BG10NUC-HC188 5535 2P BG10NUC-HC189 5536 2P BG10NUC-HC190 5537 2P BG10NUC-HC191 5538 RBD BG10NUC-HC192 5539 2P BG10NUC-HC193 5540 RBD BG10NUC-HC194 5541 2P BG10NUC-HC195 5542 RBD BG10NUC-HC196 5543 2P BG10NUC-HC197 5544 2P BG10NUC-HC198 5545 RBD BG10NUC-HC199 5546 2P BG10NUC-HC200 5547 RBD BG10NUC-HC201 5548 2P BG10NUC-HC202 5549 RBD BG10NUC-HC203 5550 2P BG10NUC-HC204 5551 RBD BG10NUC-HC205 5552 2P BG10NUC-HC206 5553 RBD BG10NUC-HC207 5554 RBD BG10NUC-HC208 5555 2P BG10NUC-HC209 5556 2P BG10NUC-HC210 5557 2P BG10NUC-HC211 5558 2P BG10NUC-HC212 5559 2P BG10NUC-HC213 5560 2P BG10NUC-HC214 5561 2P BG10NUC-HC215 5562 2P BG10NUC-HC216 5563 2P BG10NUC-HC217 5564 RBD BG10NUC-HC218 5565 2P BG10NUC-HC219 5566 2P BG10NUC-HC220 5567 2F BG10NUC-HC221 5568 2F BG10NUC-HC222 5569 RBD BG10NUC-HC223 5570 RBD BG10NUC-HC224 5571 RBD BG10NUC-HC225 5572 2P BG10NUC-HC226 5573 2F BG10NUC-HC227 5574 2P BG10NUC-HC228 5575 2P BG10NUC-HC229 5576 2F BG10NUC-HC230 5577 2P BG10NUC-HC231 5578 RBD BG10NUC-HC232 5579 RBD BG10NUC-HC233 5580 RBD BG10NUC-HC234 5581 RBD BG10NUC-HC235 5582 2P BG10NUC-HC236 5583 RBD BG10NUC-HC237 5584 RBD BG10NUC-HC238 5585 2P BG10NUC-HC239 5586 2P BG10NUC-HC240 5587 2P BG10NUC-HC241 5588 2P BG10NUC-HC242 5589 RBD BG10NUC-HC243 5590 2P BG10NUC-HC244 5591 RBD BG10NUC-HC245 5592 2P BG10NUC-HC246 5593 2P BG10NUC-HC247 5594 2P BG10NUC-HC248 5595 2P BG10NUC-HC249 5596 2P BG10NUC-HC250 5597 2P BG10NUC-HC251 5598 2F BG10NUC-HC252 5599 2P BG10NUC-HC253 5600 2P BG10NUC-HC254 5601 2P BG10NUC-HC255 5602 2P BG10NUC-HC256 5603 2P BG10NUC-HC257 5604 2P BG10NUC-HC258 5605 RBD BG10NUC-HC259 5606 RBD BG10NUC-HC260 5607 2P BG10NUC-HC261 5608 RBD BG10NUC-HC262 5609 2P BG10NUC-HC263 5610 2P BG10NUC-HC264 5611 RBD BG10NUC-HC265 5612 RBD BG10NUC-HC266 5613 RBD BG10NUC-HC267 5614 RBD BG10NUC-HC268 5615 2P BG10NUC-HC269 5616 2P BG10NUC-HC270 5617 RBD BG10NUC-HC271 5618 2P BG10NUC-HC272 5619 2P BG10NUC-HC273 5620 RBD BG10NUC-HC274 5621 2P BG10NUC-HC275 5622 RBD BG10NUC-HC276 5623 RBD BG10NUC-HC277 5624 RBD BG10NUC-HC278 5625 2P BG10NUC-HC279 5626 2P BG10NUC-HC280 5627 2P BG10NUC-HC281 5628 2F BG10NUC-HC282 5629 2F BG10NUC-HC283 5630 2P BG10NUC-HC284 5631 2P BG10NUC-HC285 5632 2P BG10NUC-HC286 5633 RBD BG10NUC-HC287 5634 RBD BG10NUC-HC288 5635 RBD BG10NUC-HC289 5636 2P BG10NUC-HC290 5637 2P BG10NUC-HC291 5638 RBD BG10NUC-HC292 5639 2P BG10NUC-HC293 5640 RBD BG10NUC-HC294 5641 RBD BG10NUC-HC295 5642 RBD BG10NUC-HC296 5643 RBD BG10NUC-HC297 5644 2P BG10NUC-HC298 5645 RBD BG10NUC-HC299 5646 RBD BG10NUC-HC300 5647 RBD BG10NUC-HC301 5648 RBD BG10NUC-HC302 5649 RBD BG10NUC-HC303 5650 RBD BG10NUC-HC304 5651 2P BG10NUC-HC305 5652 RBD BG10NUC-HC306 5653 RBD BG10NUC-HC307 5654 2P BG10NUC-HC308 5655 2P BG10NUC-HC309 5656 RBD BG10NUC-HC310 5657 2P BG10NUC-HC311 5658 2P BG10NUC-HC312 5659 2P BG10NUC-HC313 5660 2P BG10NUC-HC314 5661 2P BG10NUC-HC315 5662 2P BG10NUC-HC316 5663 2F BG10NUC-HC317 5664 RBD BG10NUC-HC318 5665 2P BG10NUC-HC319 5666 2P BG10NUC-HC320 5667 2P BG10NUC-HC321 5668 2P BG10NUC-HC322 5669 2P BG10NUC-HC323 5670 RBD BG10NUC-HC324 5671 RBD BG10NUC-HC325 5672 2P BG10NUC-HC326 5673 2P BG10NUC-HC327 5674 2P BG10NUC-HC328 5675 2P BG10NUC-HC329 5676 RBD BG10NUC-HC330 5677 2P BG10NUC-HC331 5678 RBD BG10NUC-HC332 5679 RBD BG10NUC-HC333 5680 RBD BG10NUC-HC334 5681 2P BG10NUC-HC335 5682 2P BG10NUC-HC336 5683 2P BG10NUC-HC337 5684 RBD BG10NUC-HC338 5685 2P BG10NUC-HC339 5686 2P BG10NUC-HC340 5687 2P BG10NUC-HC341 5688 2P BG10NUC-HC342 5689 RBD BG10NUC-HC343 5690 2P BG10NUC-HC344 5691 RBD BG10NUC-HC345 5692 2P BG10NUC-HC346 5693 2P BG10NUC-HC347 5694 2P BG10NUC-HC348 5695 2P BG10NUC-HC349 5696 2P BG10NUC-HC350 5697 2P BG10NUC-HC351 5698 RBD BG10NUC-HC352 5699 2P BG10NUC-HC353 5700 2P BG10NUC-HC354 5701 2F BG10NUC-HC355 5702 RBD BG10NUC-HC356 5703 RBD BG10NUC-HC357 5704 2P BG10NUC-HC358 5705 RBD BG10NUC-HC359 5706 RBD BG10NUC-HC360 5707 2P BG10NUC-HC361 5708 2P BG10NUC-HC362 5709 2P BG10NUC-HC363 5710 RBD BG10NUC-HC364 5711 2P BG10NUC-HC365 5712 2P BG10NUC-HC366 5713 RBD BG10NUC-HC367 5714 RBD BG10NUC-HC368 5715 2P BG10NUC-HC369 5716 2P BG10NUC-HC370 5717 2P BG10NUC-HC371 5718 RBD BG10NUC-HC372 5719 RBD BG10NUC-HC373 5720 RBD BG10NUC-HC374 5721 2P BG10NUC-HC375 5722 2F BG10NUC-HC376 5723 2P BG10NUC-HC377 5724 2P BG10NUC-HC378 5725 2P BG10NUC-HC379 5726 2P BG10NUC-HC380 5727 2P BG10NUC-HC381 5728 RBD BG10NUC-HC382 5729 RBD BG10NUC-HC383 5730 RBD BG10NUC-HC384 5731 RBD BG10NUC-HC385 5732 RBD BG10NUC-HC386 5733 2P BG10NUC-HC387 5734 2F BG10NUC-HC388 5735 RBD BG10NUC-HC389 5736 2P BG10NUC-HC390 5737 2P BG10NUC-HC391 5738 2P BG10NUC-HC392 5739 2P BG10NUC-HC393 5740 2P BG10NUC-HC394 5741 2P BG10NUC-HC395 5742 2P BG10NUC-HC396 5743 RBD BG10NUC-HC397 5744 2P BG10NUC-HC398 5745 2P BG10NUC-HC399 5746 RBD BG10NUC-HC400 5747 2P BG10NUC-HC401 5748 2P BG10NUC-HC402 5749 2P BG10NUC-HC403 5750 RBD BG10NUC-HC404 5751 RBD BG10NUC-HC405 5752 2P BG10NUC-HC406 5753 2P BG10NUC-HC407 5754 2P BG10NUC-HC408 5755 2P BG10NUC-HC409 5756 RBD BG10NUC-HC410 5757 2P BG10NUC-HC411 5758 2P BG10NUC-HC412 5759 2P BG10NUC-HC413 5760 RBD BG10NUC-HC414 5761 2P BG10NUC-HC415 5762 RBD BG10NUC-HC416 5763 2P BG10NUC-HC417 5764 RBD BG10NUC-HC418 5765 RBD BG10NUC-HC419 5766 RBD BG10NUC-HC420 5767 2P BG10NUC-HC421 5768 RBD BG10NUC-HC422 5769 RBD BG10NUC-HC423 5770 RBD BG10NUC-HC424 5771 RBD BG10NUC-HC425 5772 2P BG10NUC-HC426 5773 RBD BG10NUC-HC427 5774 RBD BG10NUC-LC1 5775 RBD BG10NUC-LC2 5776 RBD BG10NUC-LC3 5777 RBD BG10NUC-LC4 5778 RBD BG10NUC-LC5 5779 RBD BG10NUC-LC6 5780 RBD BG10NUC-LC7 5781 RBD BG10NUC-LC8 5782 RBD BG10NUC-LC9 5783 RBD BG10NUC-LC10 5784 RBD BG10NUC-LC11 5785 RBD BG10NUC-LC12 5786 RBD BG10NUC-LC13 5787 RBD BG10NUC-LC14 5788 RBD BG10NUC-LC15 5789 RBD BG10NUC-LC16 5790 RBD BG10NUC-LC17 5791 RBD BG10NUC-LC18 5792 RBD BG10NUC-LC19 5793 RBD BG10NUC-LC20 5794 RBD BG10NUC-LC21 5795 RBD BG10NUC-LC22 5796 RBD BG10NUC-LC23 5797 RBD BG10NUC-LC24 5798 RBD BG10NUC-LC25 5799 RBD BG10NUC-LC26 5800 RBD BG10NUC-LC27 5801 2P BG10NUC-LC28 5802 2P BG10NUC-LC29 5803 2P BG10NUC-LC30 5804 2P BG10NUC-LC31 5805 2P BG10NUC-LC32 5806 2P BG10NUC-LC33 5807 2P BG10NUC-LC34 5808 2P BG10NUC-LC35 5809 2P BG10NUC-LC36 5810 RBD BG10NUC-LC37 5811 RBD BG10NUC-LC38 5812 RBD BG10NUC-LC39 5813 RBD BG10NUC-LC40 5814 RBD BG10NUC-LC41 5815 RBD BG10NUC-LC42 5816 RBD BG10NUC-LC43 5817 RBD BG10NUC-LC44 5818 RBD BG10NUC-LC45 5819 RBD BG10NUC-LC46 5820 RBD BG10NUC-LC47 5821 RBD BG10NUC-LC48 5822 RBD BG10NUC-LC49 5823 RBD BG10NUC-LC50 5824 RBD BG10NUC-LC51 5825 RBD BG10NUC-LC52 5826 RBD BG10NUC-LC53 5827 RBD BG10NUC-LC54 5828 2P BG10NUC-LC55 5829 RBD BG10NUC-LC56 5830 RBD BG10NUC-LC57 5831 2P BG10NUC-LC58 5832 RBD BG10NUC-LC59 5833 RBD BG10NUC-LC60 5834 RBD BG10NUC-LC61 5835 RBD BG10NUC-LC62 5836 RBD BG10NUC-LC63 5837 RBD BG10NUC-LC64 5838 RBD BG10NUC-LC65 5839 RBD BG10NUC-LC66 5840 2P BG10NUC-LC67 5841 2F BG10NUC-LC68 5842 2P BG10NUC-LC69 5843 RBD BG10NUC-LC70 5844 RBD BG10NUC-LC71 5845 RBD BG10NUC-LC72 5846 RBD BG10NUC-LC73 5847 2P BG10NUC-LC74 5848 2P BG10NUC-LC75 5849 2P BG10NUC-LC76 5850 2P BG10NUC-LC77 5851 RBD BG10NUC-LC78 5852 RBD BG10NUC-LC79 5853 RBD BG10NUC-LC80 5854 RBD BG10NUC-LC81 5855 2P BG10NUC-LC82 5856 RBD BG10NUC-LC83 5857 RBD BG10NUC-LC84 5858 RBD BG10NUC-LC85 5859 RBD BG10NUC-LC86 5860 RBD BG10NUC-LC87 5861 2P BG10NUC-LC88 5862 2P BG10NUC-LC89 5863 RBD BG10NUC-LC90 5864 RBD BG10NUC-LC91 5865 2P BG10NUC-LC92 5866 RBD BG10NUC-LC93 5867 RBD BG10NUC-LC94 5868 2P BG10NUC-LC95 5869 2P BG10NUC-LC96 5870 2P BG10NUC-LC97 5871 2P BG10NUC-LC98 5872 2P BG10NUC-LC99 5873 RBD BG10NUC-LC100 5874 RBD BG10NUC-LC101 5875 2P BG10NUC-LC102 5876 2P BG10NUC-LC103 5877 RBD BG10NUC-LC104 5878 2P BG10NUC-LC105 5879 2P BG10NUC-LC106 5880 2P BG10NUC-LC107 5881 2P BG10NUC-LC108 5882 2P BG10NUC-LC109 5883 2P BG10NUC-LC110 5884 RBD BG10NUC-LC111 5885 2P BG10NUC-LC112 5886 2P BG10NUC-LC113 5887 2P BG10NUC-LC114 5888 RBD BG10NUC-LC115 5889 2P BG10NUC-LC116 5890 2P BG10NUC-LC117 5891 2P BG10NUC-LC118 5892 2P BG10NUC-LC119 5893 2P BG10NUC-LC120 5894 2P BG10NUC-LC121 5895 2P BG10NUC-LC122 5896 2P BG10NUC-LC123 5897 2P BG10NUC-LC124 5898 2P BG10NUC-LC125 5899 2P BG10NUC-LC126 5900 RBD BG10NUC-LC127 5901 RBD BG10NUC-LC128 5902 RBD BG10NUC-LC129 5903 2P BG10NUC-LC130 5904 2P BG10NUC-LC131 5905 2P BG10NUC-LC132 5906 2P BG10NUC-LC133 5907 2P BG10NUC-LC134 5908 2P BG10NUC-LC135 5909 2P BG10NUC-LC136 5910 2P BG10NUC-LC137 5911 RBD BG10NUC-LC138 5912 2P BG10NUC-LC139 5913 2P BG10NUC-LC140 5914 RBD BG10NUC-LC141 5915 RBD BG10NUC-LC142 5916 2F BG10NUC-LC143 5917 2P BG10NUC-LC144 5918 2P BG10NUC-LC145 5919 2P BG10NUC-LC146 5920 2P BG10NUC-LC147 5921 2P BG10NUC-LC148 5922 2P BG10NUC-LC149 5923 2P BG10NUC-LC150 5924 RBD BG10NUC-LC151 5925 RBD BG10NUC-LC152 5926 RBD BG10NUC-LC153 5927 RBD BG10NUC-LC154 5928 2P BG10NUC-LC155 5929 2P BG10NUC-LC156 5930 2P BG10NUC-LC157 5931 RBD BG10NUC-LC158 5932 2P BG10NUC-LC159 5933 RBD BG10NUC-LC160 5934 2P BG10NUC-LC161 5935 RBD BG10NUC-LC162 5936 RBD BG10NUC-LC163 5937 RBD BG10NUC-LC164 5938 2P BG10NUC-LC165 5939 2P BG10NUC-LC166 5940 2P BG10NUC-LC167 5941 RBD BG10NUC-LC168 5942 RBD BG10NUC-LC169 5943 RBD BG10NUC-LC170 5944 2P BG10NUC-LC171 5945 2P BG10NUC-LC172 5946 2P BG10NUC-LC173 5947 2P BG10NUC-LC174 5948 2P BG10NUC-LC175 5949 2P BG10NUC-LC176 5950 RBD BG10NUC-LC177 5951 2P BG10NUC-LC178 5952 RBD BG10NUC-LC179 5953 2P BG10NUC-LC180 5954 2P BG10NUC-LC181 5955 RBD BG10NUC-LC182 5956 2P BG10NUC-LC183 5957 2P BG10NUC-LC184 5958 2P BG10NUC-LC185 5959 2P BG10NUC-LC186 5960 2P BG10NUC-LC187 5961 2P BG10NUC-LC188 5962 2P BG10NUC-LC189 5963 2P BG10NUC-LC190 5964 2P BG10NUC-LC191 5965 RBD BG10NUC-LC192 5966 2P BG10NUC-LC193 5967 RBD BG10NUC-LC194 5968 2P BG10NUC-LC195 5969 RBD BG10NUC-LC196 5970 2P BG10NUC-LC197 5971 2P BG10NUC-LC198 5972 RBD BG10NUC-LC199 5973 2P BG10NUC-LC200 5974 RBD BG10NUC-LC201 5975 2P BG10NUC-LC202 5976 RBD BG10NUC-LC203 5977 2P BG10NUC-LC204 5978 RBD BG10NUC-LC205 5979 2P BG10NUC-LC206 5980 RBD BG10NUC-LC207 5981 RBD BG10NUC-LC208 5982 2P BG10NUC-LC209 5983 2P BG10NUC-LC210 5984 2P BG10NUC-LC211 5985 2P BG10NUC-LC212 5986 2P BG10NUC-LC213 5987 2P BG10NUC-LC214 5988 2P BG10NUC-LC215 5989 2P BG10NUC-LC216 5990 2P BG10NUC-LC217 5991 RBD BG10NUC-LC218 5992 2P BG10NUC-LC219 5993 2P BG10NUC-LC220 5994 2P BG10NUC-LC221 5995 2P BG10NUC-LC222 5996 RBD BG10NUC-LC223 5997 RBD BG10NUC-LC224 5998 RBD BG10NUC-LC225 5999 2P BG10NUC-LC226 6000 2P BG10NUC-LC227 6001 2P BG10NUC-LC228 6002 2P BG10NUC-LC229 6003 2P BG10NUC-LC230 6004 2P BG10NUC-LC231 6005 RBD BG10NUC-LC232 6006 RBD BG10NUC-LC233 6007 RBD BG10NUC-LC234 6008 RBD BG10NUC-LC235 6009 2P BG10NUC-LC236 6010 RBD BG10NUC-LC237 6011 RBD BG10NUC-LC238 6012 2P BG10NUC-LC239 6013 2P BG10NUC-LC240 6014 2P BG10NUC-LC241 6015 2P BG10NUC-LC242 6016 RBD BG10NUC-LC243 6017 2P BG10NUC-LC244 6018 RBD BG10NUC-LC245 6019 2P BG10NUC-LC246 6020 2P BG10NUC-LC247 6021 2P BG10NUC-LC248 6022 2P BG10NUC-LC249 6023 2P BG10NUC-LC250 6024 2P BG10NUC-LC251 6025 2P BG10NUC-LC252 6026 2P BG10NUC-LC253 6027 2P BG10NUC-LC254 6028 2P BG10NUC-LC255 6029 2P BG10NUC-LC256 6030 2P BG10NUC-LC257 6031 2P BG10NUC-LC258 6032 RBD BG10NUC-LC259 6033 RBD BG10NUC-LC260 6034 2P BG10NUC-LC261 6035 RBD BG10NUC-LC262 6036 2P BG10NUC-LC263 6037 2P BG10NUC-LC264 6038 RBD BG10NUC-LC265 6039 RBD BG10NUC-LC266 6040 RBD BG10NUC-LC267 6041 RBD BG10NUC-LC268 6042 2P BG10NUC-LC269 6043 2P BG10NUC-LC270 6044 RBD BG10NUC-LC271 6045 2P BG10NUC-LC272 6046 2P BG10NUC-LC273 6047 RBD BG10NUC-LC274 6048 2P BG10NUC-LC275 6049 RBD BG10NUC-LC276 6050 RBD BG10NUC-LC277 6051 RBD BG10NUC-LC278 6052 2P BG10NUC-LC279 6053 2P BG10NUC-LC280 6054 2P BG10NUC-LC281 6055 2P BG10NUC-LC282 6056 2P BG10NUC-LC283 6057 2P BG10NUC-LC284 6058 2P BG10NUC-LC285 6059 2P BG10NUC-LC286 6060 RBD BG10NUC-LC287 6061 RBD BG10NUC-LC288 6062 RBD BG10NUC-LC289 6063 2P BG10NUC-LC290 6064 2P BG10NUC-LC291 6065 RBD BG10NUC-LC292 6066 2P BG10NUC-LC293 6067 RBD BG10NUC-LC294 6068 RBD BG10NUC-LC295 6069 RBD BG10NUC-LC296 6070 RBD BG10NUC-LC297 6071 2P BG10NUC-LC298 6072 RBD BG10NUC-LC299 6073 RBD BG10NUC-LC300 6074 RBD BG10NUC-LC301 6075 RBD BG10NUC-LC302 6076 RBD BG10NUC-LC303 6077 RBD BG10NUC-LC304 6078 2P BG10NUC-LC305 6079 RBD BG10NUC-LC306 6080 RBD BG10NUC-LC307 6081 2P BG10NUC-LC308 6082 2P BG10NUC-LC309 6083 RBD BG10NUC-LC310 6084 2P BG10NUC-LC311 6085 2P BG10NUC-LC312 6086 2P BG10NUC-LC313 6087 2P BG10NUC-LC314 6088 2P BG10NUC-LC315 6089 2P BG10NUC-LC316 6090 2P BG10NUC-LC317 6091 RBD BG10NUC-LC318 6092 2P BG10NUC-LC319 6093 2P BG10NUC-LC320 6094 2P BG10NUC-LC321 6095 2P BG10NUC-LC322 6096 2P BG10NUC-LC323 6097 RBD BG10NUC-LC324 6098 RBD BG10NUC-LC325 6099 2P BG10NUC-LC326 6100 2P BG10NUC-LC327 6101 2P BG10NUC-LC328 6102 2P BG10NUC-LC329 6103 RBD BG10NUC-LC330 6104 2P BG10NUC-LC331 6105 RBD BG10NUC-LC332 6106 RBD BG10NUC-LC333 6107 RBD BG10NUC-LC334 6108 2P BG10NUC-LC335 6109 2P BG10NUC-LC336 6110 2P BG10NUC-LC337 6111 RBD BG10NUC-LC338 6112 2P BG10NUC-LC339 6113 2P BG10NUC-LC340 6114 2P BG10NUC-LC341 6115 2P BG10NUC-LC342 6116 RBD BG10NUC-LC343 6117 2P BG10NUC-LC344 6118 RBD BG10NUC-LC345 6119 2P BG10NUC-LC346 6120 2P BG10NUC-LC347 6121 2P BG10NUC-LC348 6122 2P BG10NUC-LC349 6123 2P BG10NUC-LC350 6124 2P BG10NUC-LC351 6125 RBD BG10NUC-LC352 6126 2P BG10NUC-LC353 6127 2P BG10NUC-LC354 6128 2P BG10NUC-LC355 6129 RBD BG10NUC-LC356 6130 RBD BG10NUC-LC357 6131 2P BG10NUC-LC358 6132 RBD BG10NUC-LC359 6133 RBD BG10NUC-LC360 6134 2P BG10NUC-LC361 6135 2P BG10NUC-LC362 6136 2P BG10NUC-LC363 6137 RBD BG10NUC-LC364 6138 2P BG10NUC-LC365 6139 2P BG10NUC-LC366 6140 RBD BG10NUC-LC367 6141 RBD BG10NUC-LC368 6142 2P BG10NUC-LC369 6143 2P BG10NUC-LC370 6144 2F BG10NUC-LC371 6145 RBD BG10NUC-LC372 6146 RBD BG10NUC-LC373 6147 RBD BG10NUC-LC374 6148 2P BG10NUC-LC375 6149 2P BG10NUC-LC376 6150 2P BG10NUC-LC377 6151 2P BG10NUC-LC378 6152 2P BG10NUC-LC379 6153 2P BG10NUC-LC380 6154 2P BG10NUC-LC381 6155 RBD BG10NUC-LC382 6156 RBD BG10NUC-LC383 6157 RBD BG10NUC-LC384 6158 RBD BG10NUC-LC385 6159 RBD BG10NUC-LC386 6160 2P BG10NUC-LC387 6161 2P BG10NUC-LC388 6162 RBD BG10NUC-LC389 6163 2P BG10NUC-LC390 6164 2P BG10NUC-LC391 6165 2P BG10NUC-LC392 6166 2P BG10NUC-LC393 6167 2P BG10NUC-LC394 6168 2P BG10NUC-LC395 6169 2P BG10NUC-LC396 6170 RBD BG10NUC-LC397 6171 2P BG10NUC-LC398 6172 2P BG10NUC-LC399 6173 RBD BG10NUC-LC400 6174 2P BG10NUC-LC401 6175 2P BG10NUC-LC402 6176 2F BG10NUC-LC403 6177 RBD BG10NUC-LC404 6178 RBD BG10NUC-LC405 6179 2P BG10NUC-LC406 6180 2P BG10NUC-LC407 6181 2P BG10NUC-LC408 6182 2P BG10NUC-LC409 6183 RBD BG10NUC-LC410 6184 2P BG10NUC-LC411 6185 2P BG10NUC-LC412 6186 2P BG10NUC-LC413 6187 RBD BG10NUC-LC414 6188 2P BG10NUC-LC415 6189 RBD BG10NUC-LC416 6190 2P BG10NUC-LC417 6191 RBD BG10NUC-LC418 6192 RBD BG10NUC-LC419 6193 RBD BG10NUC-LC420 6194 2P BG10NUC-LC421 6195 RBD BG10NUC-LC422 6196 RBD BG10NUC-LC423 6197 RBD BG10NUC-LC424 6198 RBD BG10NUC-LC425 6199 2P BG10NUC-LC426 6200 RBD BG10NUC-LC427 6201 RBD BG13NUC-HC1 6202 RBD BG13NUC-HC2 6203 RBD BG13NUC-HC3 6204 RBD BG13NUC-HC4 6205 RBD BG13NUC-HC5 6206 RBD BG13NUC-HC6 6207 RBD BG13NUC-HC7 6208 RBD BG13NUC-HC8 6209 RBD BG13NUC-HC9 6210 RBD BG13NUC-HC10 6211 RBD BG13NUC-HC11 6212 2P BG13NUC-HC12 6213 2P BG13NUC-HC13 6214 2P BG13NUC-HC14 6215 2P BG13NUC-HC15 6216 2P BG13NUC-HC16 6217 2P BG13NUC-HC17 6218 2F BG13NUC-HC18 6219 2P BG13NUC-HC19 6220 RBD BG13NUC-HC20 6221 RBD BG13NUC-HC21 6222 RBD BG13NUC-HC22 6223 RBD BG13NUC-HC23 6224 RBD BG13NUC-HC24 6225 RBD BG13NUC-HC25 6226 RBD BG13NUC-HC26 6227 2P BG13NUC-HC27 6228 2F BG13NUC-HC28 6229 2F BG13NUC-HC29 6230 2P BG13NUC-HC30 6231 2P BG13NUC-HC31 6232 2P BG13NUC-HC32 6233 2P BG13NUC-HC33 6234 2P BG13NUC-HC34 6235 RBD BG13NUC-HC35 6236 RBD BG13NUC-HC36 6237 RBD BG13NUC-HC37 6238 RBD BG13NUC-HC38 6239 RBD BG13NUC-HC39 6240 RBD BG13NUC-HC40 6241 RBD BG13NUC-HC41 6242 2P BG13NUC-HC42 6243 2P BG13NUC-HC43 6244 2P BG13NUC-HC44 6245 2P BG13NUC-HC45 6246 2P BG13NUC-HC46 6247 RBD BG13NUC-HC47 6248 RBD BG13NUC-HC48 6249 RBD BG13NUC-HC49 6250 RBD BG13NUC-HC50 6251 RBD BG13NUC-HC51 6252 RBD BG13NUC-HC52 6253 RBD BG13NUC-HC53 6254 RBD BG13NUC-HC54 6255 RBD BG13NUC-HC55 6256 RBD BG13NUC-HC56 6257 2P BG13NUC-HC57 6258 2P BG13NUC-HC58 6259 RBD BG13NUC-HC59 6260 RBD BG13NUC-HC60 6261 RBD BG13NUC-HC61 6262 RBD BG13NUC-HC62 6263 RBD BG13NUC-HC63 6264 RBD BG13NUC-HC64 6265 RBD BG13NUC-HC65 6266 RBD BG13NUC-HC66 6267 2P BG13NUC-HC67 6268 2P BG13NUC-HC68 6269 RBD BG13NUC-HC69 6270 RBD BG13NUC-HC70 6271 RBD BG13NUC-HC71 6272 RBD BG13NUC-HC72 6273 RBD BG13NUC-HC73 6274 2P BG13NUC-HC74 6275 2P BG13NUC-HC75 6276 2F BG13NUC-HC76 6277 2P BG13NUC-HC77 6278 2F BG13NUC-HC78 6279 RBD BG13NUC-HC79 6280 RBD BG13NUC-HC80 6281 RBD BG13NUC-HC81 6282 RBD BG13NUC-HC82 6283 RBD BG13NUC-HC83 6284 2F BG13NUC-HC84 6285 2P BG13NUC-HC85 6286 2F BG13NUC-HC86 6287 RBD BG13NUC-HC87 6288 RBD BG13NUC-HC88 6289 RBD BG13NUC-HC89 6290 RBD BG13NUC-HC90 6291 RBD BG13NUC-HC91 6292 2P BG13NUC-HC92 6293 2P BG13NUC-HC93 6294 2P BG13NUC-HC94 6295 RBD BG13NUC-HC95 6296 RBD BG13NUC-HC96 6297 RBD BG13NUC-HC97 6298 RBD BG13NUC-HC98 6299 RBD BG13NUC-HC99 6300 2P BG13NUC-HC100 6301 2P BG13NUC-HC101 6302 RBD BG13NUC-HC102 6303 RBD BG13NUC-HC103 6304 2P BG13NUC-HC104 6305 2P BG13NUC-HC105 6306 RBD BG13NUC-HC106 6307 RBD BG13NUC-HC107 6308 RBD BG13NUC-HC108 6309 RBD BG13NUC-HC109 6310 RBD BG13NUC-HC110 6311 2P BG13NUC-HC111 6312 2P BG13NUC-HC112 6313 RBD BG13NUC-HC113 6314 RBD BG13NUC-HC114 6315 RBD BG13NUC-HC115 6316 RBD BG13NUC-HC116 6317 RBD BG13NUC-HC117 6318 RBD BG13NUC-HC118 6319 RBD BG13NUC-HC119 6320 2P BG13NUC-HC120 6321 2P BG13NUC-HC121 6322 2P BG13NUC-HC122 6323 RBD BG13NUC-HC123 6324 RBD BG13NUC-HC124 6325 RBD BG13NUC-HC125 6326 2P BG13NUC-HC126 6327 2P BG13NUC-HC127 6328 2P BG13NUC-HC128 6329 2P BG13NUC-HC129 6330 2P BG13NUC-HC130 6331 2P BG13NUC-HC131 6332 2P BG13NUC-HC132 6333 RBD BG13NUC-HC133 6334 RBD BG13NUC-HC134 6335 2P BG13NUC-HC135 6336 2P BG13NUC-HC136 6337 RBD BG13NUC-HC137 6338 RBD BG13NUC-HC138 6339 RBD BG13NUC-HC139 6340 2P BG13NUC-HC140 6341 RBD BG13NUC-HC141 6342 RBD BG13NUC-HC142 6343 RBD BG13NUC-HC143 6344 2P BG13NUC-HC144 6345 RBD BG13NUC-HC145 6346 RBD BG13NUC-HC146 6347 RBD BG13NUC-HC147 6348 2P BG13NUC-HC148 6349 RBD BG13NUC-HC149 6350 2P BG13NUC-HC150 6351 2P BG13NUC-HC151 6352 2P BG13NUC-HC152 6353 RBD BG13NUC-HC153 6354 RBD BG13NUC-HC154 6355 2P BG13NUC-HC155 6356 2P BG13NUC-HC156 6357 RBD BG13NUC-HC157 6358 RBD BG13NUC-HC158 6359 RBD BG13NUC-HC159 6360 2P BG13NUC-HC160 6361 2P BG13NUC-HC161 6362 2P BG13NUC-HC162 6363 RBD BG13NUC-HC163 6364 2P BG13NUC-HC164 6365 RBD BG13NUC-HC165 6366 RBD BG13NUC-HC166 6367 RBD BG13NUC-HC167 6368 2P BG13NUC-HC168 6369 RBD BG13NUC-HC169 6370 2P BG13NUC-HC170 6371 RBD BG13NUC-HC171 6372 RBD BG13NUC-HC172 6373 RBD BG13NUC-HC173 6374 RBD BG13NUC-HC174 6375 RBD BG13NUC-HC175 6376 RBD BG13NUC-HC176 6377 RBD BG13NUC-HC177 6378 2P BG13NUC-HC178 6379 2P BG13NUC-HC179 6380 2P BG13NUC-HC180 6381 2P BG13NUC-HC181 6382 2P BG13NUC-HC182 6383 2P BG13NUC-HC183 6384 RBD BG13NUC-HC184 6385 RBD BG13NUC-HC185 6386 RBD BG13NUC-HC186 6387 RBD BG13NUC-HC187 6388 2P BG13NUC-HC188 6389 2P BG13NUC-HC189 6390 2P BG13NUC-HC190 6391 RBD BG13NUC-HC191 6392 2P BG13NUC-HC192 6393 2P BG13NUC-HC193 6394 2P BG13NUC-HC194 6395 RBD BG13NUC-HC195 6396 2P BG13NUC-HC196 6397 RBD BG13NUC-HC197 6398 2P BG13NUC-HC198 6399 RBD BG13NUC-HC199 6400 RBD BG13NUC-HC200 6401 RBD BG13NUC-HC201 6402 2P BG13NUC-HC202 6403 2P BG13NUC-HC203 6404 2P BG13NUC-HC204 6405 2P BG13NUC-HC205 6406 2P BG13NUC-HC206 6407 RBD BG13NUC-HC207 6408 2P BG13NUC-HC208 6409 RBD BG13NUC-HC209 6410 2P BG13NUC-HC210 6411 RBD BG13NUC-HC211 6412 2P BG13NUC-HC212 6413 RBD BG13NUC-HC213 6414 2P BG13NUC-HC214 6415 RBD BG13NUC-HC215 6416 RBD BG13NUC-HC216 6417 RBD BG13NUC-HC217 6418 2P BG13NUC-HC218 6419 RBD BG13NUC-HC219 6420 RBD BG13NUC-HC220 6421 2P BG13NUC-HC221 6422 2P BG13NUC-HC222 6423 RBD BG13NUC-HC223 6424 2P BG13NUC-HC224 6425 RBD BG13NUC-HC225 6426 2P BG13NUC-HC226 6427 2P BG13NUC-HC227 6428 2P BG13NUC-HC228 6429 RBD BG13NUC-HC229 6430 RBD BG13NUC-HC230 6431 RBD BG13NUC-HC231 6432 2P BG13NUC-HC232 6433 2P BG13NUC-HC233 6434 2P BG13NUC-HC234 6435 RBD BG13NUC-HC235 6436 2P BG13NUC-HC236 6437 2P BG13NUC-HC237 6438 2P BG13NUC-HC238 6439 RBD BG13NUC-HC239 6440 RBD BG13NUC-HC240 6441 RBD BG13NUC-HC241 6442 RBD BG13NUC-HC242 6443 RBD BG13NUC-HC243 6444 RBD BG13NUC-HC244 6445 RBD BG13NUC-HC245 6446 2P BG13NUC-HC246 6447 RBD BG13NUC-HC247 6448 2P BG13NUC-HC248 6449 RBD BG13NUC-HC249 6450 2P BG13NUC-HC250 6451 2P BG13NUC-HC251 6452 2P BG13NUC-HC252 6453 RBD BG13NUC-HC253 6454 2P BG13NUC-HC254 6455 RBD BG13NUC-HC255 6456 2P BG13NUC-HC256 6457 RBD BG13NUC-HC257 6458 RBD BG13NUC-HC258 6459 2P BG13NUC-HC259 6460 2P BG13NUC-HC260 6461 2P BG13NUC-HC261 6462 2P BG13NUC-HC262 6463 RBD BG13NUC-HC263 6464 RBD BG13NUC-HC264 6465 RBD BG13NUC-HC265 6466 2P BG13NUC-HC266 6467 RBD BG13NUC-HC267 6468 2P BG13NUC-HC268 6469 RBD BG13NUC-HC269 6470 2P BG13NUC-HC270 6471 2P BG13NUC-HC271 6472 2P BG13NUC-HC272 6473 2P BG13NUC-HC273 6474 2P BG13NUC-HC274 6475 2P BG13NUC-HC275 6476 2P BG13NUC-HC276 6477 RBD BG13NUC-HC277 6478 2P BG13NUC-HC278 6479 2P BG13NUC-HC279 6480 RBD BG13NUC-HC280 6481 RBD BG13NUC-HC281 6482 RBD BG13NUC-HC282 6483 RBD BG13NUC-HC283 6484 RBD BG13NUC-HC284 6485 RBD BG13NUC-HC285 6486 2P BG13NUC-HC286 6487 2P BG13NUC-HC287 6488 RBD BG13NUC-HC288 6489 2P BG13NUC-HC289 6490 2P BG13NUC-HC290 6491 2P BG13NUC-HC291 6492 RBD BG13NUC-HC292 6493 2P BG13NUC-HC293 6494 RBD BG13NUC-HC294 6495 RBD BG13NUC-HC295 6496 RBD BG13NUC-HC296 6497 2P BG13NUC-HC297 6498 2P BG13NUC-HC298 6499 RBD BG13NUC-HC299 6500 2F BG13NUC-HC300 6501 RBD BG13NUC-HC301 6502 2P BG13NUC-HC302 6503 RBD BG13NUC-HC303 6504 2P BG13NUC-HC304 6505 RBD BG13NUC-HC305 6506 2P BG13NUC-HC306 6507 2P BG13NUC-HC307 6508 RBD BG13NUC-HC308 6509 RBD BG13NUC-HC309 6510 2P BG13NUC-HC310 6511 RBD BG13NUC-HC311 6512 2P BG13NUC-HC312 6513 2P BG13NUC-HC313 6514 RBD BG13NUC-HC314 6515 2P BG13NUC-HC315 6516 2P BG13NUC-HC316 6517 RBD BG13NUC-HC317 6518 2P BG13NUC-HC318 6519 RBD BG13NUC-HC319 6520 RBD BG13NUC-HC320 6521 2P BG13NUC-HC321 6522 2P BG13NUC-HC322 6523 2P BG13NUC-HC323 6524 RBD BG13NUC-HC324 6525 RBD BG13NUC-HC325 6526 RBD BG13NUC-HC326 6527 2P BG13NUC-HC327 6528 2P BG13NUC-HC328 6529 2P BG13NUC-HC329 6530 2P BG13NUC-HC330 6531 RBD BG13NUC-HC331 6532 2P BG13NUC-HC332 6533 RBD BG13NUC-HC333 6534 RBD BG13NUC-HC334 6535 2P BG13NUC-HC335 6536 RBD BG13NUC-HC336 6537 RBD BG13NUC-HC337 6538 RBD BG13NUC-HC338 6539 RBD BG13NUC-HC339 6540 RBD BG13NUC-HC340 6541 2P BG13NUC-HC341 6542 2P BG13NUC-HC342 6543 2P BG13NUC-HC343 6544 RBD BG13NUC-HC344 6545 2P BG13NUC-HC345 6546 2P BG13NUC-HC346 6547 RBD BG13NUC-HC347 6548 2P BG13NUC-HC348 6549 2P BG13NUC-HC349 6550 2P BG13NUC-HC350 6551 2P BG13NUC-HC351 6552 RBD BG13NUC-HC352 6553 2P BG13NUC-HC353 6554 RBD BG13NUC-HC354 6555 2P BG13NUC-HC355 6556 RBD BG13NUC-HC356 6557 2P BG13NUC-HC357 6558 RBD BG13NUC-HC358 6559 2P BG13NUC-HC359 6560 RBD BG13NUC-HC360 6561 2P BG13NUC-HC361 6562 2P BG13NUC-HC362 6563 RBD BG13NUC-HC363 6564 RBD BG13NUC-HC364 6565 RBD BG13NUC-HC365 6566 2P BG13NUC-HC366 6567 2P BG13NUC-HC367 6568 2P BG13NUC-HC368 6569 2P BG13NUC-HC369 6570 RBD BG13NUC-HC370 6571 2P BG13NUC-HC371 6572 2P BG13NUC-HC372 6573 2P BG13NUC-HC373 6574 RBD BG13NUC-HC374 6575 2P BG13NUC-HC375 6576 2P BG13NUC-HC376 6577 RBD BG13NUC-HC377 6578 2P BG13NUC-HC378 6579 RBD BG13NUC-HC379 6580 RBD BG13NUC-HC380 6581 2P BG13NUC-HC381 6582 RBD BG13NUC-HC382 6583 RBD BG13NUC-HC383 6584 2P BG13NUC-HC384 6585 RBD BG13NUC-HC385 6586 RBD BG13NUC-HC386 6587 RBD BG13NUC-HC387 6588 2P BG13NUC-HC388 6589 2P BG13NUC-HC389 6590 2P BG13NUC-HC390 6591 2P BG13NUC-HC391 6592 RBD BG13NUC-HC392 6593 RBD BG13NUC-HC393 6594 RBD BG13NUC-HC394 6595 2P BG13NUC-HC395 6596 2P BG13NUC-HC396 6597 2P BG13NUC-HC397 6598 2P BG13NUC-HC398 6599 2P BG13NUC-HC399 6600 RBD BG13NUC-HC400 6601 2P BG13NUC-HC401 6602 2P BG13NUC-HC402 6603 2P BG13NUC-HC403 6604 2P BG13NUC-HC404 6605 2P BG13NUC-HC405 6606 RBD BG13NUC-HC406 6607 2P BG13NUC-HC407 6608 2P BG13NUC-HC408 6609 2P BG13NUC-HC409 6610 2P BG13NUC-HC410 6611 RBD BG13NUC-HC411 6612 RBD BG13NUC-HC412 6613 RBD BG13NUC-HC413 6614 RBD BG13NUC-HC414 6615 2P BG13NUC-HC415 6616 2P BG13NUC-HC416 6617 RBD BG13NUC-HC417 6618 RBD BG13NUC-HC418 6619 2P BG13NUC-HC419 6620 2P BG13NUC-HC420 6621 RBD BG13NUC-HC421 6622 2P BG13NUC-HC422 6623 2P BG13NUC-HC423 6624 RBD BG13NUC-HC424 6625 RBD BG13NUC-HC425 6626 RBD BG13NUC-HC426 6627 2P BG13NUC-HC427 6628 2P BG13NUC-HC428 6629 2P BG13NUC-HC429 6630 2P BG13NUC-HC430 6631 2P BG13NUC-HC431 6632 RBD BG13NUC-HC432 6633 2P BG13NUC-HC433 6634 2P BG13NUC-HC434 6635 2P BG13NUC-HC435 6636 2P BG13NUC-HC436 6637 2P BG13NUC-HC437 6638 2P BG13NUC-HC438 6639 RBD BG13NUC-HC439 6640 RBD BG13NUC-HC440 6641 2P BG13NUC-HC441 6642 2P BG13NUC-HC442 6643 2P BG13NUC-HC443 6644 2P BG13NUC-HC444 6645 2P BG13NUC-HC445 6646 2P BG13NUC-HC446 6647 2P BG13NUC-HC447 6648 2P BG13NUC-HC448 6649 RBD BG13NUC-HC449 6650 2P BG13NUC-HC450 6651 2P BG13NUC-HC451 6652 2P BG13NUC-HC452 6653 2P BG13NUC-HC453 6654 RBD BG13NUC-HC454 6655 RBD BG13NUC-HC455 6656 2P BG13NUC-HC456 6657 2P BG13NUC-HC457 6658 2P BG13NUC-HC458 6659 RBD BG13NUC-HC459 6660 2P BG13NUC-HC460 6661 RBD BG13NUC-HC461 6662 2P BG13NUC-HC462 6663 RBD BG13NUC-HC463 6664 RBD BG13NUC-HC464 6665 2P BG13NUC-HC465 6666 2P BG13NUC-HC466 6667 2P BG13NUC-HC467 6668 2P BG13NUC-HC468 6669 2P BG13NUC-HC469 6670 2P BG13NUC-HC470 6671 RBD BG13NUC-HC471 6672 2P BG13NUC-HC472 6673 RBD BG13NUC-HC473 6674 RBD BG13NUC-HC474 6675 2P BG13NUC-HC475 6676 2P BG13NUC-HC476 6677 2P BG13NUC-HC477 6678 2P BG13NUC-HC478 6679 2P BG13NUC-HC479 6680 2P BG13NUC-HC480 6681 2P BG13NUC-HC481 6682 2P BG13NUC-HC482 6683 2P BG13NUC-HC483 6684 2P BG13NUC-HC484 6685 2P BG13NUC-HC485 6686 RBD BG13NUC-HC486 6687 RBD BG13NUC-HC487 6688 2P BG13NUC-HC488 6689 2P BG13NUC-HC489 6690 2P BG13NUC-HC490 6691 2P BG13NUC-HC491 6692 2P BG13NUC-HC492 6693 2P BG13NUC-HC493 6694 2P BG13NUC-HC494 6695 2P BG13NUC-HC495 6696 RBD BG13NUC-HC496 6697 RBD BG13NUC-HC497 6698 2P BG13NUC-HC498 6699 RBD BG13NUC-HC499 6700 2P BG13NUC-HC500 6701 RBD BG13NUC-HC501 6702 2P BG13NUC-HC502 6703 2P BG13NUC-HC503 6704 RBD BG13NUC-HC504 6705 2P BG13NUC-HC505 6706 RBD BG13NUC-HC506 6707 RBD BG13NUC-HC507 6708 2P BG13NUC-HC508 6709 2P BG13NUC-HC509 6710 2P BG13NUC-HC510 6711 2P BG13NUC-HC511 6712 RBD BG13NUC-HC512 6713 RBD BG13NUC-HC513 6714 RBD BG13NUC-HC514 6715 2P BG13NUC-HC515 6716 2P BG13NUC-HC516 6717 2P BG13NUC-HC517 6718 RBD BG13NUC-HC518 6719 RBD BG13NUC-HC519 6720 2P BG13NUC-HC520 6721 2P BG13NUC-HC521 6722 RBD BG13NUC-HC522 6723 RBD BG13NUC-HC523 6724 RBD BG13NUC-HC524 6725 2P BG13NUC-HC525 6726 2P BG13NUC-HC526 6727 2P BG13NUC-HC527 6728 2P BG13NUC-HC528 6729 2P BG13NUC-HC529 6730 RBD BG13NUC-HC530 6731 2P BG13NUC-HC531 6732 RBD BG13NUC-HC532 6733 RBD BG13NUC-HC533 6734 RBD BG13NUC-HC534 6735 RBD BG13NUC-HC535 6736 2P BG13NUC-HC536 6737 2P BG13NUC-HC537 6738 2P BG13NUC-HC538 6739 2P BG13NUC-HC539 6740 2P BG13NUC-HC540 6741 2P BG13NUC-HC541 6742 RBD BG13NUC-HC542 6743 RBD BG13NUC-HC543 6744 2P BG13NUC-HC544 6745 2P BG13NUC-HC545 6746 RBD BG13NUC-HC546 6747 RBD BG13NUC-HC547 6748 2F BG13NUC-HC548 6749 RBD BG13NUC-HC549 6750 2P BG13NUC-HC550 6751 2P BG13NUC-HC551 6752 RBD BG13NUC-HC552 6753 RBD BG13NUC-HC553 6754 RBD BG13NUC-HC554 6755 RBD BG13NUC-HC555 6756 2P BG13NUC-HC556 6757 2P BG13NUC-HC557 6758 RBD BG13NUC-HC558 6759 2F BG13NUC-HC559 6760 RBD BG13NUC-HC560 6761 2P BG13NUC-HC561 6762 2P BG13NUC-HC562 6763 2P BG13NUC-HC563 6764 2P BG13NUC-HC564 6765 2F BG13NUC-HC565 6766 2F BG13NUC-HC566 6767 2P BG13NUC-HC567 6768 RBD BG13NUC-HC568 6769 RBD BG13NUC-HC569 6770 RBD BG13NUC-HC570 6771 RBD BG13NUC-HC571 6772 2F BG13NUC-HC572 6773 2P BG13NUC-HC573 6774 2P BG13NUC-HC574 6775 2P BG13NUC-HC575 6776 2P BG13NUC-HC576 6777 2P BG13NUC-HC577 6778 2P BG13NUC-HC578 6779 2P BG13NUC-HC579 6780 2P BG13NUC-HC580 6781 2F BG13NUC-HC581 6782 2P BG13NUC-HC582 6783 2P BG13NUC-HC583 6784 2P BG13NUC-HC584 6785 2P BG13NUC-HC585 6786 2P BG13NUC-HC586 6787 2P BG13NUC-HC587 6788 2P BG13NUC-HC588 6789 2P BG13NUC-HC589 6790 2P BG13NUC-HC590 6791 RBD BG13NUC-HC591 6792 2P BG13NUC-HC592 6793 RBD BG13NUC-HC593 6794 2P BG13NUC-HC594 6795 RBD BG13NUC-HC595 6796 2F BG13NUC-HC596 6797 2F BG13NUC-HC597 6798 RBD BG13NUC-HC598 6799 2P BG13NUC-HC599 6800 2P BG13NUC-HC600 6801 2P BG13NUC-HC601 6802 2P BG13NUC-HC602 6803 2P BG13NUC-HC603 6804 2P BG13NUC-HC604 6805 2P BG13NUC-HC605 6806 RBD BG13NUC-HC606 6807 RBD BG13NUC-HC607 6808 RBD BG13NUC-HC608 6809 2P BG13NUC-HC609 6810 RBD BG13NUC-HC610 6811 2P BG13NUC-HC611 6812 RBD BG13NUC-HC612 6813 RBD BG13NUC-HC613 6814 RBD BG13NUC-HC614 6815 2P BG13NUC-HC615 6816 2P BG13NUC-HC616 6817 RBD BG13NUC-HC617 6818 RBD BG13NUC-HC618 6819 2P BG13NUC-HC619 6820 RBD BG13NUC-HC620 6821 2P BG13NUC-HC621 6822 2P BG13NUC-HC622 6823 RBD BG13NUC-HC623 6824 RBD BG13NUC-HC624 6825 2P BG13NUC-HC625 6826 2P BG13NUC-HC626 6827 2P BG13NUC-HC627 6828 RBD BG13NUC-HC628 6829 RBD BG13NUC-HC629 6830 RBD BG13NUC-HC630 6831 2P BG13NUC-HC631 6832 2P BG13NUC-HC632 6833 2P BG13NUC-HC633 6834 2P BG13NUC-HC634 6835 2P BG13NUC-HC635 6836 RBD BG13NUC-HC636 6837 RBD BG13NUC-HC637 6838 RBD BG13NUC-HC638 6839 2P BG13NUC-HC639 6840 RBD BG13NUC-HC640 6841 RBD BG13NUC-HC641 6842 2P BG13NUC-HC642 6843 2P BG13NUC-HC643 6844 RBD BG13NUC-HC644 6845 RBD BG13NUC-HC645 6846 2P BG13NUC-HC646 6847 RBD BG13NUC-HC647 6848 2P BG13NUC-HC648 6849 2P BG13NUC-HC649 6850 RBD BG13NUC-HC650 6851 RBD BG13NUC-HC651 6852 2P BG13NUC-HC652 6853 2P BG13NUC-HC653 6854 2P BG13NUC-HC654 6855 2P BG13NUC-HC655 6856 RBD BG13NUC-HC656 6857 RBD BG13NUC-HC657 6858 2P BG13NUC-HC658 6859 2P BG13NUC-HC659 6860 2P BG13NUC-HC660 6861 2P BG13NUC-HC661 6862 2P BG13NUC-HC662 6863 2P BG13NUC-HC663 6864 RBD BG13NUC-HC664 6865 2P BG13NUC-HC665 6866 RBD BG13NUC-HC666 6867 2P BG13NUC-HC667 6868 RBD BG13NUC-HC668 6869 RBD BG13NUC-HC669 6870 RBD BG13NUC-HC670 6871 2P BG13NUC-HC671 6872 RBD BG13NUC-HC672 6873 2P BG13NUC-HC673 6874 RBD BG13NUC-HC674 6875 RBD BG13NUC-HC675 6876 2P BG13NUC-HC676 6877 2P BG13NUC-HC677 6878 2P BG13NUC-HC678 6879 RBD BG13NUC-HC679 6880 2P BG13NUC-HC680 6881 2P BG13NUC-HC681 6882 2P BG13NUC-HC682 6883 2P BG13NUC-HC683 6884 RBD BG13NUC-HC684 6885 2P BG13NUC-HC685 6886 2P BG13NUC-HC686 6887 2P BG13NUC-HC687 6888 RBD BG13NUC-HC688 6889 2P BG13NUC-HC689 6890 RBD BG13NUC-HC690 6891 2P BG13NUC-HC691 6892 RBD BG13NUC-HC692 6893 RBD BG13NUC-HC693 6894 RBD BG13NUC-HC694 6895 2P BG13NUC-HC695 6896 RBD BG13NUC-HC696 6897 RBD BG13NUC-HC697 6898 RBD BG13NUC-HC698 6899 2P BG13NUC-HC699 6900 RBD BG13NUC-HC700 6901 RBD BG13NUC-HC701 6902 2P BG13NUC-HC702 6903 2P BG13NUC-HC703 6904 2P BG13NUC-HC704 6905 2P BG13NUC-HC705 6906 2P BG13NUC-HC706 6907 2P BG13NUC-HC707 6908 2P BG13NUC-HC708 6909 2P BG13NUC-HC709 6910 2P BG13NUC-HC710 6911 2P BG13NUC-HC711 6912 2P BG13NUC-HC712 6913 2P BG13NUC-HC713 6914 2P BG13NUC-HC714 6915 RBD BG13NUC-HC715 6916 RBD BG13NUC-HC716 6917 RBD BG13NUC-HC717 6918 RBD BG13NUC-HC718 6919 RBD BG13NUC-HC719 6920 2P BG13NUC-HC720 6921 2P BG13NUC-HC721 6922 2P BG13NUC-HC722 6923 2P BG13NUC-HC723 6924 2P BG13NUC-HC724 6925 2P BG13NUC-HC725 6926 2P BG13NUC-HC726 6927 2P BG13NUC-HC727 6928 2P BG13NUC-HC728 6929 RBD BG13NUC-HC729 6930 2P BG13NUC-HC730 6931 2P BG13NUC-HC731 6932 2P BG13NUC-HC732 6933 2P BG13NUC-HC733 6934 2P BG13NUC-HC734 6935 2P BG13NUC-HC735 6936 2P BG13NUC-HC736 6937 RBD BG13NUC-HC737 6938 2P BG13NUC-HC738 6939 RBD BG13NUC-HC739 6940 RBD BG13NUC-HC740 6941 RBD BG13NUC-HC741 6942 2P BG13NUC-HC742 6943 2P BG13NUC-HC743 6944 2P BG13NUC-HC744 6945 RBD BG13NUC-HC745 6946 2P BG13NUC-HC746 6947 RBD BG13NUC-HC747 6948 2F BG13NUC-HC748 6949 2P BG13NUC-HC749 6950 2P BG13NUC-HC750 6951 2P BG13NUC-HC751 6952 2P BG13NUC-HC752 6953 2P BG13NUC-HC753 6954 2P BG13NUC-HC754 6955 2P BG13NUC-HC755 6956 2P BG13NUC-HC756 6957 2P BG13NUC-HC757 6958 RBD BG13NUC-HC758 6959 2P BG13NUC-HC759 6960 2P BG13NUC-HC760 6961 2P BG13NUC-HC761 6962 2P BG13NUC-HC762 6963 RBD BG13NUC-HC763 6964 2P BG13NUC-HC764 6965 2P BG13NUC-HC765 6966 2P BG13NUC-HC766 6967 2P BG13NUC-HC767 6968 2P BG13NUC-HC768 6969 2P BG13NUC-HC769 6970 2P BG13NUC-HC770 6971 2P BG13NUC-HC771 6972 2P BG13NUC-HC772 6973 RBD BG13NUC-HC773 6974 RBD BG13NUC-HC774 6975 RBD BG13NUC-HC775 6976 RBD BG13NUC-HC776 6977 RBD BG13NUC-HC777 6978 RBD BG13NUC-HC778 6979 2P BG13NUC-HC779 6980 RBD BG13NUC-HC780 6981 RBD BG13NUC-HC781 6982 2P BG13NUC-HC782 6983 2P BG13NUC-HC783 6984 RBD BG13NUC-HC784 6985 RBD BG13NUC-HC785 6986 2P BG13NUC-HC786 6987 2P BG13NUC-HC787 6988 2P BG13NUC-HC788 6989 2P BG13NUC-HC789 6990 RBD BG13NUC-HC790 6991 2P BG13NUC-HC791 6992 RBD BG13NUC-HC792 6993 RBD BG13NUC-HC793 6994 2P BG13NUC-HC794 6995 2P BG13NUC-HC795 6996 2P BG13NUC-HC796 6997 2P BG13NUC-HC797 6998 2P BG13NUC-HC798 6999 RBD BG13NUC-HC799 7000 RBD BG13NUC-HC800 7001 RBD BG13NUC-HC801 7002 2P BG13NUC-HC802 7003 2P BG13NUC-HC803 7004 2P BG13NUC-HC804 7005 2P BG13NUC-HC805 7006 2P BG13NUC-HC806 7007 2P BG13NUC-HC807 7008 2P BG13NUC-HC808 7009 2P BG13NUC-HC809 7010 2P BG13NUC-HC810 7011 RBD BG13NUC-HC811 7012 RBD BG13NUC-HC812 7013 RBD BG13NUC-HC813 7014 2P BG13NUC-HC814 7015 2P BG13NUC-HC815 7016 2P BG13NUC-HC816 7017 2P BG13NUC-HC817 7018 2P BG13NUC-HC818 7019 2P BG13NUC-HC819 7020 2P BG13NUC-HC820 7021 2P BG13NUC-HC821 7022 2P BG13NUC-HC822 7023 RBD BG13NUC-HC823 7024 RBD BG13NUC-HC824 7025 RBD BG13NUC-HC825 7026 RBD BG13NUC-HC826 7027 RBD BG13NUC-HC827 7028 2P BG13NUC-HC828 7029 2P BG13NUC-HC829 7030 2P BG13NUC-HC830 7031 2P BG13NUC-HC831 7032 2P BG13NUC-HC832 7033 RBD BG13NUC-HC833 7034 RBD BG13NUC-HC834 7035 RBD BG13NUC-HC835 7036 2P BG13NUC-HC836 7037 RBD BG13NUC-HC837 7038 2P BG13NUC-HC838 7039 RBD BG13NUC-HC839 7040 2P BG13NUC-HC840 7041 2P BG13NUC-HC841 7042 RBD BG13NUC-HC842 7043 RBD BG13NUC-HC843 7044 2P BG13NUC-HC844 7045 RBD BG13NUC-HC845 7046 RBD BG13NUC-HC846 7047 2P BG13NUC-HC847 7048 2P BG13NUC-HC848 7049 RBD BG13NUC-HC849 7050 RBD BG13NUC-HC850 7051 RBD BG13NUC-HC851 7052 2P BG13NUC-HC852 7053 2P BG13NUC-HC853 7054 2P BG13NUC-HC854 7055 2P BG13NUC-HC855 7056 2P BG13NUC-HC856 7057 RBD BG13NUC-HC857 7058 2P BG13NUC-HC858 7059 2P BG13NUC-HC859 7060 2P BG13NUC-HC860 7061 2P BG13NUC-HC861 7062 2P BG13NUC-HC862 7063 RBD BG13NUC-HC863 7064 2P BG13NUC-HC864 7065 2P BG13NUC-HC865 7066 2P BG13NUC-HC866 7067 2P BG13NUC-HC867 7068 2P BG13NUC-HC868 7069 2P BG13NUC-HC869 7070 RBD BG13NUC-HC870 7071 2P BG13NUC-HC871 7072 RBD BG13NUC-HC872 7073 RBD BG13NUC-HC873 7074 RBD BG13NUC-HC874 7075 RBD BG13NUC-HC875 7076 RBD BG13NUC-HC876 7077 RBD BG13NUC-HC877 7078 2P BG13NUC-HC878 7079 2P BG13NUC-HC879 7080 2P BG13NUC-HC880 7081 2P BG13NUC-HC881 7082 RBD BG13NUC-HC882 7083 2P BG13NUC-HC883 7084 RBD BG13NUC-HC884 7085 RBD BG13NUC-HC885 7086 2P BG13NUC-HC886 7087 RBD BG13NUC-HC887 7088 RBD BG13NUC-HC888 7089 RBD BG13NUC-HC889 7090 RBD BG13NUC-HC890 7091 RBD BG13NUC-HC891 7092 RBD BG13NUC-HC892 7093 2P BG13NUC-HC893 7094 RBD BG13NUC-HC894 7095 RBD BG13NUC-HC895 7096 RBD BG13NUC-HC896 7097 RBD BG13NUC-HC897 7098 RBD BG13NUC-HC898 7099 RBD BG13NUC-HC899 7100 2P BG13NUC-HC900 7101 2P BG13NUC-HC901 7102 2P BG13NUC-HC902 7103 2P BG13NUC-HC903 7104 2P BG13NUC-HC904 7105 RBD BG13NUC-HC905 7106 2F BG13NUC-HC906 7107 RBD BG13NUC-HC907 7108 2P BG13NUC-HC908 7109 2P BG13NUC-HC909 7110 2P BG13NUC-HC910 7111 2P BG13NUC-HC911 7112 2P BG13NUC-HC912 7113 2P BG13NUC-HC913 7114 2P BG13NUC-HC914 7115 2P BG13NUC-HC915 7116 2P BG13NUC-HC916 7117 2P BG13NUC-HC917 7118 2P BG13NUC-HC918 7119 RBD BG13NUC-HC919 7120 2P BG13NUC-HC920 7121 RBD BG13NUC-HC921 7122 RBD BG13NUC-HC922 7123 RBD BG13NUC-HC923 7124 RBD BG13NUC-HC924 7125 2F BG13NUC-HC925 7126 2P BG13NUC-HC926 7127 RBD BG13NUC-HC927 7128 2P BG13NUC-HC928 7129 2P BG13NUC-HC929 7130 2P BG13NUC-HC930 7131 2P BG13NUC-HC931 7132 2P BG13NUC-HC932 7133 2P BG13NUC-HC933 7134 2P BG13NUC-HC934 7135 RBD BG13NUC-HC935 7136 RBD BG13NUC-HC936 7137 2P BG13NUC-HC937 7138 2P BG13NUC-HC938 7139 2P BG13NUC-HC939 7140 RBD BG13NUC-HC940 7141 2P BG13NUC-HC941 7142 RBD BG13NUC-HC942 7143 RBD BG13NUC-HC943 7144 RBD BG13NUC-HC944 7145 RBD BG13NUC-HC945 7146 2P BG13NUC-HC946 7147 RBD BG13NUC-HC947 7148 RBD BG13NUC-HC948 7149 RBD BG13NUC-HC949 7150 2P BG13NUC-HC950 7151 RBD BG13NUC-HC951 7152 2F BG13NUC-HC952 7153 2P BG13NUC-HC953 7154 2P BG13NUC-HC954 7155 2P BG13NUC-HC955 7156 2P BG13NUC-HC956 7157 RBD BG13NUC-HC957 7158 2P BG13NUC-HC958 7159 RBD BG13NUC-HC959 7160 RBD BG13NUC-HC960 7161 2P BG13NUC-HC961 7162 RBD BG13NUC-HC962 7163 RBD BG13NUC-HC963 7164 2P BG13NUC-HC964 7165 RBD BG13NUC-HC965 7166 2P BG13NUC-HC966 7167 2P BG13NUC-HC967 7168 2P BG13NUC-HC968 7169 2P BG13NUC-HC969 7170 RBD BG13NUC-HC970 7171 2P BG13NUC-HC971 7172 RBD BG13NUC-HC972 7173 2P BG13NUC-HC973 7174 RBD BG13NUC-HC974 7175 RBD BG13NUC-HC975 7176 RBD BG13NUC-HC976 7177 2P BG13NUC-HC977 7178 RBD BG13NUC-HC978 7179 2P BG13NUC-HC979 7180 2P BG13NUC-HC980 7181 RBD BG13NUC-HC981 7182 2P BG13NUC-HC982 7183 2P BG13NUC-HC983 7184 RBD BG13NUC-HC984 7185 RBD BG13NUC-HC985 7186 RBD BG13NUC-HC986 7187 RBD BG13NUC-HC987 7188 2P BG13NUC-HC988 7189 2P BG13NUC-HC989 7190 2P BG13NUC-HC990 7191 RBD BG13NUC-HC991 7192 2P BG13NUC-HC992 7193 2P BG13NUC-HC993 7194 RBD BG13NUC-HC994 7195 RBD BG13NUC-HC995 7196 2P BG13NUC-HC996 7197 RBD BG13NUC-HC997 7198 2P BG13NUC-HC998 7199 RBD BG13NUC-HC999 7200 2P BG13NUC-HC1000 7201 RBD BG13NUC-HC1001 7202 RBD BG13NUC-HC1002 7203 2P BG13NUC-HC1003 7204 RBD BG13NUC-HC1004 7205 2P BG13NUC-HC1005 7206 2P BG13NUC-HC1006 7207 2P BG13NUC-HC1007 7208 2P BG13NUC-HC1008 7209 2P BG13NUC-HC1009 7210 RBD BG13NUC-HC1010 7211 2P BG13NUC-HC1011 7212 2P BG13NUC-HC1012 7213 RBD BG13NUC-HC1013 7214 RBD BG13NUC-HC1014 7215 2P BG13NUC-HC1015 7216 2P BG13NUC-HC1016 7217 2P BG13NUC-HC1017 7218 2P BG13NUC-HC1018 7219 2P BG13NUC-HC1019 7220 2P BG13NUC-HC1020 7221 2P BG13NUC-HC1021 7222 RBD BG13NUC-HC1022 7223 2P BG13NUC-HC1023 7224 2P BG13NUC-HC1024 7225 2P BG13NUC-HC1025 7226 RBD BG13NUC-HC1026 7227 2P BG13NUC-HC1027 7228 2P BG13NUC-HC1028 7229 2P BG13NUC-HC1029 7230 2P BG13NUC-HC1030 7231 2P BG13NUC-HC1031 7232 RBD BG13NUC-HC1032 7233 RBD BG13NUC-HC1033 7234 2P BG13NUC-HC1034 7235 2P BG13NUC-HC1035 7236 2P BG13NUC-HC1036 7237 2P BG13NUC-HC1037 7238 RBD BG13NUC-HC1038 7239 RBD BG13NUC-HC1039 7240 RBD BG13NUC-HC1040 7241 2P BG13NUC-HC1041 7242 2F BG13NUC-HC1042 7243 RBD BG13NUC-HC1043 7244 2P BG13NUC-HC1044 7245 2P BG13NUC-HC1045 7246 2P BG13NUC-HC1046 7247 2P BG13NUC-HC1047 7248 2P BG13NUC-HC1048 7249 RBD BG13NUC-HC1049 7250 2P BG13NUC-HC1050 7251 2P BG13NUC-HC1051 7252 2P BG13NUC-HC1052 7253 RBD BG13NUC-HC1053 7254 2P BG13NUC-HC1054 7255 2P BG13NUC-HC1055 7256 2P BG13NUC-HC1056 7257 2F BG13NUC-HC1057 7258 2P BG13NUC-HC1058 7259 RBD BG13NUC-HC1059 7260 2P BG13NUC-HC1060 7261 RBD BG13NUC-HC1061 7262 2P BG13NUC-HC1062 7263 2P BG13NUC-HC1063 7264 2P BG13NUC-HC1064 7265 RBD BG13NUC-HC1065 7266 2P BG13NUC-HC1066 7267 2P BG13NUC-HC1067 7268 RBD BG13NUC-HC1068 7269 2P BG13NUC-HC1069 7270 2P BG13NUC-HC1070 7271 2P BG13NUC-HC1071 7272 RBD BG13NUC-HC1072 7273 RBD BG13NUC-HC1073 7274 2P BG13NUC-HC1074 7275 RBD BG13NUC-HC1075 7276 2P BG13NUC-HC1076 7277 2P BG13NUC-HC1077 7278 RBD BG13NUC-HC1078 7279 RBD BG13NUC-HC1079 7280 RBD BG13NUC-HC1080 7281 RBD BG13NUC-HC1081 7282 2P BG13NUC-HC1082 7283 2P BG13NUC-HC1083 7284 RBD BG13NUC-HC1084 7285 2P BG13NUC-HC1085 7286 RBD BG13NUC-HC1086 7287 2P BG13NUC-HC1087 7288 2P BG13NUC-HC1088 7289 2P BG13NUC-HC1089 7290 RBD BG13NUC-HC1090 7291 RBD BG13NUC-HC1091 7292 2P BG13NUC-HC1092 7293 RBD BG13NUC-HC1093 7294 2P BG13NUC-HC1094 7295 RBD BG13NUC-HC1095 7296 RBD BG13NUC-HC1096 7297 RBD BG13NUC-HC1097 7298 RBD BG13NUC-HC1098 7299 2P BG13NUC-HC1099 7300 RBD BG13NUC-HC1100 7301 RBD BG13NUC-HC1101 7302 RBD BG13NUC-HC1102 7303 RBD BG13NUC-HC1103 7304 2P BG13NUC-HC1104 7305 2P BG13NUC-HC1105 7306 RBD BG13NUC-HC1106 7307 2P BG13NUC-HC1107 7308 RBD BG13NUC-HC1108 7309 2P BG13NUC-HC1109 7310 2F BG13NUC-HC1110 7311 2P BG13NUC-HC1111 7312 RBD BG13NUC-HC1112 7313 2P BG13NUC-HC1113 7314 RBD BG13NUC-HC1114 7315 2P BG13NUC-HC1115 7316 2P BG13NUC-HC1116 7317 2P BG13NUC-HC1117 7318 2P BG13NUC-HC1118 7319 2P BG13NUC-HC1119 7320 2P BG13NUC-HC1120 7321 2P BG13NUC-HC1121 7322 2P BG13NUC-HC1122 7323 2P BG13NUC-HC1123 7324 2P BG13NUC-HC1124 7325 2P BG13NUC-HC1125 7326 RBD BG13NUC-HC1126 7327 2P BG13NUC-HC1127 7328 2P BG13NUC-HC1128 7329 2P BG13NUC-HC1129 7330 2P BG13NUC-HC1130 7331 RBD BG13NUC-HC1131 7332 RBD BG13NUC-HC1132 7333 2P BG13NUC-HC1133 7334 RBD BG13NUC-HC1134 7335 RBD BG13NUC-HC1135 7336 RBD BG13NUC-HC1136 7337 RBD BG13NUC-LC1 7338 RBD BG13NUC-LC2 7339 RBD BG13NUC-LC3 7340 RBD BG13NUC-LC4 7341 RBD BG13NUC-LC5 7342 RBD BG13NUC-LC6 7343 RBD BG13NUC-LC7 7344 RBD BG13NUC-LC8 7345 RBD BG13NUC-LC9 7346 RBD BG13NUC-LC10 7347 RBD BG13NUC-LC11 7348 2P BG13NUC-LC12 7349 2P BG13NUC-LC13 7350 2P BG13NUC-LC14 7351 2P BG13NUC-LC15 7352 2P BG13NUC-LC16 7353 2P BG13NUC-LC17 7354 2F BG13NUC-LC18 7355 2P BG13NUC-LC19 7356 RBD BG13NUC-LC20 7357 RBD BG13NUC-LC21 7358 RBD BG13NUC-LC22 7359 RBD BG13NUC-LC23 7360 RBD BG13NUC-LC24 7361 RBD BG13NUC-LC25 7362 RBD BG13NUC-LC26 7363 2P BG13NUC-LC27 7364 2P BG13NUC-LC28 7365 2P BG13NUC-LC29 7366 2P BG13NUC-LC30 7367 2P BG13NUC-LC31 7368 2P BG13NUC-LC32 7369 2P BG13NUC-LC33 7370 2P BG13NUC-LC34 7371 RBD BG13NUC-LC35 7372 RBD BG13NUC-LC36 7373 RBD BG13NUC-LC37 7374 RBD BG13NUC-LC38 7375 RBD BG13NUC-LC39 7376 RBD BG13NUC-LC40 7377 RBD BG13NUC-LC41 7378 2P BG13NUC-LC42 7379 2P BG13NUC-LC43 7380 2P BG13NUC-LC44 7381 2P BG13NUC-LC45 7382 2P BG13NUC-LC46 7383 RBD BG13NUC-LC47 7384 RBD BG13NUC-LC48 7385 RBD BG13NUC-LC49 7386 RBD BG13NUC-LC50 7387 RBD BG13NUC-LC51 7388 RBD BG13NUC-LC52 7389 RBD BG13NUC-LC53 7390 RBD BG13NUC-LC54 7391 RBD BG13NUC-LC55 7392 RBD BG13NUC-LC56 7393 2P BG13NUC-LC57 7394 2P BG13NUC-LC58 7395 RBD BG13NUC-LC59 7396 RBD BG13NUC-LC60 7397 RBD BG13NUC-LC61 7398 RBD BG13NUC-LC62 7399 RBD BG13NUC-LC63 7400 RBD BG13NUC-LC64 7401 RBD BG13NUC-LC65 7402 RBD BG13NUC-LC66 7403 2P BG13NUC-LC67 7404 2P BG13NUC-LC68 7405 RBD BG13NUC-LC69 7406 RBD BG13NUC-LC70 7407 RBD BG13NUC-LC71 7408 RBD BG13NUC-LC72 7409 RBD BG13NUC-LC73 7410 2P BG13NUC-LC74 7411 2P BG13NUC-LC75 7412 2P BG13NUC-LC76 7413 2P BG13NUC-LC77 7414 2P BG13NUC-LC78 7415 RBD BG13NUC-LC79 7416 RBD BG13NUC-LC80 7417 RBD BG13NUC-LC81 7418 RBD BG13NUC-LC82 7419 RBD BG13NUC-LC83 7420 2P BG13NUC-LC84 7421 2P BG13NUC-LC85 7422 2P BG13NUC-LC86 7423 RBD BG13NUC-LC87 7424 RBD BG13NUC-LC88 7425 RBD BG13NUC-LC89 7426 RBD BG13NUC-LC90 7427 RBD BG13NUC-LC91 7428 2P BG13NUC-LC92 7429 2P BG13NUC-LC93 7430 2P BG13NUC-LC94 7431 RBD BG13NUC-LC95 7432 RBD BG13NUC-LC96 7433 RBD BG13NUC-LC97 7434 RBD BG13NUC-LC98 7435 RBD BG13NUC-LC99 7436 2P BG13NUC-LC100 7437 2P BG13NUC-LC101 7438 RBD BG13NUC-LC102 7439 RBD BG13NUC-LC103 7440 2P BG13NUC-LC104 7441 2P BG13NUC-LC105 7442 RBD BG13NUC-LC106 7443 RBD BG13NUC-LC107 7444 RBD BG13NUC-LC108 7445 RBD BG13NUC-LC109 7446 RBD BG13NUC-LC110 7447 2P BG13NUC-LC111 7448 2P BG13NUC-LC112 7449 RBD BG13NUC-LC113 7450 RBD BG13NUC-LC114 7451 RBD BG13NUC-LC115 7452 RBD BG13NUC-LC116 7453 RBD BG13NUC-LC117 7454 RBD BG13NUC-LC118 7455 RBD BG13NUC-LC119 7456 2P BG13NUC-LC120 7457 2P BG13NUC-LC121 7458 2P BG13NUC-LC122 7459 RBD BG13NUC-LC123 7460 RBD BG13NUC-LC124 7461 RBD BG13NUC-LC125 7462 2P BG13NUC-LC126 7463 2P BG13NUC-LC127 7464 2P BG13NUC-LC128 7465 2P BG13NUC-LC129 7466 2P BG13NUC-LC130 7467 2P BG13NUC-LC131 7468 2P BG13NUC-LC132 7469 RBD BG13NUC-LC133 7470 RBD BG13NUC-LC134 7471 2P BG13NUC-LC135 7472 2P BG13NUC-LC136 7473 RBD BG13NUC-LC137 7474 RBD BG13NUC-LC138 7475 RBD BG13NUC-LC139 7476 2P BG13NUC-LC140 7477 RBD BG13NUC-LC141 7478 RBD BG13NUC-LC142 7479 RBD BG13NUC-LC143 7480 2P BG13NUC-LC144 7481 RBD BG13NUC-LC145 7482 RBD BG13NUC-LC146 7483 RBD BG13NUC-LC147 7484 2P BG13NUC-LC148 7485 RBD BG13NUC-LC149 7486 2P BG13NUC-LC150 7487 2P BG13NUC-LC151 7488 2P BG13NUC-LC152 7489 RBD BG13NUC-LC153 7490 RBD BG13NUC-LC154 7491 2P BG13NUC-LC155 7492 2P BG13NUC-LC156 7493 RBD BG13NUC-LC157 7494 RBD BG13NUC-LC158 7495 RBD BG13NUC-LC159 7496 2P BG13NUC-LC160 7497 2P BG13NUC-LC161 7498 2P BG13NUC-LC162 7499 RBD BG13NUC-LC163 7500 2P BG13NUC-LC164 7501 RBD BG13NUC-LC165 7502 RBD BG13NUC-LC166 7503 RBD BG13NUC-LC167 7504 2P BG13NUC-LC168 7505 RBD BG13NUC-LC169 7506 2P BG13NUC-LC170 7507 RBD BG13NUC-LC171 7508 RBD BG13NUC-LC172 7509 RBD BG13NUC-LC173 7510 RBD BG13NUC-LC174 7511 RBD BG13NUC-LC175 7512 RBD BG13NUC-LC176 7513 RBD BG13NUC-LC177 7514 2P BG13NUC-LC178 7515 2P BG13NUC-LC179 7516 2P BG13NUC-LC180 7517 2P BG13NUC-LC181 7518 2P BG13NUC-LC182 7519 2P BG13NUC-LC183 7520 RBD BG13NUC-LC184 7521 RBD BG13NUC-LC185 7522 RBD BG13NUC-LC186 7523 RBD BG13NUC-LC187 7524 2P BG13NUC-LC188 7525 2P BG13NUC-LC189 7526 2P BG13NUC-LC190 7527 RBD BG13NUC-LC191 7528 2P BG13NUC-LC192 7529 2P BG13NUC-LC193 7530 2P BG13NUC-LC194 7531 RBD BG13NUC-LC195 7532 2P BG13NUC-LC196 7533 RBD BG13NUC-LC197 7534 2P BG13NUC-LC198 7535 RBD BG13NUC-LC199 7536 RBD BG13NUC-LC200 7537 RBD BG13NUC-LC201 7538 2P BG13NUC-LC202 7539 2P BG13NUC-LC203 7540 2P BG13NUC-LC204 7541 2P BG13NUC-LC205 7542 2P BG13NUC-LC206 7543 RBD BG13NUC-LC207 7544 2P BG13NUC-LC208 7545 RBD BG13NUC-LC209 7546 2P BG13NUC-LC210 7547 RBD BG13NUC-LC211 7548 2P BG13NUC-LC212 7549 RBD BG13NUC-LC213 7550 2P BG13NUC-LC214 7551 RBD BG13NUC-LC215 7552 RBD BG13NUC-LC216 7553 RBD BG13NUC-LC217 7554 2P BG13NUC-LC218 7555 RBD BG13NUC-LC219 7556 RBD BG13NUC-LC220 7557 2P BG13NUC-LC221 7558 2P BG13NUC-LC222 7559 RBD BG13NUC-LC223 7560 2P BG13NUC-LC224 7561 RBD BG13NUC-LC225 7562 2P BG13NUC-LC226 7563 2P BG13NUC-LC227 7564 2P BG13NUC-LC228 7565 RBD BG13NUC-LC229 7566 RBD BG13NUC-LC230 7567 RBD BG13NUC-LC231 7568 2P BG13NUC-LC232 7569 2P BG13NUC-LC233 7570 2P BG13NUC-LC234 7571 RBD BG13NUC-LC235 7572 2P BG13NUC-LC236 7573 2P BG13NUC-LC237 7574 2P BG13NUC-LC238 7575 RBD BG13NUC-LC239 7576 RBD BG13NUC-LC240 7577 RBD BG13NUC-LC241 7578 RBD BG13NUC-LC242 7579 RBD BG13NUC-LC243 7580 RBD BG13NUC-LC244 7581 RBD BG13NUC-LC245 7582 2P BG13NUC-LC246 7583 RBD BG13NUC-LC247 7584 2P BG13NUC-LC248 7585 RBD BG13NUC-LC249 7586 2P BG13NUC-LC250 7587 2P BG13NUC-LC251 7588 2P BG13NUC-LC252 7589 RBD BG13NUC-LC253 7590 2P BG13NUC-LC254 7591 RBD BG13NUC-LC255 7592 2P BG13NUC-LC256 7593 RBD BG13NUC-LC257 7594 RBD BG13NUC-LC258 7595 2P BG13NUC-LC259 7596 2P BG13NUC-LC260 7597 2P BG13NUC-LC261 7598 2P BG13NUC-LC262 7599 RBD BG13NUC-LC263 7600 RBD BG13NUC-LC264 7601 RBD BG13NUC-LC265 7602 2P BG13NUC-LC266 7603 RBD BG13NUC-LC267 7604 2P BG13NUC-LC268 7605 RBD BG13NUC-LC269 7606 2P BG13NUC-LC270 7607 2P BG13NUC-LC271 7608 2P BG13NUC-LC272 7609 2F BG13NUC-LC273 7610 2P BG13NUC-LC274 7611 2P BG13NUC-LC275 7612 2P BG13NUC-LC276 7613 RBD BG13NUC-LC277 7614 2P BG13NUC-LC278 7615 2P BG13NUC-LC279 7616 RBD BG13NUC-LC280 7617 RBD BG13NUC-LC281 7618 RBD BG13NUC-LC282 7619 RBD BG13NUC-LC283 7620 RBD BG13NUC-LC284 7621 RBD BG13NUC-LC285 7622 2P BG13NUC-LC286 7623 2P BG13NUC-LC287 7624 RBD BG13NUC-LC288 7625 2P BG13NUC-LC289 7626 2P BG13NUC-LC290 7627 2P BG13NUC-LC291 7628 RBD BG13NUC-LC292 7629 2P BG13NUC-LC293 7630 RBD BG13NUC-LC294 7631 RBD BG13NUC-LC295 7632 RBD BG13NUC-LC296 7633 2F BG13NUC-LC297 7634 2P BG13NUC-LC298 7635 RBD BG13NUC-LC299 7636 2P BG13NUC-LC300 7637 RBD BG13NUC-LC301 7638 2P BG13NUC-LC302 7639 RBD BG13NUC-LC303 7640 2P BG13NUC-LC304 7641 RBD BG13NUC-LC305 7642 2P BG13NUC-LC306 7643 2P BG13NUC-LC307 7644 RBD BG13NUC-LC308 7645 RBD BG13NUC-LC309 7646 2P BG13NUC-LC310 7647 RBD BG13NUC-LC311 7648 2P BG13NUC-LC312 7649 2P BG13NUC-LC313 7650 RBD BG13NUC-LC314 7651 2P BG13NUC-LC315 7652 2P BG13NUC-LC316 7653 RBD BG13NUC-LC317 7654 2P BG13NUC-LC318 7655 RBD BG13NUC-LC319 7656 RBD BG13NUC-LC320 7657 2P BG13NUC-LC321 7658 2P BG13NUC-LC322 7659 2P BG13NUC-LC323 7660 RBD BG13NUC-LC324 7661 RBD BG13NUC-LC325 7662 RBD BG13NUC-LC326 7663 2P BG13NUC-LC327 7664 2P BG13NUC-LC328 7665 2P BG13NUC-LC329 7666 2P BG13NUC-LC330 7667 RBD BG13NUC-LC331 7668 2P BG13NUC-LC332 7669 RBD BG13NUC-LC333 7670 RBD BG13NUC-LC334 7671 2P BG13NUC-LC335 7672 RBD BG13NUC-LC336 7673 RBD BG13NUC-LC337 7674 RBD BG13NUC-LC338 7675 RBD BG13NUC-LC339 7676 RBD BG13NUC-LC340 7677 2P BG13NUC-LC341 7678 2P BG13NUC-LC342 7679 2P BG13NUC-LC343 7680 RBD BG13NUC-LC344 7681 2P BG13NUC-LC345 7682 2P BG13NUC-LC346 7683 RBD BG13NUC-LC347 7684 2P BG13NUC-LC348 7685 2P BG13NUC-LC349 7686 2P BG13NUC-LC350 7687 2P BG13NUC-LC351 7688 RBD BG13NUC-LC352 7689 2P BG13NUC-LC353 7690 RBD BG13NUC-LC354 7691 2P BG13NUC-LC355 7692 RBD BG13NUC-LC356 7693 2P BG13NUC-LC357 7694 RBD BG13NUC-LC358 7695 2P BG13NUC-LC359 7696 RBD BG13NUC-LC360 7697 2P BG13NUC-LC361 7698 2P BG13NUC-LC362 7699 RBD BG13NUC-LC363 7700 RBD BG13NUC-LC364 7701 RBD BG13NUC-LC365 7702 2P BG13NUC-LC366 7703 2P BG13NUC-LC367 7704 2P BG13NUC-LC368 7705 2P BG13NUC-LC369 7706 RBD BG13NUC-LC370 7707 2P BG13NUC-LC371 7708 2P BG13NUC-LC372 7709 2P BG13NUC-LC373 7710 RBD BG13NUC-LC374 7711 2P BG13NUC-LC375 7712 2P BG13NUC-LC376 7713 RBD BG13NUC-LC377 7714 2P BG13NUC-LC378 7715 RBD BG13NUC-LC379 7716 RBD BG13NUC-LC380 7717 2P BG13NUC-LC381 7718 RBD BG13NUC-LC382 7719 RBD BG13NUC-LC383 7720 2P BG13NUC-LC384 7721 RBD BG13NUC-LC385 7722 RBD BG13NUC-LC386 7723 RBD BG13NUC-LC387 7724 2P BG13NUC-LC388 7725 2P BG13NUC-LC389 7726 2P BG13NUC-LC390 7727 2P BG13NUC-LC391 7728 RBD BG13NUC-LC392 7729 RBD BG13NUC-LC393 7730 RBD BG13NUC-LC394 7731 2P BG13NUC-LC395 7732 2P BG13NUC-LC396 7733 2P BG13NUC-LC397 7734 2P BG13NUC-LC398 7735 2P BG13NUC-LC399 7736 RBD BG13NUC-LC400 7737 2P BG13NUC-LC401 7738 2P BG13NUC-LC402 7739 2P BG13NUC-LC403 7740 2P BG13NUC-LC404 7741 2P BG13NUC-LC405 7742 RBD BG13NUC-LC406 7743 2P BG13NUC-LC407 7744 2P BG13NUC-LC408 7745 2P BG13NUC-LC409 7746 2P BG13NUC-LC410 7747 RBD BG13NUC-LC411 7748 RBD BG13NUC-LC412 7749 RBD BG13NUC-LC413 7750 RBD BG13NUC-LC414 7751 2P BG13NUC-LC415 7752 2P BG13NUC-LC416 7753 RBD BG13NUC-LC417 7754 RBD BG13NUC-LC418 7755 2P BG13NUC-LC419 7756 2P BG13NUC-LC420 7757 RBD BG13NUC-LC421 7758 2P BG13NUC-LC422 7759 2P BG13NUC-LC423 7760 RBD BG13NUC-LC424 7761 RBD BG13NUC-LC425 7762 RBD BG13NUC-LC426 7763 2P BG13NUC-LC427 7764 2P BG13NUC-LC428 7765 2P BG13NUC-LC429 7766 2P BG13NUC-LC430 7767 2P BG13NUC-LC431 7768 RBD BG13NUC-LC432 7769 2P BG13NUC-LC433 7770 2P BG13NUC-LC434 7771 2P BG13NUC-LC435 7772 2P BG13NUC-LC436 7773 2P BG13NUC-LC437 7774 2P BG13NUC-LC438 7775 RBD BG13NUC-LC439 7776 RBD BG13NUC-LC440 7777 2P BG13NUC-LC441 7778 2P BG13NUC-LC442 7779 2P BG13NUC-LC443 7780 2P BG13NUC-LC444 7781 2P BG13NUC-LC445 7782 2P BG13NUC-LC446 7783 2P BG13NUC-LC447 7784 2P BG13NUC-LC448 7785 RBD BG13NUC-LC449 7786 2P BG13NUC-LC450 7787 2P BG13NUC-LC451 7788 2P BG13NUC-LC452 7789 2P BG13NUC-LC453 7790 RBD BG13NUC-LC454 7791 RBD BG13NUC-LC455 7792 2P BG13NUC-LC456 7793 2P BG13NUC-LC457 7794 2P BG13NUC-LC458 7795 RBD BG13NUC-LC459 7796 2P BG13NUC-LC460 7797 RBD BG13NUC-LC461 7798 2P BG13NUC-LC462 7799 RBD BG13NUC-LC463 7800 RBD BG13NUC-LC464 7801 2P BG13NUC-LC465 7802 2P BG13NUC-LC466 7803 2P BG13NUC-LC467 7804 2P BG13NUC-LC468 7805 2P BG13NUC-LC469 7806 2P BG13NUC-LC470 7807 RBD BG13NUC-LC471 7808 2P BG13NUC-LC472 7809 RBD BG13NUC-LC473 7810 RBD BG13NUC-LC474 7811 2P BG13NUC-LC475 7812 2P BG13NUC-LC476 7813 2P BG13NUC-LC477 7814 2P BG13NUC-LC478 7815 2P BG13NUC-LC479 7816 2P BG13NUC-LC480 7817 2P BG13NUC-LC481 7818 2P BG13NUC-LC482 7819 2P BG13NUC-LC483 7820 2P BG13NUC-LC484 7821 2P BG13NUC-LC485 7822 RBD BG13NUC-LC486 7823 RBD BG13NUC-LC487 7824 2P BG13NUC-LC488 7825 2P BG13NUC-LC489 7826 2P BG13NUC-LC490 7827 2P BG13NUC-LC491 7828 2P BG13NUC-LC492 7829 2P BG13NUC-LC493 7830 2P BG13NUC-LC494 7831 2P BG13NUC-LC495 7832 RBD BG13NUC-LC496 7833 RBD BG13NUC-LC497 7834 2P BG13NUC-LC498 7835 RBD BG13NUC-LC499 7836 2P BG13NUC-LC500 7837 RBD BG13NUC-LC501 7838 2P BG13NUC-LC502 7839 2P BG13NUC-LC503 7840 RBD BG13NUC-LC504 7841 2P BG13NUC-LC505 7842 RBD BG13NUC-LC506 7843 RBD BG13NUC-LC507 7844 2P BG13NUC-LC508 7845 2P BG13NUC-LC509 7846 2P BG13NUC-LC510 7847 2P BG13NUC-LC511 7848 RBD BG13NUC-LC512 7849 RBD BG13NUC-LC513 7850 RBD BG13NUC-LC514 7851 2P BG13NUC-LC515 7852 2P BG13NUC-LC516 7853 2P BG13NUC-LC517 7854 RBD BG13NUC-LC518 7855 RBD BG13NUC-LC519 7856 2P BG13NUC-LC520 7857 2P BG13NUC-LC521 7858 RBD BG13NUC-LC522 7859 RBD BG13NUC-LC523 7860 RBD BG13NUC-LC524 7861 2P BG13NUC-LC525 7862 2P BG13NUC-LC526 7863 2P BG13NUC-LC527 7864 2P BG13NUC-LC528 7865 2P BG13NUC-LC529 7866 RBD BG13NUC-LC530 7867 2P BG13NUC-LC531 7868 RBD BG13NUC-LC532 7869 RBD BG13NUC-LC533 7870 RBD BG13NUC-LC534 7871 RBD BG13NUC-LC535 7872 2P BG13NUC-LC536 7873 2P BG13NUC-LC537 7874 2P BG13NUC-LC538 7875 2P BG13NUC-LC539 7876 2P BG13NUC-LC540 7877 2P BG13NUC-LC541 7878 RBD BG13NUC-LC542 7879 RBD BG13NUC-LC543 7880 2P BG13NUC-LC544 7881 2P BG13NUC-LC545 7882 RBD BG13NUC-LC546 7883 RBD BG13NUC-LC547 7884 2P BG13NUC-LC548 7885 RBD BG13NUC-LC549 7886 2P BG13NUC-LC550 7887 2P BG13NUC-LC551 7888 RBD BG13NUC-LC552 7889 RBD BG13NUC-LC553 7890 RBD BG13NUC-LC554 7891 RBD BG13NUC-LC555 7892 2P BG13NUC-LC556 7893 2P BG13NUC-LC557 7894 RBD BG13NUC-LC558 7895 2P BG13NUC-LC559 7896 RBD BG13NUC-LC560 7897 2P BG13NUC-LC561 7898 2P BG13NUC-LC562 7899 2P BG13NUC-LC563 7900 2P BG13NUC-LC564 7901 2P BG13NUC-LC565 7902 2P BG13NUC-LC566 7903 2P BG13NUC-LC567 7904 RBD BG13NUC-LC568 7905 RBD BG13NUC-LC569 7906 RBD BG13NUC-LC570 7907 RBD BG13NUC-LC571 7908 2P BG13NUC-LC572 7909 2P BG13NUC-LC573 7910 2P BG13NUC-LC574 7911 2P BG13NUC-LC575 7912 2P BG13NUC-LC576 7913 2P BG13NUC-LC577 7914 2P BG13NUC-LC578 7915 2P BG13NUC-LC579 7916 2P BG13NUC-LC580 7917 2P BG13NUC-LC581 7918 2P BG13NUC-LC582 7919 2P BG13NUC-LC583 7920 2P BG13NUC-LC584 7921 2P BG13NUC-LC585 7922 2P BG13NUC-LC586 7923 2P BG13NUC-LC587 7924 2P BG13NUC-LC588 7925 2P BG13NUC-LC589 7926 2P BG13NUC-LC590 7927 RBD BG13NUC-LC591 7928 2P BG13NUC-LC592 7929 RBD BG13NUC-LC593 7930 2P BG13NUC-LC594 7931 RBD BG13NUC-LC595 7932 2P BG13NUC-LC596 7933 2P BG13NUC-LC597 7934 RBD BG13NUC-LC598 7935 2P BG13NUC-LC599 7936 2P BG13NUC-LC600 7937 2P BG13NUC-LC601 7938 2P BG13NUC-LC602 7939 2P BG13NUC-LC603 7940 2P BG13NUC-LC604 7941 2P BG13NUC-LC605 7942 RBD BG13NUC-LC606 7943 RBD BG13NUC-LC607 7944 RBD BG13NUC-LC608 7945 2P BG13NUC-LC609 7946 RBD BG13NUC-LC610 7947 2P BG13NUC-LC611 7948 RBD BG13NUC-LC612 7949 RBD BG13NUC-LC613 7950 RBD BG13NUC-LC614 7951 2P BG13NUC-LC615 7952 2P BG13NUC-LC616 7953 RBD BG13NUC-LC617 7954 RBD BG13NUC-LC618 7955 2P BG13NUC-LC619 7956 RBD BG13NUC-LC620 7957 2P BG13NUC-LC621 7958 2P BG13NUC-LC622 7959 RBD BG13NUC-LC623 7960 RBD BG13NUC-LC624 7961 2P BG13NUC-LC625 7962 2P BG13NUC-LC626 7963 2P BG13NUC-LC627 7964 RBD BG13NUC-LC628 7965 RBD BG13NUC-LC629 7966 RBD BG13NUC-LC630 7967 2P BG13NUC-LC631 7968 2P BG13NUC-LC632 7969 2P BG13NUC-LC633 7970 2P BG13NUC-LC634 7971 2P BG13NUC-LC635 7972 RBD BG13NUC-LC636 7973 RBD BG13NUC-LC637 7974 RBD BG13NUC-LC638 7975 2P BG13NUC-LC639 7976 RBD BG13NUC-LC640 7977 RBD BG13NUC-LC641 7978 2P BG13NUC-LC642 7979 2P BG13NUC-LC643 7980 RBD BG13NUC-LC644 7981 RBD BG13NUC-LC645 7982 2P BG13NUC-LC646 7983 RBD BG13NUC-LC647 7984 2P BG13NUC-LC648 7985 2P BG13NUC-LC649 7986 RBD BG13NUC-LC650 7987 RBD BG13NUC-LC651 7988 2P BG13NUC-LC652 7989 2P BG13NUC-LC653 7990 2P BG13NUC-LC654 7991 2P BG13NUC-LC655 7992 RBD BG13NUC-LC656 7993 RBD BG13NUC-LC657 7994 2P BG13NUC-LC658 7995 2P BG13NUC-LC659 7996 2P BG13NUC-LC660 7997 2P BG13NUC-LC661 7998 2P BG13NUC-LC662 7999 2P BG13NUC-LC663 8000 RBD BG13NUC-LC664 8001 2P BG13NUC-LC665 8002 RBD BG13NUC-LC666 8003 2P BG13NUC-LC667 8004 RBD BG13NUC-LC668 8005 RBD BG13NUC-LC669 8006 RBD BG13NUC-LC670 8007 2F BG13NUC-LC671 8008 RBD BG13NUC-LC672 8009 2P BG13NUC-LC673 8010 RBD BG13NUC-LC674 8011 RBD BG13NUC-LC675 8012 2P BG13NUC-LC676 8013 2P BG13NUC-LC677 8014 2P BG13NUC-LC678 8015 RBD BG13NUC-LC679 8016 2P BG13NUC-LC680 8017 2P BG13NUC-LC681 8018 2P BG13NUC-LC682 8019 2P BG13NUC-LC683 8020 RBD BG13NUC-LC684 8021 2P BG13NUC-LC685 8022 2P BG13NUC-LC686 8023 2P BG13NUC-LC687 8024 RBD BG13NUC-LC688 8025 2P BG13NUC-LC689 8026 RBD BG13NUC-LC690 8027 2F BG13NUC-LC691 8028 RBD BG13NUC-LC692 8029 RBD BG13NUC-LC693 8030 RBD BG13NUC-LC694 8031 2P BG13NUC-LC695 8032 RBD BG13NUC-LC696 8033 RBD BG13NUC-LC697 8034 RBD BG13NUC-LC698 8035 2P BG13NUC-LC699 8036 RBD BG13NUC-LC700 8037 RBD BG13NUC-LC701 8038 2P BG13NUC-LC702 8039 2P BG13NUC-LC703 8040 2P BG13NUC-LC704 8041 2P BG13NUC-LC705 8042 2P BG13NUC-LC706 8043 2P BG13NUC-LC707 8044 2P BG13NUC-LC708 8045 2P BG13NUC-LC709 8046 2P BG13NUC-LC710 8047 2P BG13NUC-LC711 8048 2P BG13NUC-LC712 8049 2P BG13NUC-LC713 8050 2P BG13NUC-LC714 8051 RBD BG13NUC-LC715 8052 RBD BG13NUC-LC716 8053 RBD BG13NUC-LC717 8054 RBD BG13NUC-LC718 8055 RBD BG13NUC-LC719 8056 2P BG13NUC-LC720 8057 2P BG13NUC-LC721 8058 2P BG13NUC-LC722 8059 2P BG13NUC-LC723 8060 2P BG13NUC-LC724 8061 2P BG13NUC-LC725 8062 2P BG13NUC-LC726 8063 2P BG13NUC-LC727 8064 2P BG13NUC-LC728 8065 RBD BG13NUC-LC729 8066 2P BG13NUC-LC730 8067 2P BG13NUC-LC731 8068 2P BG13NUC-LC732 8069 2P BG13NUC-LC733 8070 2P BG13NUC-LC734 8071 2P BG13NUC-LC735 8072 2P BG13NUC-LC736 8073 RBD BG13NUC-LC737 8074 2P BG13NUC-LC738 8075 RBD BG13NUC-LC739 8076 RBD BG13NUC-LC740 8077 RBD BG13NUC-LC741 8078 2P BG13NUC-LC742 8079 2P BG13NUC-LC743 8080 2P BG13NUC-LC744 8081 RBD BG13NUC-LC745 8082 2F BG13NUC-LC746 8083 RBD BG13NUC-LC747 8084 2P BG13NUC-LC748 8085 2P BG13NUC-LC749 8086 2P BG13NUC-LC750 8087 2P BG13NUC-LC751 8088 2P BG13NUC-LC752 8089 2P BG13NUC-LC753 8090 2P BG13NUC-LC754 8091 2P BG13NUC-LC755 8092 2P BG13NUC-LC756 8093 2P BG13NUC-LC757 8094 RBD BG13NUC-LC758 8095 2P BG13NUC-LC759 8096 2P BG13NUC-LC760 8097 2P BG13NUC-LC761 8098 2P BG13NUC-LC762 8099 RBD BG13NUC-LC763 8100 2P BG13NUC-LC764 8101 2P BG13NUC-LC765 8102 2P BG13NUC-LC766 8103 2P BG13NUC-LC767 8104 2P BG13NUC-LC768 8105 2P BG13NUC-LC769 8106 2P BG13NUC-LC770 8107 2P BG13NUC-LC771 8108 2P BG13NUC-LC772 8109 RBD BG13NUC-LC773 8110 RBD BG13NUC-LC774 8111 RBD BG13NUC-LC775 8112 RBD BG13NUC-LC776 8113 RBD BG13NUC-LC777 8114 RBD BG13NUC-LC778 8115 2P BG13NUC-LC779 8116 RBD BG13NUC-LC780 8117 RBD BG13NUC-LC781 8118 2P BG13NUC-LC782 8119 2P BG13NUC-LC783 8120 RBD BG13NUC-LC784 8121 RBD BG13NUC-LC785 8122 2P BG13NUC-LC786 8123 2P BG13NUC-LC787 8124 2P BG13NUC-LC788 8125 2P BG13NUC-LC789 8126 RBD BG13NUC-LC790 8127 2P BG13NUC-LC791 8128 RBD BG13NUC-LC792 8129 RBD BG13NUC-LC793 8130 2P BG13NUC-LC794 8131 2P BG13NUC-LC795 8132 2P BG13NUC-LC796 8133 2P BG13NUC-LC797 8134 2P BG13NUC-LC798 8135 RBD BG13NUC-LC799 8136 RBD BG13NUC-LC800 8137 RBD BG13NUC-LC801 8138 2P BG13NUC-LC802 8139 2P BG13NUC-LC803 8140 2P BG13NUC-LC804 8141 2P BG13NUC-LC805 8142 2P BG13NUC-LC806 8143 2P BG13NUC-LC807 8144 2P BG13NUC-LC808 8145 2P BG13NUC-LC809 8146 2P BG13NUC-LC810 8147 RBD BG13NUC-LC811 8148 RBD BG13NUC-LC812 8149 RBD BG13NUC-LC813 8150 2P BG13NUC-LC814 8151 2P BG13NUC-LC815 8152 2P BG13NUC-LC816 8153 2P BG13NUC-LC817 8154 2P BG13NUC-LC818 8155 2P BG13NUC-LC819 8156 2P BG13NUC-LC820 8157 2P BG13NUC-LC821 8158 2P BG13NUC-LC822 8159 RBD BG13NUC-LC823 8160 RBD BG13NUC-LC824 8161 RBD BG13NUC-LC825 8162 RBD BG13NUC-LC826 8163 RBD BG13NUC-LC827 8164 2P BG13NUC-LC828 8165 2P BG13NUC-LC829 8166 2P BG13NUC-LC830 8167 2P BG13NUC-LC831 8168 2P BG13NUC-LC832 8169 RBD BG13NUC-LC833 8170 RBD BG13NUC-LC834 8171 RBD BG13NUC-LC835 8172 2P BG13NUC-LC836 8173 RBD BG13NUC-LC837 8174 2P BG13NUC-LC838 8175 RBD BG13NUC-LC839 8176 2P BG13NUC-LC840 8177 2P BG13NUC-LC841 8178 RBD BG13NUC-LC842 8179 RBD BG13NUC-LC843 8180 2P BG13NUC-LC844 8181 RBD BG13NUC-LC845 8182 RBD BG13NUC-LC846 8183 2P BG13NUC-LC847 8184 2P BG13NUC-LC848 8185 RBD BG13NUC-LC849 8186 RBD BG13NUC-LC850 8187 RBD BG13NUC-LC851 8188 2P BG13NUC-LC852 8189 2P BG13NUC-LC853 8190 2P BG13NUC-LC854 8191 2P BG13NUC-LC855 8192 2P BG13NUC-LC856 8193 RBD BG13NUC-LC857 8194 2P BG13NUC-LC858 8195 2P BG13NUC-LC859 8196 2P BG13NUC-LC860 8197 2P BG13NUC-LC861 8198 2P BG13NUC-LC862 8199 RBD BG13NUC-LC863 8200 2P BG13NUC-LC864 8201 2P BG13NUC-LC865 8202 2P BG13NUC-LC866 8203 2P BG13NUC-LC867 8204 2F BG13NUC-LC868 8205 2P BG13NUC-LC869 8206 RBD BG13NUC-LC870 8207 2P BG13NUC-LC871 8208 RBD BG13NUC-LC872 8209 RBD BG13NUC-LC873 8210 RBD BG13NUC-LC874 8211 RBD BG13NUC-LC875 8212 RBD BG13NUC-LC876 8213 RBD BG13NUC-LC877 8214 2P BG13NUC-LC878 8215 2P BG13NUC-LC879 8216 2P BG13NUC-LC880 8217 2P BG13NUC-LC881 8218 RBD BG13NUC-LC882 8219 2P BG13NUC-LC883 8220 RBD BG13NUC-LC884 8221 RBD BG13NUC-LC885 8222 2P BG13NUC-LC886 8223 RBD BG13NUC-LC887 8224 RBD BG13NUC-LC888 8225 RBD BG13NUC-LC889 8226 RBD BG13NUC-LC890 8227 RBD BG13NUC-LC891 8228 RBD BG13NUC-LC892 8229 2P BG13NUC-LC893 8230 RBD BG13NUC-LC894 8231 RBD BG13NUC-LC895 8232 RBD BG13NUC-LC896 8233 RBD BG13NUC-LC897 8234 RBD BG13NUC-LC898 8235 RBD BG13NUC-LC899 8236 2P BG13NUC-LC900 8237 2P BG13NUC-LC901 8238 2P BG13NUC-LC902 8239 2P BG13NUC-LC903 8240 2P BG13NUC-LC904 8241 RBD BG13NUC-LC905 8242 2P BG13NUC-LC906 8243 RBD BG13NUC-LC907 8244 2P BG13NUC-LC908 8245 2P BG13NUC-LC909 8246 2P BG13NUC-LC910 8247 2P BG13NUC-LC911 8248 2P BG13NUC-LC912 8249 2P BG13NUC-LC913 8250 2P BG13NUC-LC914 8251 2P BG13NUC-LC915 8252 2P BG13NUC-LC916 8253 2P BG13NUC-LC917 8254 2P BG13NUC-LC918 8255 RBD BG13NUC-LC919 8256 2P BG13NUC-LC920 8257 RBD BG13NUC-LC921 8258 RBD BG13NUC-LC922 8259 RBD BG13NUC-LC923 8260 RBD BG13NUC-LC924 8261 2P BG13NUC-LC925 8262 2P BG13NUC-LC926 8263 RBD BG13NUC-LC927 8264 2P BG13NUC-LC928 8265 2P BG13NUC-LC929 8266 2P BG13NUC-LC930 8267 2P BG13NUC-LC931 8268 2P BG13NUC-LC932 8269 2P BG13NUC-LC933 8270 2P BG13NUC-LC934 8271 RBD BG13NUC-LC935 8272 RBD BG13NUC-LC936 8273 2P BG13NUC-LC937 8274 2P BG13NUC-LC938 8275 2P BG13NUC-LC939 8276 RBD BG13NUC-LC940 8277 2P BG13NUC-LC941 8278 RBD BG13NUC-LC942 8279 RBD BG13NUC-LC943 8280 RBD BG13NUC-LC944 8281 RBD BG13NUC-LC945 8282 2P BG13NUC-LC946 8283 RBD BG13NUC-LC947 8284 RBD BG13NUC-LC948 8285 RBD BG13NUC-LC949 8286 2P BG13NUC-LC950 8287 RBD BG13NUC-LC951 8288 2P BG13NUC-LC952 8289 2P BG13NUC-LC953 8290 2P BG13NUC-LC954 8291 2P BG13NUC-LC955 8292 2P BG13NUC-LC956 8293 RBD BG13NUC-LC957 8294 2P BG13NUC-LC958 8295 RBD BG13NUC-LC959 8296 RBD BG13NUC-LC960 8297 2P BG13NUC-LC961 8298 RBD BG13NUC-LC962 8299 RBD BG13NUC-LC963 8300 2P BG13NUC-LC964 8301 RBD BG13NUC-LC965 8302 2P BG13NUC-LC966 8303 2P BG13NUC-LC967 8304 2P BG13NUC-LC968 8305 2P BG13NUC-LC969 8306 RBD BG13NUC-LC970 8307 2P BG13NUC-LC971 8308 RBD BG13NUC-LC972 8309 2P BG13NUC-LC973 8310 RBD BG13NUC-LC974 8311 RBD BG13NUC-LC975 8312 RBD BG13NUC-LC976 8313 2P BG13NUC-LC977 8314 RBD BG13NUC-LC978 8315 2P BG13NUC-LC979 8316 2P BG13NUC-LC980 8317 RBD BG13NUC-LC981 8318 2P BG13NUC-LC982 8319 2P BG13NUC-LC983 8320 RBD BG13NUC-LC984 8321 RBD BG13NUC-LC985 8322 RBD BG13NUC-LC986 8323 RBD BG13NUC-LC987 8324 2P BG13NUC-LC988 8325 2P BG13NUC-LC989 8326 2P BG13NUC-LC990 8327 RBD BG13NUC-LC991 8328 2P BG13NUC-LC992 8329 2P BG13NUC-LC993 8330 RBD BG13NUC-LC994 8331 RBD BG13NUC-LC995 8332 2P BG13NUC-LC996 8333 RBD BG13NUC-LC997 8334 2P BG13NUC-LC998 8335 RBD BG13NUC-LC999 8336 2P BG13NUC-LC1000 8337 RBD BG13NUC-LC1001 8338 RBD BG13NUC-LC1002 8339 2P BG13NUC-LC1003 8340 RBD BG13NUC-LC1004 8341 2P BG13NUC-LC1005 8342 2P BG13NUC-LC1006 8343 2P BG13NUC-LC1007 8344 2P BG13NUC-LC1008 8345 2P BG13NUC-LC1009 8346 RBD BG13NUC-LC1010 8347 2P BG13NUC-LC1011 8348 2P BG13NUC-LC1012 8349 RBD BG13NUC-LC1013 8350 RBD BG13NUC-LC1014 8351 2P BG13NUC-LC1015 8352 2P BG13NUC-LC1016 8353 2P BG13NUC-LC1017 8354 2P BG13NUC-LC1018 8355 2P BG13NUC-LC1019 8356 2P BG13NUC-LC1020 8357 2P BG13NUC-LC1021 8358 RBD BG13NUC-LC1022 8359 2P BG13NUC-LC1023 8360 2P BG13NUC-LC1024 8361 2P BG13NUC-LC1025 8362 RBD BG13NUC-LC1026 8363 2P BG13NUC-LC1027 8364 2P BG13NUC-LC1028 8365 2P BG13NUC-LC1029 8366 2P BG13NUC-LC1030 8367 2P BG13NUC-LC1031 8368 RBD BG13NUC-LC1032 8369 RBD BG13NUC-LC1033 8370 2P BG13NUC-LC1034 8371 2P BG13NUC-LC1035 8372 2P BG13NUC-LC1036 8373 2P BG13NUC-LC1037 8374 RBD BG13NUC-LC1038 8375 RBD BG13NUC-LC1039 8376 RBD BG13NUC-LC1040 8377 2P BG13NUC-LC1041 8378 2F BG13NUC-LC1042 8379 RBD BG13NUC-LC1043 8380 2P BG13NUC-LC1044 8381 2P BG13NUC-LC1045 8382 2P BG13NUC-LC1046 8383 2P BG13NUC-LC1047 8384 2P BG13NUC-LC1048 8385 RBD BG13NUC-LC1049 8386 2P BG13NUC-LC1050 8387 2P BG13NUC-LC1051 8388 2P BG13NUC-LC1052 8389 RBD BG13NUC-LC1053 8390 2P BG13NUC-LC1054 8391 2P BG13NUC-LC1055 8392 2P BG13NUC-LC1056 8393 2P BG13NUC-LC1057 8394 2P BG13NUC-LC1058 8395 RBD BG13NUC-LC1059 8396 2P BG13NUC-LC1060 8397 RBD BG13NUC-LC1061 8398 2P BG13NUC-LC1062 8399 2P BG13NUC-LC1063 8400 2P BG13NUC-LC1064 8401 RBD BG13NUC-LC1065 8402 2P BG13NUC-LC1066 8403 2P BG13NUC-LC1067 8404 RBD BG13NUC-LC1068 8405 2P BG13NUC-LC1069 8406 2P BG13NUC-LC1070 8407 2P BG13NUC-LC1071 8408 RBD BG13NUC-LC1072 8409 RBD BG13NUC-LC1073 8410 2P BG13NUC-LC1074 8411 RBD BG13NUC-LC1075 8412 2P BG13NUC-LC1076 8413 2F BG13NUC-LC1077 8414 RBD BG13NUC-LC1078 8415 RBD BG13NUC-LC1079 8416 RBD BG13NUC-LC1080 8417 RBD BG13NUC-LC1081 8418 2P BG13NUC-LC1082 8419 2P BG13NUC-LC1083 8420 RBD BG13NUC-LC1084 8421 2P BG13NUC-LC1085 8422 RBD BG13NUC-LC1086 8423 2P BG13NUC-LC1087 8424 2P BG13NUC-LC1088 8425 2P BG13NUC-LC1089 8426 RBD BG13NUC-LC1090 8427 RBD BG13NUC-LC1091 8428 2P BG13NUC-LC1092 8429 RBD BG13NUC-LC1093 8430 2P BG13NUC-LC1094 8431 RBD BG13NUC-LC1095 8432 RBD BG13NUC-LC1096 8433 RBD BG13NUC-LC1097 8434 RBD BG13NUC-LC1098 8435 2P BG13NUC-LC1099 8436 RBD BG13NUC-LC1100 8437 RBD BG13NUC-LC1101 8438 RBD BG13NUC-LC1102 8439 RBD BG13NUC-LC1103 8440 2P BG13NUC-LC1104 8441 2P BG13NUC-LC1105 8442 RBD BG13NUC-LC1106 8443 2P BG13NUC-LC1107 8444 RBD BG13NUC-LC1108 8445 2P BG13NUC-LC1109 8446 2P BG13NUC-LC1110 8447 2P BG13NUC-LC1111 8448 RBD BG13NUC-LC1112 8449 2P BG13NUC-LC1113 8450 RBD BG13NUC-LC1114 8451 2P BG13NUC-LC1115 8452 2P BG13NUC-LC1116 8453 2P BG13NUC-LC1117 8454 2P BG13NUC-LC1118 8455 2P BG13NUC-LC1119 8456 2P BG13NUC-LC1120 8457 2P BG13NUC-LC1121 8458 2P BG13NUC-LC1122 8459 2P BG13NUC-LC1123 8460 2P BG13NUC-LC1124 8461 2F BG13NUC-LC1125 8462 RBD BG13NUC-LC1126 8463 2P BG13NUC-LC1127 8464 2P BG13NUC-LC1128 8465 2P BG13NUC-LC1129 8466 2P BG13NUC-LC1130 8467 RBD BG13NUC-LC1131 8468 RBD BG13NUC-LC1132 8469 2P BG13NUC-LC1133 8470 RBD BG13NUC-LC1134 8471 RBD BG13NUC-LC1135 8472 RBD BG13NUC-LC1136 8473 RBD BG14NUC-HC1 8474 RBD BG14NUC-HC2 8475 RBD BG14NUC-HC3 8476 RBD BG14NUC-HC4 8477 RBD BG14NUC-HC5 8478 RBD BG14NUC-HC6 8479 RBD BG14NUC-HC7 8480 RBD BG14NUC-HC8 8481 RBD BG14NUC-HC9 8482 RBD BG14NUC-HC10 8483 RBD BG14NUC-HC11 8484 RBD BG14NUC-HC12 8485 RBD BG14NUC-HC13 8486 RBD BG14NUC-HC14 8487 RBD BG14NUC-HC15 8488 RBD BG14NUC-HC16 8489 RBD BG14NUC-HC17 8490 RBD BG14NUC-HC18 8491 RBD BG14NUC-HC19 8492 RBD BG14NUC-HC20 8493 RBD BG14NUC-HC21 8494 RBD BG14NUC-HC22 8495 RBD BG14NUC-HC23 8496 RBD BG14NUC-HC24 8497 RBD BG14NUC-HC25 8498 2P BG14NUC-HC26 8499 2P BG14NUC-HC27 8500 2P BG14NUC-HC28 8501 2P BG14NUC-HC29 8502 2P BG14NUC-HC30 8503 2P BG14NUC-HC31 8504 2P BG14NUC-HC32 8505 2P BG14NUC-HC33 8506 2P BG14NUC-HC34 8507 2P BG14NUC-HC35 8508 2P BG14NUC-HC36 8509 2P BG14NUC-HC37 8510 2P BG14NUC-HC38 8511 2P BG14NUC-HC39 8512 2P BG14NUC-HC40 8513 2P BG14NUC-HC41 8514 2P BG14NUC-HC42 8515 2P BG14NUC-HC43 8516 2P BG14NUC-HC44 8517 2P BG14NUC-HC45 8518 2P BG14NUC-HC46 8519 2P BG14NUC-HC47 8520 2P BG14NUC-HC48 8521 2P BG14NUC-HC49 8522 RBD BG14NUC-HC50 8523 RBD BG14NUC-HC51 8524 RBD BG14NUC-HC52 8525 RBD BG14NUC-HC53 8526 RBD BG14NUC-HC54 8527 RBD BG14NUC-HC55 8528 RBD BG14NUC-HC56 8529 RBD BG14NUC-HC57 8530 RBD BG14NUC-HC58 8531 2P BG14NUC-HC59 8532 2P BG14NUC-HC60 8533 2P BG14NUC-HC61 8534 2P BG14NUC-HC62 8535 2P BG14NUC-HC63 8536 2P BG14NUC-HC64 8537 2P BG14NUC-HC65 8538 RBD BG14NUC-HC66 8539 RBD BG14NUC-HC67 8540 RBD BG14NUC-HC68 8541 RBD BG14NUC-HC69 8542 RBD BG14NUC-HC70 8543 2F BG14NUC-HC71 8544 2P BG14NUC-HC72 8545 RBD BG14NUC-HC73 8546 RBD BG14NUC-HC74 8547 RBD BG14NUC-HC75 8548 2P BG14NUC-HC76 8549 RBD BG14NUC-HC77 8550 RBD BG14NUC-HC78 8551 RBD BG14NUC-HC79 8552 RBD BG14NUC-HC80 8553 RBD BG14NUC-HC81 8554 RBD BG14NUC-HC82 8555 RBD BG14NUC-HC83 8556 RBD BG14NUC-HC84 8557 RBD BG14NUC-HC85 8558 2P BG14NUC-HC86 8559 2P BG14NUC-HC87 8560 2P BG14NUC-HC88 8561 2F BG14NUC-HC89 8562 RBD BG14NUC-HC90 8563 RBD BG14NUC-HC91 8564 RBD BG14NUC-HC92 8565 2P BG14NUC-HC93 8566 2P BG14NUC-HC94 8567 2P BG14NUC-HC95 8568 RBD BG14NUC-HC96 8569 RBD BG14NUC-HC97 8570 RBD BG14NUC-HC98 8571 2P BG14NUC-HC99 8572 RBD BG14NUC-HC100 8573 RBD BG14NUC-HC101 8574 RBD BG14NUC-HC102 8575 2P BG14NUC-HC103 8576 RBD BG14NUC-HC104 8577 RBD BG14NUC-HC105 8578 RBD BG14NUC-HC106 8579 RBD BG14NUC-HC107 8580 RBD BG14NUC-HC108 8581 2P BG14NUC-HC109 8582 2F BG14NUC-HC110 8583 RBD BG14NUC-HC111 8584 RBD BG14NUC-HC112 8585 2P BG14NUC-HC113 8586 2P BG14NUC-HC114 8587 2P BG14NUC-HC115 8588 RBD BG14NUC-HC116 8589 RBD BG14NUC-HC117 8590 RBD BG14NUC-HC118 8591 RBD BG14NUC-HC119 8592 RBD BG14NUC-HC120 8593 2P BG14NUC-HC121 8594 2P BG14NUC-HC122 8595 RBD BG14NUC-HC123 8596 RBD BG14NUC-HC124 8597 RBD BG14NUC-HC125 8598 2P BG14NUC-HC126 8599 2P BG14NUC-HC127 8600 RBD BG14NUC-HC128 8601 RBD BG14NUC-HC129 8602 RBD BG14NUC-HC130 8603 2P BG14NUC-HC131 8604 2P BG14NUC-HC132 8605 RBD BG14NUC-HC133 8606 RBD BG14NUC-HC134 8607 RBD BG14NUC-HC135 8608 RBD BG14NUC-HC136 8609 RBD BG14NUC-HC137 8610 RBD BG14NUC-HC138 8611 RBD BG14NUC-HC139 8612 RBD BG14NUC-HC140 8613 2P BG14NUC-HC141 8614 2P BG14NUC-HC142 8615 RBD BG14NUC-HC143 8616 2P BG14NUC-HC144 8617 2P BG14NUC-HC145 8618 2P BG14NUC-HC146 8619 RBD BG14NUC-HC147 8620 RBD BG14NUC-HC148 8621 2P BG14NUC-HC149 8622 2P BG14NUC-HC150 8623 2P BG14NUC-HC151 8624 2P BG14NUC-HC152 8625 2F BG14NUC-HC153 8626 RBD BG14NUC-HC154 8627 2P BG14NUC-HC155 8628 2P BG14NUC-HC156 8629 RBD BG14NUC-HC157 8630 2P BG14NUC-HC158 8631 2P BG14NUC-HC159 8632 2P BG14NUC-HC160 8633 2P BG14NUC-HC161 8634 2P BG14NUC-HC162 8635 RBD BG14NUC-HC163 8636 RBD BG14NUC-HC164 8637 RBD BG14NUC-HC165 8638 2P BG14NUC-HC166 8639 2P BG14NUC-HC167 8640 2P BG14NUC-HC168 8641 2P BG14NUC-HC169 8642 RBD BG14NUC-HC170 8643 2P BG14NUC-HC171 8644 RBD BG14NUC-HC172 8645 2P BG14NUC-HC173 8646 2P BG14NUC-HC174 8647 2P BG14NUC-HC175 8648 RBD BG14NUC-HC176 8649 2P BG14NUC-HC177 8650 RBD BG14NUC-HC178 8651 2P BG14NUC-HC179 8652 2P BG14NUC-HC180 8653 2P BG14NUC-HC181 8654 2P BG14NUC-HC182 8655 2P BG14NUC-HC183 8656 RBD BG14NUC-HC184 8657 2P BG14NUC-HC185 8658 2P BG14NUC-HC186 8659 2P BG14NUC-HC187 8660 RBD BG14NUC-HC188 8661 2P BG14NUC-HC189 8662 2P BG14NUC-HC190 8663 2P BG14NUC-HC191 8664 RBD BG14NUC-HC192 8665 RBD BG14NUC-HC193 8666 RBD BG14NUC-HC194 8667 RBD BG14NUC-HC195 8668 RBD BG14NUC-HC196 8669 2P BG14NUC-HC197 8670 2P BG14NUC-HC198 8671 2P BG14NUC-HC199 8672 2P BG14NUC-HC200 8673 RBD BG14NUC-HC201 8674 RBD BG14NUC-HC202 8675 2P BG14NUC-HC203 8676 2P BG14NUC-HC204 8677 2P BG14NUC-HC205 8678 2P BG14NUC-HC206 8679 2P BG14NUC-HC207 8680 2P BG14NUC-HC208 8681 2P BG14NUC-HC209 8682 2P BG14NUC-HC210 8683 2P BG14NUC-HC211 8684 RBD BG14NUC-HC212 8685 2P BG14NUC-HC213 8686 2P BG14NUC-HC214 8687 RBD BG14NUC-HC215 8688 RBD BG14NUC-HC216 8689 2P BG14NUC-HC217 8690 2P BG14NUC-HC218 8691 2P BG14NUC-HC219 8692 RBD BG14NUC-HC220 8693 2P BG14NUC-HC221 8694 2P BG14NUC-HC222 8695 2P BG14NUC-HC223 8696 RBD BG14NUC-HC224 8697 2P BG14NUC-HC225 8698 RBD BG14NUC-HC226 8699 2P BG14NUC-HC227 8700 2F BG14NUC-HC228 8701 RBD BG14NUC-HC229 8702 RBD BG14NUC-HC230 8703 2P BG14NUC-HC231 8704 RBD BG14NUC-HC232 8705 2P BG14NUC-HC233 8706 2P BG14NUC-HC234 8707 2P BG14NUC-HC235 8708 2P BG14NUC-HC236 8709 2P BG14NUC-HC237 8710 2P BG14NUC-HC238 8711 2P BG14NUC-HC239 8712 2P BG14NUC-HC240 8713 2P BG14NUC-HC241 8714 2P BG14NUC-HC242 8715 2P BG14NUC-HC243 8716 2P BG14NUC-HC244 8717 2P BG14NUC-HC245 8718 2P BG14NUC-HC246 8719 2P BG14NUC-HC247 8720 2P BG14NUC-HC248 8721 2P BG14NUC-HC249 8722 RBD BG14NUC-HC250 8723 2P BG14NUC-HC251 8724 RBD BG14NUC-HC252 8725 RBD BG14NUC-HC253 8726 RBD BG14NUC-HC254 8727 RBD BG14NUC-HC255 8728 2P BG14NUC-HC256 8729 RBD BG14NUC-HC257 8730 2F BG14NUC-HC258 8731 2P BG14NUC-HC259 8732 RBD BG14NUC-HC260 8733 RBD BG14NUC-HC261 8734 RBD BG14NUC-HC262 8735 2P BG14NUC-HC263 8736 2P BG14NUC-HC264 8737 2P BG14NUC-HC265 8738 2P BG14NUC-HC266 8739 RBD BG14NUC-HC267 8740 2P BG14NUC-HC268 8741 RBD BG14NUC-HC269 8742 RBD BG14NUC-HC270 8743 2P BG14NUC-HC271 8744 RBD BG14NUC-HC272 8745 RBD BG14NUC-HC273 8746 RBD BG14NUC-HC274 8747 RBD BG14NUC-HC275 8748 RBD BG14NUC-HC276 8749 2P BG14NUC-HC277 8750 RBD BG14NUC-HC278 8751 2P BG14NUC-HC279 8752 2F BG14NUC-HC280 8753 RBD BG14NUC-HC281 8754 RBD BG14NUC-HC282 8755 2P BG14NUC-HC283 8756 RBD BG14NUC-HC284 8757 RBD BG14NUC-HC285 8758 2P BG14NUC-HC286 8759 RBD BG14NUC-HC287 8760 RBD BG14NUC-HC288 8761 2P BG14NUC-HC289 8762 RBD BG14NUC-HC290 8763 2P BG14NUC-HC291 8764 2P BG14NUC-HC292 8765 2P BG14NUC-HC293 8766 2P BG14NUC-HC294 8767 2P BG14NUC-HC295 8768 2P BG14NUC-HC296 8769 2P BG14NUC-HC297 8770 2P BG14NUC-HC298 8771 RBD BG14NUC-HC299 8772 RBD BG14NUC-HC300 8773 RBD BG14NUC-HC301 8774 2P BG14NUC-HC302 8775 RBD BG14NUC-HC303 8776 2P BG14NUC-HC304 8777 RBD BG14NUC-HC305 8778 RBD BG14NUC-HC306 8779 2P BG14NUC-HC307 8780 2F BG14NUC-HC308 8781 2P BG14NUC-HC309 8782 2P BG14NUC-HC310 8783 2P BG14NUC-HC311 8784 2P BG14NUC-HC312 8785 RBD BG14NUC-HC313 8786 2P BG14NUC-HC314 8787 2P BG14NUC-HC315 8788 2P BG14NUC-HC316 8789 RBD BG14NUC-HC317 8790 RBD BG14NUC-HC318 8791 RBD BG14NUC-HC319 8792 RBD BG14NUC-HC320 8793 2P BG14NUC-HC321 8794 RBD BG14NUC-HC322 8795 RBD BG14NUC-HC323 8796 RBD BG14NUC-HC324 8797 2P BG14NUC-HC325 8798 2F BG14NUC-HC326 8799 2P BG14NUC-HC327 8800 RBD BG14NUC-HC328 8801 RBD BG14NUC-HC329 8802 RBD BG14NUC-HC330 8803 2P BG14NUC-HC331 8804 RBD BG14NUC-HC332 8805 RBD BG14NUC-HC333 8806 RBD BG14NUC-HC334 8807 2F BG14NUC-HC335 8808 2P BG14NUC-HC336 8809 2P BG14NUC-HC337 8810 2P BG14NUC-HC338 8811 RBD BG14NUC-HC339 8812 2P BG14NUC-HC340 8813 RBD BG14NUC-HC341 8814 RBD BG14NUC-HC342 8815 2F BG14NUC-HC343 8816 2P BG14NUC-HC344 8817 RBD BG14NUC-HC345 8818 RBD BG14NUC-HC346 8819 RBD BG14NUC-HC347 8820 RBD BG14NUC-HC348 8821 2P BG14NUC-HC349 8822 2F BG14NUC-HC350 8823 2P BG14NUC-HC351 8824 RBD BG14NUC-HC352 8825 RBD BG14NUC-HC353 8826 RBD BG14NUC-HC354 8827 2F BG14NUC-HC355 8828 2F BG14NUC-HC356 8829 2F BG14NUC-HC357 8830 2P BG14NUC-HC358 8831 2P BG14NUC-HC359 8832 2P BG14NUC-HC360 8833 2P BG14NUC-HC361 8834 2P BG14NUC-HC362 8835 RBD BG14NUC-HC363 8836 RBD BG14NUC-HC364 8837 2F BG14NUC-HC365 8838 2F BG14NUC-HC366 8839 2P BG14NUC-HC367 8840 2P BG14NUC-HC368 8841 2P BG14NUC-HC369 8842 RBD BG14NUC-HC370 8843 2P BG14NUC-HC371 8844 2P BG14NUC-HC372 8845 RBD BG14NUC-HC373 8846 2P BG14NUC-HC374 8847 2P BG14NUC-HC375 8848 RBD BG14NUC-HC376 8849 RBD BG14NUC-HC377 8850 RBD BG14NUC-HC378 8851 2P BG14NUC-HC379 8852 RBD BG14NUC-HC380 8853 2P BG14NUC-HC381 8854 RBD BG14NUC-HC382 8855 RBD BG14NUC-HC383 8856 RBD BG14NUC-HC384 8857 RBD BG14NUC-HC385 8858 RBD BG14NUC-HC386 8859 2P BG14NUC-HC387 8860 2F BG14NUC-HC388 8861 2P BG14NUC-HC389 8862 2P BG14NUC-HC390 8863 RBD BG14NUC-HC391 8864 2P BG14NUC-HC392 8865 2P BG14NUC-HC393 8866 2P BG14NUC-HC394 8867 2P BG14NUC-HC395 8868 2P BG14NUC-HC396 8869 2P BG14NUC-HC397 8870 2P BG14NUC-HC398 8871 2P BG14NUC-HC399 8872 RBD BG14NUC-HC400 8873 2P BG14NUC-HC401 8874 2P BG14NUC-HC402 8875 2P BG14NUC-HC403 8876 2P BG14NUC-HC404 8877 2P BG14NUC-HC405 8878 RBD BG14NUC-HC406 8879 2F BG14NUC-HC407 8880 2P BG14NUC-HC408 8881 RBD BG14NUC-HC409 8882 RBD BG14NUC-HC410 8883 2P BG14NUC-HC411 8884 2P BG14NUC-HC412 8885 2P BG14NUC-HC413 8886 2P BG14NUC-HC414 8887 2P BG14NUC-HC415 8888 RBD BG14NUC-HC416 8889 2P BG14NUC-HC417 8890 2P BG14NUC-HC418 8891 RBD BG14NUC-HC419 8892 RBD BG14NUC-HC420 8893 2P BG14NUC-HC421 8894 2P BG14NUC-HC422 8895 2P BG14NUC-HC423 8896 RBD BG14NUC-HC424 8897 2P BG14NUC-HC425 8898 2P BG14NUC-HC426 8899 RBD BG14NUC-HC427 8900 RBD BG14NUC-HC428 8901 2F BG14NUC-HC429 8902 RBD BG14NUC-HC430 8903 2P BG14NUC-HC431 8904 RBD BG14NUC-HC432 8905 2P BG14NUC-HC433 8906 RBD BG14NUC-HC434 8907 RBD BG14NUC-HC435 8908 2P BG14NUC-HC436 8909 RBD BG14NUC-HC437 8910 RBD BG14NUC-HC438 8911 RBD BG14NUC-HC439 8912 RBD BG14NUC-HC440 8913 2P BG14NUC-HC441 8914 2P BG14NUC-HC442 8915 RBD BG14NUC-HC443 8916 RBD BG14NUC-HC444 8917 2P BG14NUC-HC445 8918 RBD BG14NUC-HC446 8919 2P BG14NUC-HC447 8920 2P BG14NUC-HC448 8921 2P BG14NUC-HC449 8922 RBD BG14NUC-HC450 8923 RBD BG14NUC-HC451 8924 RBD BG14NUC-HC452 8925 RBD BG14NUC-HC453 8926 2P BG14NUC-HC454 8927 RBD BG14NUC-HC455 8928 RBD BG14NUC-HC456 8929 RBD BG14NUC-HC457 8930 2P BG14NUC-HC458 8931 2P BG14NUC-HC459 8932 RBD BG14NUC-HC460 8933 2P BG14NUC-HC461 8934 RBD BG14NUC-HC462 8935 2P BG14NUC-HC463 8936 RBD BG14NUC-HC464 8937 RBD BG14NUC-HC465 8938 RBD BG14NUC-HC466 8939 RBD BG14NUC-HC467 8940 2P BG14NUC-HC468 8941 2P BG14NUC-HC469 8942 RBD BG14NUC-HC470 8943 2P BG14NUC-HC471 8944 2P BG14NUC-HC472 8945 RBD BG14NUC-HC473 8946 2P BG14NUC-HC474 8947 RBD BG14NUC-HC475 8948 RBD BG14NUC-HC476 8949 2P BG14NUC-HC477 8950 2P BG14NUC-HC478 8951 RBD BG14NUC-HC479 8952 RBD BG14NUC-HC480 8953 RBD BG14NUC-HC481 8954 2P BG14NUC-HC482 8955 2P BG14NUC-HC483 8956 2P BG14NUC-HC484 8957 2P BG14NUC-HC485 8958 2P BG14NUC-HC486 8959 2P BG14NUC-HC487 8960 2P BG14NUC-HC488 8961 RBD BG14NUC-HC489 8962 2P BG14NUC-HC490 8963 RBD BG14NUC-HC491 8964 RBD BG14NUC-HC492 8965 2P BG14NUC-HC493 8966 2P BG14NUC-HC494 8967 2P BG14NUC-HC495 8968 RBD BG14NUC-HC496 8969 RBD BG14NUC-HC497 8970 2P BG14NUC-HC498 8971 RBD BG14NUC-HC499 8972 RBD BG14NUC-HC500 8973 RBD BG14NUC-HC501 8974 RBD BG14NUC-HC502 8975 RBD BG14NUC-HC503 8976 RBD BG14NUC-HC504 8977 2P BG14NUC-HC505 8978 2P BG14NUC-HC506 8979 2P BG14NUC-HC507 8980 RBD BG14NUC-HC508 8981 RBD BG14NUC-HC509 8982 RBD BG14NUC-HC510 8983 RBD BG14NUC-HC511 8984 2P BG14NUC-HC512 8985 RBD BG14NUC-HC513 8986 2P BG14NUC-HC514 8987 2P BG14NUC-HC515 8988 RBD BG14NUC-HC516 8989 2P BG14NUC-HC517 8990 RBD BG14NUC-HC518 8991 2P BG14NUC-HC519 8992 RBD BG14NUC-HC520 8993 RBD BG14NUC-HC521 8994 RBD BG14NUC-HC522 8995 2P BG14NUC-HC523 8996 RBD BG14NUC-HC524 8997 2P BG14NUC-HC525 8998 2P BG14NUC-HC526 8999 2P BG14NUC-HC527 9000 2P BG14NUC-HC528 9001 2P BG14NUC-HC529 9002 2P BG14NUC-HC530 9003 RBD BG14NUC-HC531 9004 RBD BG14NUC-HC532 9005 RBD BG14NUC-HC533 9006 2P BG14NUC-HC534 9007 2P BG14NUC-HC535 9008 RBD BG14NUC-LC1 9009 RBD BG14NUC-LC2 9010 RBD BG14NUC-LC3 9011 RBD BG14NUC-LC4 9012 RBD BG14NUC-LC5 9013 RBD BG14NUC-LC6 9014 RBD BG14NUC-LC7 9015 RBD BG14NUC-LC8 9016 RBD BG14NUC-LC9 9017 RBD BG14NUC-LC10 9018 RBD BG14NUC-LC11 9019 RBD BG14NUC-LC12 9020 RBD BG14NUC-LC13 9021 RBD BG14NUC-LC14 9022 RBD BG14NUC-LC15 9023 RBD BG14NUC-LC16 9024 RBD BG14NUC-LC17 9025 RBD BG14NUC-LC18 9026 RBD BG14NUC-LC19 9027 RBD BG14NUC-LC20 9028 RBD BG14NUC-LC21 9029 RBD BG14NUC-LC22 9030 RBD BG14NUC-LC23 9031 RBD BG14NUC-LC24 9032 RBD BG14NUC-LC25 9033 2P BG14NUC-LC26 9034 2P BG14NUC-LC27 9035 2P BG14NUC-LC28 9036 2P BG14NUC-LC29 9037 2P BG14NUC-LC30 9038 2P BG14NUC-LC31 9039 2P BG14NUC-LC32 9040 2P BG14NUC-LC33 9041 2P BG14NUC-LC34 9042 2P BG14NUC-LC35 9043 2P BG14NUC-LC36 9044 2P BG14NUC-LC37 9045 2P BG14NUC-LC38 9046 2P BG14NUC-LC39 9047 2P BG14NUC-LC40 9048 2P BG14NUC-LC41 9049 2P BG14NUC-LC42 9050 2P BG14NUC-LC43 9051 2P BG14NUC-LC44 9052 2P BG14NUC-LC45 9053 2P BG14NUC-LC46 9054 2P BG14NUC-LC47 9055 2P BG14NUC-LC48 9056 2P BG14NUC-LC49 9057 RBD BG14NUC-LC50 9058 RBD BG14NUC-LC51 9059 RBD BG14NUC-LC52 9060 RBD BG14NUC-LC53 9061 RBD BG14NUC-LC54 9062 RBD BG14NUC-LC55 9063 RBD BG14NUC-LC56 9064 RBD BG14NUC-LC57 9065 RBD BG14NUC-LC58 9066 2P BG14NUC-LC59 9067 2P BG14NUC-LC60 9068 2P BG14NUC-LC61 9069 2P BG14NUC-LC62 9070 2P BG14NUC-LC63 9071 2P BG14NUC-LC64 9072 2P BG14NUC-LC65 9073 RBD BG14NUC-LC66 9074 RBD BG14NUC-LC67 9075 RBD BG14NUC-LC68 9076 RBD BG14NUC-LC69 9077 RBD BG14NUC-LC70 9078 2P BG14NUC-LC71 9079 2P BG14NUC-LC72 9080 RBD BG14NUC-LC73 9081 RBD BG14NUC-LC74 9082 RBD BG14NUC-LC75 9083 2P BG14NUC-LC76 9084 RBD BG14NUC-LC77 9085 RBD BG14NUC-LC78 9086 RBD BG14NUC-LC79 9087 RBD BG14NUC-LC80 9088 RBD BG14NUC-LC81 9089 RBD BG14NUC-LC82 9090 RBD BG14NUC-LC83 9091 RBD BG14NUC-LC84 9092 RBD BG14NUC-LC85 9093 2P BG14NUC-LC86 9094 2P BG14NUC-LC87 9095 2P BG14NUC-LC88 9096 2P BG14NUC-LC89 9097 RBD BG14NUC-LC90 9098 RBD BG14NUC-LC91 9099 RBD BG14NUC-LC92 9100 2P BG14NUC-LC93 9101 2P BG14NUC-LC94 9102 2P BG14NUC-LC95 9103 RBD BG14NUC-LC96 9104 RBD BG14NUC-LC97 9105 RBD BG14NUC-LC98 9106 2P BG14NUC-LC99 9107 RBD BG14NUC-LC100 9108 RBD BG14NUC-LC101 9109 RBD BG14NUC-LC102 9110 2P BG14NUC-LC103 9111 RBD BG14NUC-LC104 9112 RBD BG14NUC-LC105 9113 RBD BG14NUC-LC106 9114 RBD BG14NUC-LC107 9115 RBD BG14NUC-LC108 9116 2P BG14NUC-LC109 9117 2P BG14NUC-LC110 9118 RBD BG14NUC-LC111 9119 RBD BG14NUC-LC112 9120 2P BG14NUC-LC113 9121 2P BG14NUC-LC114 9122 2P BG14NUC-LC115 9123 RBD BG14NUC-LC116 9124 RBD BG14NUC-LC117 9125 RBD BG14NUC-LC118 9126 RBD BG14NUC-LC119 9127 RBD BG14NUC-LC120 9128 2P BG14NUC-LC121 9129 2P BG14NUC-LC122 9130 RBD BG14NUC-LC123 9131 RBD BG14NUC-LC124 9132 RBD BG14NUC-LC125 9133 2P BG14NUC-LC126 9134 2P BG14NUC-LC127 9135 RBD BG14NUC-LC128 9136 RBD BG14NUC-LC129 9137 RBD BG14NUC-LC130 9138 2P BG14NUC-LC131 9139 2P BG14NUC-LC132 9140 RBD BG14NUC-LC133 9141 RBD BG14NUC-LC134 9142 RBD BG14NUC-LC135 9143 RBD BG14NUC-LC136 9144 RBD BG14NUC-LC137 9145 RBD BG14NUC-LC138 9146 RBD BG14NUC-LC139 9147 RBD BG14NUC-LC140 9148 2P BG14NUC-LC141 9149 2P BG14NUC-LC142 9150 RBD BG14NUC-LC143 9151 2P BG14NUC-LC144 9152 2P BG14NUC-LC145 9153 2P BG14NUC-LC146 9154 RBD BG14NUC-LC147 9155 RBD BG14NUC-LC148 9156 2P BG14NUC-LC149 9157 2P BG14NUC-LC150 9158 2P BG14NUC-LC151 9159 2P BG14NUC-LC152 9160 2P BG14NUC-LC153 9161 RBD BG14NUC-LC154 9162 2P BG14NUC-LC155 9163 2P BG14NUC-LC156 9164 RBD BG14NUC-LC157 9165 2P BG14NUC-LC158 9166 2P BG14NUC-LC159 9167 2P BG14NUC-LC160 9168 2P BG14NUC-LC161 9169 2P BG14NUC-LC162 9170 RBD BG14NUC-LC163 9171 RBD BG14NUC-LC164 9172 RBD BG14NUC-LC165 9173 2P BG14NUC-LC166 9174 2P BG14NUC-LC167 9175 2P BG14NUC-LC168 9176 2P BG14NUC-LC169 9177 RBD BG14NUC-LC170 9178 2P BG14NUC-LC171 9179 RBD BG14NUC-LC172 9180 2P BG14NUC-LC173 9181 2P BG14NUC-LC174 9182 2P BG14NUC-LC175 9183 RBD BG14NUC-LC176 9184 2P BG14NUC-LC177 9185 RBD BG14NUC-LC178 9186 2P BG14NUC-LC179 9187 2P BG14NUC-LC180 9188 2P BG14NUC-LC181 9189 2P BG14NUC-LC182 9190 2P BG14NUC-LC183 9191 RBD BG14NUC-LC184 9192 2P BG14NUC-LC185 9193 2P BG14NUC-LC186 9194 2P BG14NUC-LC187 9195 RBD BG14NUC-LC188 9196 2P BG14NUC-LC189 9197 2P BG14NUC-LC190 9198 2P BG14NUC-LC191 9199 RBD BG14NUC-LC192 9200 RBD BG14NUC-LC193 9201 RBD BG14NUC-LC194 9202 RBD BG14NUC-LC195 9203 RBD BG14NUC-LC196 9204 2P BG14NUC-LC197 9205 2P BG14NUC-LC198 9206 2P BG14NUC-LC199 9207 2P BG14NUC-LC200 9208 RBD BG14NUC-LC201 9209 RBD BG14NUC-LC202 9210 2P BG14NUC-LC203 9211 2P BG14NUC-LC204 9212 2P BG14NUC-LC205 9213 2P BG14NUC-LC206 9214 2P BG14NUC-LC207 9215 2P BG14NUC-LC208 9216 2P BG14NUC-LC209 9217 2P BG14NUC-LC210 9218 2P BG14NUC-LC211 9219 RBD BG14NUC-LC212 9220 2P BG14NUC-LC213 9221 2P BG14NUC-LC214 9222 RBD BG14NUC-LC215 9223 RBD BG14NUC-LC216 9224 2P BG14NUC-LC217 9225 2P BG14NUC-LC218 9226 2P BG14NUC-LC219 9227 RBD BG14NUC-LC220 9228 2P BG14NUC-LC221 9229 2P BG14NUC-LC222 9230 2P BG14NUC-LC223 9231 RBD BG14NUC-LC224 9232 2P BG14NUC-LC225 9233 RBD BG14NUC-LC226 9234 2P BG14NUC-LC227 9235 2P BG14NUC-LC228 9236 RBD BG14NUC-LC229 9237 RBD BG14NUC-LC230 9238 2P BG14NUC-LC231 9239 RBD BG14NUC-LC232 9240 2P BG14NUC-LC233 9241 2P BG14NUC-LC234 9242 2P BG14NUC-LC235 9243 2P BG14NUC-LC236 9244 2P BG14NUC-LC237 9245 2P BG14NUC-LC238 9246 2P BG14NUC-LC239 9247 2P BG14NUC-LC240 9248 2P BG14NUC-LC241 9249 2P BG14NUC-LC242 9250 2P BG14NUC-LC243 9251 2P BG14NUC-LC244 9252 2P BG14NUC-LC245 9253 2P BG14NUC-LC246 9254 2P BG14NUC-LC247 9255 2P BG14NUC-LC248 9256 2P BG14NUC-LC249 9257 RBD BG14NUC-LC250 9258 2P BG14NUC-LC251 9259 RBD BG14NUC-LC252 9260 RBD BG14NUC-LC253 9261 RBD BG14NUC-LC254 9262 RBD BG14NUC-LC255 9263 2P BG14NUC-LC256 9264 RBD BG14NUC-LC257 9265 2P BG14NUC-LC258 9266 2P BG14NUC-LC259 9267 RBD BG14NUC-LC260 9268 RBD BG14NUC-LC261 9269 RBD BG14NUC-LC262 9270 2P BG14NUC-LC263 9271 2P BG14NUC-LC264 9272 2P BG14NUC-LC265 9273 2P BG14NUC-LC266 9274 RBD BG14NUC-LC267 9275 2P BG14NUC-LC268 9276 RBD BG14NUC-LC269 9277 RBD BG14NUC-LC270 9278 2P BG14NUC-LC271 9279 RBD BG14NUC-LC272 9280 RBD BG14NUC-LC273 9281 RBD BG14NUC-LC274 9282 RBD BG14NUC-LC275 9283 RBD BG14NUC-LC276 9284 2P BG14NUC-LC277 9285 RBD BG14NUC-LC278 9286 2P BG14NUC-LC279 9287 2P BG14NUC-LC280 9288 RBD BG14NUC-LC281 9289 RBD BG14NUC-LC282 9290 2P BG14NUC-LC283 9291 RBD BG14NUC-LC284 9292 RBD BG14NUC-LC285 9293 2P BG14NUC-LC286 9294 RBD BG14NUC-LC287 9295 RBD BG14NUC-LC288 9296 2P BG14NUC-LC289 9297 RBD BG14NUC-LC290 9298 2P BG14NUC-LC291 9299 2P BG14NUC-LC292 9300 2P BG14NUC-LC293 9301 2P BG14NUC-LC294 9302 2P BG14NUC-LC295 9303 2P BG14NUC-LC296 9304 2P BG14NUC-LC297 9305 2P BG14NUC-LC298 9306 RBD BG14NUC-LC299 9307 RBD BG14NUC-LC300 9308 RBD BG14NUC-LC301 9309 2P BG14NUC-LC302 9310 RBD BG14NUC-LC303 9311 2P BG14NUC-LC304 9312 RBD BG14NUC-LC305 9313 RBD BG14NUC-LC306 9314 2P BG14NUC-LC307 9315 2P BG14NUC-LC308 9316 2P BG14NUC-LC309 9317 2P BG14NUC-LC310 9318 2P BG14NUC-LC311 9319 2P BG14NUC-LC312 9320 RBD BG14NUC-LC313 9321 2P BG14NUC-LC314 9322 2P BG14NUC-LC315 9323 2P BG14NUC-LC316 9324 RBD BG14NUC-LC317 9325 RBD BG14NUC-LC318 9326 RBD BG14NUC-LC319 9327 RBD BG14NUC-LC320 9328 2P BG14NUC-LC321 9329 RBD BG14NUC-LC322 9330 RBD BG14NUC-LC323 9331 RBD BG14NUC-LC324 9332 2P BG14NUC-LC325 9333 2P BG14NUC-LC326 9334 2P BG14NUC-LC327 9335 RBD BG14NUC-LC328 9336 RBD BG14NUC-LC329 9337 RBD BG14NUC-LC330 9338 2P BG14NUC-LC331 9339 RBD BG14NUC-LC332 9340 RBD BG14NUC-LC333 9341 RBD BG14NUC-LC334 9342 2P BG14NUC-LC335 9343 2P BG14NUC-LC336 9344 2P BG14NUC-LC337 9345 2P BG14NUC-LC338 9346 RBD BG14NUC-LC339 9347 2P BG14NUC-LC340 9348 RBD BG14NUC-LC341 9349 RBD BG14NUC-LC342 9350 2P BG14NUC-LC343 9351 2P BG14NUC-LC344 9352 RBD BG14NUC-LC345 9353 RBD BG14NUC-LC346 9354 RBD BG14NUC-LC347 9355 RBD BG14NUC-LC348 9356 2P BG14NUC-LC349 9357 2P BG14NUC-LC350 9358 2P BG14NUC-LC351 9359 RBD BG14NUC-LC352 9360 RBD BG14NUC-LC353 9361 RBD BG14NUC-LC354 9362 2P BG14NUC-LC355 9363 2P BG14NUC-LC356 9364 2P BG14NUC-LC357 9365 2P BG14NUC-LC358 9366 2P BG14NUC-LC359 9367 2P BG14NUC-LC360 9368 2P BG14NUC-LC361 9369 2P BG14NUC-LC362 9370 RBD BG14NUC-LC363 9371 RBD BG14NUC-LC364 9372 2P BG14NUC-LC365 9373 2P BG14NUC-LC366 9374 2P BG14NUC-LC367 9375 2P BG14NUC-LC368 9376 2P BG14NUC-LC369 9377 RBD BG14NUC-LC370 9378 2P BG14NUC-LC371 9379 2P BG14NUC-LC372 9380 RBD BG14NUC-LC373 9381 2P BG14NUC-LC374 9382 2P BG14NUC-LC375 9383 RBD BG14NUC-LC376 9384 RBD BG14NUC-LC377 9385 RBD BG14NUC-LC378 9386 2P BG14NUC-LC379 9387 RBD BG14NUC-LC380 9388 2P BG14NUC-LC381 9389 RBD BG14NUC-LC382 9390 RBD BG14NUC-LC383 9391 RBD BG14NUC-LC384 9392 RBD BG14NUC-LC385 9393 RBD BG14NUC-LC386 9394 2P BG14NUC-LC387 9395 2P BG14NUC-LC388 9396 2P BG14NUC-LC389 9397 2P BG14NUC-LC390 9398 RBD BG14NUC-LC391 9399 2P BG14NUC-LC392 9400 2P BG14NUC-LC393 9401 2P BG14NUC-LC394 9402 2P BG14NUC-LC395 9403 2P BG14NUC-LC396 9404 2P BG14NUC-LC397 9405 2P BG14NUC-LC398 9406 2P BG14NUC-LC399 9407 RBD BG14NUC-LC400 9408 2P BG14NUC-LC401 9409 2P BG14NUC-LC402 9410 2P BG14NUC-LC403 9411 2P BG14NUC-LC404 9412 2P BG14NUC-LC405 9413 RBD BG14NUC-LC406 9414 2P BG14NUC-LC407 9415 2P BG14NUC-LC408 9416 RBD BG14NUC-LC409 9417 RBD BG14NUC-LC410 9418 2P BG14NUC-LC411 9419 2P BG14NUC-LC412 9420 2P BG14NUC-LC413 9421 2P BG14NUC-LC414 9422 2P BG14NUC-LC415 9423 RBD BG14NUC-LC416 9424 2P BG14NUC-LC417 9425 2P BG14NUC-LC418 9426 RBD BG14NUC-LC419 9427 RBD BG14NUC-LC420 9428 2P BG14NUC-LC421 9429 2P BG14NUC-LC422 9430 2P BG14NUC-LC423 9431 RBD BG14NUC-LC424 9432 2P BG14NUC-LC425 9433 2P BG14NUC-LC426 9434 RBD BG14NUC-LC427 9435 RBD BG14NUC-LC428 9436 2P BG14NUC-LC429 9437 RBD BG14NUC-LC430 9438 2P BG14NUC-LC431 9439 RBD BG14NUC-LC432 9440 2P BG14NUC-LC433 9441 RBD BG14NUC-LC434 9442 RBD BG14NUC-LC435 9443 2P BG14NUC-LC436 9444 RBD BG14NUC-LC437 9445 RBD BG14NUC-LC438 9446 RBD BG14NUC-LC439 9447 RBD BG14NUC-LC440 9448 2P BG14NUC-LC441 9449 2P BG14NUC-LC442 9450 RBD BG14NUC-LC443 9451 RBD BG14NUC-LC444 9452 2P BG14NUC-LC445 9453 RBD BG14NUC-LC446 9454 2P BG14NUC-LC447 9455 2P BG14NUC-LC448 9456 2P BG14NUC-LC449 9457 RBD BG14NUC-LC450 9458 RBD BG14NUC-LC451 9459 RBD BG14NUC-LC452 9460 RBD BG14NUC-LC453 9461 2P BG14NUC-LC454 9462 RBD BG14NUC-LC455 9463 RBD BG14NUC-LC456 9464 RBD BG14NUC-LC457 9465 2P BG14NUC-LC458 9466 2P BG14NUC-LC459 9467 RBD BG14NUC-LC460 9468 2P BG14NUC-LC461 9469 RBD BG14NUC-LC462 9470 2P BG14NUC-LC463 9471 RBD BG14NUC-LC464 9472 RBD BG14NUC-LC465 9473 RBD BG14NUC-LC466 9474 RBD BG14NUC-LC467 9475 2P BG14NUC-LC468 9476 2P BG14NUC-LC469 9477 RBD BG14NUC-LC470 9478 2P BG14NUC-LC471 9479 2P BG14NUC-LC472 9480 RBD BG14NUC-LC473 9481 2P BG14NUC-LC474 9482 RBD BG14NUC-LC475 9483 RBD BG14NUC-LC476 9484 2P BG14NUC-LC477 9485 2P BG14NUC-LC478 9486 RBD BG14NUC-LC479 9487 RBD BG14NUC-LC480 9488 RBD BG14NUC-LC481 9489 2P BG14NUC-LC482 9490 2P BG14NUC-LC483 9491 2P BG14NUC-LC484 9492 2P BG14NUC-LC485 9493 2P BG14NUC-LC486 9494 2P BG14NUC-LC487 9495 2P BG14NUC-LC488 9496 RBD BG14NUC-LC489 9497 2P BG14NUC-LC490 9498 RBD BG14NUC-LC491 9499 RBD BG14NUC-LC492 9500 2P BG14NUC-LC493 9501 2P BG14NUC-LC494 9502 2P BG14NUC-LC495 9503 RBD BG14NUC-LC496 9504 RBD BG14NUC-LC497 9505 2P BG14NUC-LC498 9506 RBD BG14NUC-LC499 9507 RBD BG14NUC-LC500 9508 RBD BG14NUC-LC501 9509 RBD BG14NUC-LC502 9510 RBD BG14NUC-LC503 9511 RBD BG14NUC-LC504 9512 2P BG14NUC-LC505 9513 2P BG14NUC-LC506 9514 2P BG14NUC-LC507 9515 RBD BG14NUC-LC508 9516 RBD BG14NUC-LC509 9517 RBD BG14NUC-LC510 9518 RBD BG14NUC-LC511 9519 2P BG14NUC-LC512 9520 RBD BG14NUC-LC513 9521 2P BG14NUC-LC514 9522 2P BG14NUC-LC515 9523 RBD BG14NUC-LC516 9524 2P BG14NUC-LC517 9525 RBD BG14NUC-LC518 9526 2P BG14NUC-LC519 9527 RBD BG14NUC-LC520 9528 RBD BG14NUC-LC521 9529 RBD BG14NUC-LC522 9530 2P BG14NUC-LC523 9531 RBD BG14NUC-LC524 9532 2P BG14NUC-LC525 9533 2P BG14NUC-LC526 9534 2P BG14NUC-LC527 9535 2P BG14NUC-LC528 9536 2P BG14NUC-LC529 9537 2P BG14NUC-LC530 9538 RBD BG14NUC-LC531 9539 RBD BG14NUC-LC532 9540 RBD BG14NUC-LC533 9541 2P BG14NUC-LC534 9542 2P BG14NUC-LC535 9543 2P BG18NUC-HC1 9544 2P BG18NUC-HC2 9545 RBD BG18NUC-HC3 9546 2P BG18NUC-HC4 9547 2P BG18NUC-HC5 9548 RBD BG18NUC-HC6 9549 2P BG18NUC-HC7 9550 2P BG18NUC-HC8 9551 RBD BG18NUC-HC9 9552 2P BG18NUC-HC10 9553 2P BG18NUC-HC11 9554 2P BG18NUC-HC12 9555 2P BG18NUC-HC13 9556 2P BG18NUC-HC14 9557 2P BG18NUC-HC15 9558 2P BG18NUC-HC16 9559 RBD BG18NUC-HC17 9560 2P BG18NUC-HC18 9561 2P BG18NUC-HC19 9562 RBD BG18NUC-HC20 9563 2P BG18NUC-HC21 9564 RBD BG18NUC-HC22 9565 2P BG18NUC-HC23 9566 2P BG18NUC-HC24 9567 2P BG18NUC-HC25 9568 2P BG18NUC-HC26 9569 2P BG18NUC-HC27 9570 2P BG18NUC-HC28 9571 2P BG18NUC-HC29 9572 2P BG18NUC-HC30 9573 RBD BG18NUC-HC31 9574 RBD BG18NUC-HC32 9575 RBD BG18NUC-HC33 9576 2P BG18NUC-HC34 9577 2P BG18NUC-HC35 9578 2F BG18NUC-HC36 9579 2P BG18NUC-HC37 9580 2P BG18NUC-HC38 9581 2P BG18NUC-HC39 9582 2P BG18NUC-HC40 9583 RBD BG18NUC-HC41 9584 RBD BG18NUC-HC42 9585 2P BG18NUC-HC43 9586 2P BG18NUC-HC44 9587 2P BG18NUC-HC45 9588 RBD BG18NUC-HC46 9589 2P BG18NUC-HC47 9590 2P BG18NUC-HC48 9591 2P BG18NUC-HC49 9592 2P BG18NUC-HC50 9593 2P BG18NUC-HC51 9594 2P BG18NUC-HC52 9595 2P BG18NUC-HC53 9596 RBD BG18NUC-HC54 9597 2P BG18NUC-HC55 9598 2P BG18NUC-HC56 9599 2P BG18NUC-HC57 9600 2P BG18NUC-HC58 9601 RBD BG18NUC-HC59 9602 2P BG18NUC-HC60 9603 2P BG18NUC-HC61 9604 2P BG18NUC-HC62 9605 RBD BG18NUC-HC63 9606 RBD BG18NUC-HC64 9607 2P BG18NUC-HC65 9608 2P BG18NUC-HC66 9609 2P BG18NUC-HC67 9610 2P BG18NUC-HC68 9611 RBD BG18NUC-HC69 9612 2P BG18NUC-HC70 9613 RBD BG18NUC-HC71 9614 2P BG18NUC-HC72 9615 2P BG18NUC-HC73 9616 2P BG18NUC-HC74 9617 2P BG18NUC-HC75 9618 2P BG18NUC-HC76 9619 RBD BG18NUC-HC77 9620 RBD BG18NUC-HC78 9621 2P BG18NUC-HC79 9622 2P BG18NUC-HC80 9623 2P BG18NUC-HC81 9624 2P BG18NUC-HC82 9625 2P BG18NUC-HC83 9626 2P BG18NUC-HC84 9627 2P BG18NUC-HC85 9628 2P BG18NUC-HC86 9629 2P BG18NUC-HC87 9630 2P BG18NUC-HC88 9631 2P BG18NUC-HC89 9632 2P BG18NUC-HC90 9633 RBD BG18NUC-HC91 9634 RBD BG18NUC-HC92 9635 2P BG18NUC-HC93 9636 2P BG18NUC-HC94 9637 2P BG18NUC-HC95 9638 RBD BG18NUC-HC96 9639 2P BG18NUC-HC97 9640 2P BG18NUC-HC98 9641 2P BG18NUC-HC99 9642 2P BG18NUC-HC100 9643 RBD BG18NUC-HC101 9644 2P BG18NUC-HC102 9645 RBD BG18NUC-HC103 9646 RBD BG18NUC-HC104 9647 2P BG18NUC-HC105 9648 RBD BG18NUC-HC106 9649 RBD BG18NUC-HC107 9650 2P BG18NUC-HC108 9651 2P BG18NUC-HC109 9652 RBD BG18NUC-HC110 9653 2P BG18NUC-HC111 9654 2P BG18NUC-HC112 9655 2P BG18NUC-HC113 9656 2P BG18NUC-HC114 9657 2P BG18NUC-HC115 9658 RBD BG18NUC-HC116 9659 2P BG18NUC-HC117 9660 2P BG18NUC-HC118 9661 2P BG18NUC-HC119 9662 2P BG18NUC-HC120 9663 2P BG18NUC-HC121 9664 2P BG18NUC-HC122 9665 2P BG18NUC-HC123 9666 2P BG18NUC-HC124 9667 2P BG18NUC-HC125 9668 2P BG18NUC-HC126 9669 2P BG18NUC-HC127 9670 2P BG18NUC-HC128 9671 2P BG18NUC-HC129 9672 2P BG18NUC-HC130 9673 2P BG18NUC-HC131 9674 RBD BG18NUC-HC132 9675 2P BG18NUC-HC133 9676 RBD BG18NUC-HC134 9677 2P BG18NUC-HC135 9678 2P BG18NUC-HC136 9679 RBD BG18NUC-HC137 9680 2P BG18NUC-HC138 9681 RBD BG18NUC-HC139 9682 RBD BG18NUC-HC140 9683 RBD BG18NUC-HC141 9684 2P BG18NUC-HC142 9685 2P BG18NUC-HC143 9686 2P BG18NUC-HC144 9687 2P BG18NUC-HC145 9688 2P BG18NUC-HC146 9689 2P BG18NUC-HC147 9690 2P BG18NUC-HC148 9691 2P BG18NUC-HC149 9692 2P BG18NUC-HC150 9693 2P BG18NUC-HC151 9694 2P BG18NUC-HC152 9695 2P BG18NUC-HC153 9696 2P BG18NUC-HC154 9697 RBD BG18NUC-HC155 9698 2P BG18NUC-HC156 9699 2P BG18NUC-HC157 9700 2P BG18NUC-HC158 9701 2P BG18NUC-HC159 9702 2P BG18NUC-HC160 9703 2P BG18NUC-HC161 9704 2P BG18NUC-HC162 9705 RBD BG18NUC-HC163 9706 2P BG18NUC-HC164 9707 RBD BG18NUC-HC165 9708 RBD BG18NUC-HC166 9709 2P BG18NUC-HC167 9710 2P BG18NUC-HC168 9711 RBD BG18NUC-HC169 9712 2P BG18NUC-HC170 9713 2P BG18NUC-HC171 9714 2P BG18NUC-HC172 9715 2P BG18NUC-HC173 9716 2P BG18NUC-HC174 9717 2P BG18NUC-HC175 9718 2P BG18NUC-HC176 9719 2P BG18NUC-HC177 9720 2P BG18NUC-HC178 9721 2P BG18NUC-HC179 9722 RBD BG18NUC-HC180 9723 RBD BG18NUC-HC181 9724 2P BG18NUC-HC182 9725 2P BG18NUC-HC183 9726 2P BG18NUC-HC184 9727 2P BG18NUC-HC185 9728 RBD BG18NUC-HC186 9729 2P BG18NUC-HC187 9730 2P BG18NUC-HC188 9731 2P BG18NUC-HC189 9732 2P BG18NUC-HC190 9733 2P BG18NUC-HC191 9734 2P BG18NUC-HC192 9735 RBD BG18NUC-HC193 9736 2P BG18NUC-HC194 9737 2P BG18NUC-HC195 9738 RBD BG18NUC-HC196 9739 RBD BG18NUC-HC197 9740 RBD BG18NUC-HC198 9741 RBD BG18NUC-HC199 9742 2P BG18NUC-HC200 9743 RBD BG18NUC-HC201 9744 2P BG18NUC-HC202 9745 RBD BG18NUC-HC203 9746 2P BG18NUC-HC204 9747 RBD BG18NUC-HC205 9748 2P BG18NUC-HC206 9749 2P BG18NUC-HC207 9750 2P BG18NUC-HC208 9751 2P BG18NUC-HC209 9752 2P BG18NUC-HC210 9753 2P BG18NUC-HC211 9754 RBD BG18NUC-HC212 9755 2P BG18NUC-HC213 9756 RBD BG18NUC-HC214 9757 RBD BG18NUC-HC215 9758 RBD BG18NUC-HC216 9759 RBD BG18NUC-HC217 9760 2P BG18NUC-HC218 9761 RBD BG18NUC-HC219 9762 2P BG18NUC-HC220 9763 2P BG18NUC-HC221 9764 2P BG18NUC-HC222 9765 2P BG18NUC-HC223 9766 RBD BG18NUC-HC224 9767 RBD BG18NUC-HC225 9768 2P BG18NUC-HC226 9769 2P BG18NUC-HC227 9770 2P BG18NUC-HC228 9771 2P BG18NUC-HC229 9772 RBD BG18NUC-HC230 9773 2P BG18NUC-HC231 9774 RBD BG18NUC-HC232 9775 2P BG18NUC-HC233 9776 2P BG18NUC-HC234 9777 2P BG18NUC-HC235 9778 2P BG18NUC-HC236 9779 2P BG18NUC-HC237 9780 RBD BG18NUC-HC238 9781 RBD BG18NUC-HC239 9782 RBD BG18NUC-HC240 9783 2P BG18NUC-HC241 9784 RBD BG18NUC-HC242 9785 2P BG18NUC-HC243 9786 2P BG18NUC-HC244 9787 2P BG18NUC-HC245 9788 2P BG18NUC-HC246 9789 2P BG18NUC-HC247 9790 2P BG18NUC-HC248 9791 2P BG18NUC-HC249 9792 2P BG18NUC-HC250 9793 2P BG18NUC-HC251 9794 RBD BG18NUC-HC252 9795 2P BG18NUC-HC253 9796 RBD BG18NUC-HC254 9797 RBD BG18NUC-HC255 9798 2P BG18NUC-HC256 9799 2P BG18NUC-HC257 9800 2P BG18NUC-HC258 9801 RBD BG18NUC-HC259 9802 2P BG18NUC-HC260 9803 RBD BG18NUC-HC261 9804 2P BG18NUC-HC262 9805 RBD BG18NUC-HC263 9806 2P BG18NUC-HC264 9807 2P BG18NUC-HC265 9808 2P BG18NUC-HC266 9809 RBD BG18NUC-HC267 9810 2P BG18NUC-HC268 9811 2P BG18NUC-HC269 9812 2P BG18NUC-HC270 9813 2P BG18NUC-HC271 9814 2P BG18NUC-HC272 9815 2P BG18NUC-HC273 9816 2P BG18NUC-HC274 9817 2P BG18NUC-HC275 9818 2P BG18NUC-HC276 9819 2P BG18NUC-HC277 9820 2P BG18NUC-HC278 9821 RBD BG18NUC-HC279 9822 2P BG18NUC-HC280 9823 2P BG18NUC-HC281 9824 RBD BG18NUC-HC282 9825 2P BG18NUC-HC283 9826 RBD BG18NUC-HC284 9827 2P BG18NUC-HC285 9828 RBD BG18NUC-HC286 9829 RBD BG18NUC-HC287 9830 2P BG18NUC-HC288 9831 2P BG18NUC-HC289 9832 2P BG18NUC-HC290 9833 RBD BG18NUC-HC291 9834 RBD BG18NUC-HC292 9835 RBD BG18NUC-HC293 9836 2P BG18NUC-HC294 9837 2P BG18NUC-HC295 9838 2P BG18NUC-HC296 9839 2P BG18NUC-HC297 9840 2P BG18NUC-HC298 9841 RBD BG18NUC-HC299 9842 2P BG18NUC-HC300 9843 2P BG18NUC-HC301 9844 2P BG18NUC-HC302 9845 2P BG18NUC-HC303 9846 2P BG18NUC-HC304 9847 2P BG18NUC-HC305 9848 2P BG18NUC-HC306 9849 2P BG18NUC-HC307 9850 2P BG18NUC-HC308 9851 RBD BG18NUC-HC309 9852 2P BG18NUC-HC310 9853 RBD BG18NUC-HC311 9854 2P BG18NUC-HC312 9855 2P BG18NUC-HC313 9856 2P BG18NUC-HC314 9857 RBD BG18NUC-HC315 9858 2F BG18NUC-HC316 9859 2P BG18NUC-HC317 9860 2P BG18NUC-HC318 9861 2P BG18NUC-HC319 9862 2P BG18NUC-HC320 9863 2P BG18NUC-HC321 9864 RBD BG18NUC-HC322 9865 RBD BG18NUC-HC323 9866 RBD BG18NUC-HC324 9867 RBD BG18NUC-HC325 9868 2P BG18NUC-HC326 9869 2P BG18NUC-HC327 9870 RBD BG18NUC-HC328 9871 2P BG18NUC-HC329 9872 2P BG18NUC-HC330 9873 2P BG18NUC-HC331 9874 2P BG18NUC-HC332 9875 2P BG18NUC-HC333 9876 RBD BG18NUC-HC334 9877 2P BG18NUC-HC335 9878 RBD BG18NUC-HC336 9879 RBD BG18NUC-HC337 9880 2P BG18NUC-HC338 9881 2P BG18NUC-HC339 9882 2P BG18NUC-HC340 9883 RBD BG18NUC-HC341 9884 2P BG18NUC-HC342 9885 RBD BG18NUC-HC343 9886 2P BG18NUC-HC344 9887 2P BG18NUC-HC345 9888 2P BG18NUC-HC346 9889 2P BG18NUC-HC347 9890 2P BG18NUC-HC348 9891 2P BG18NUC-HC349 9892 2P BG18NUC-HC350 9893 RBD BG18NUC-HC351 9894 2P BG18NUC-HC352 9895 2P BG18NUC-HC353 9896 2P BG18NUC-HC354 9897 2P BG18NUC-HC355 9898 2P BG18NUC-HC356 9899 2P BG18NUC-HC357 9900 RBD BG18NUC-HC358 9901 2P BG18NUC-HC359 9902 2P BG18NUC-HC360 9903 2P BG18NUC-HC361 9904 2P BG18NUC-HC362 9905 2F BG18NUC-HC363 9906 RBD BG18NUC-HC364 9907 RBD BG18NUC-HC365 9908 2P BG18NUC-HC366 9909 2P BG18NUC-HC367 9910 2P BG18NUC-HC368 9911 2P BG18NUC-HC369 9912 2P BG18NUC-HC370 9913 2P BG18NUC-HC371 9914 2P BG18NUC-HC372 9915 RBD BG18NUC-HC373 9916 RBD BG18NUC-HC374 9917 RBD BG18NUC-HC375 9918 RBD BG18NUC-HC376 9919 RBD BG18NUC-HC377 9920 2P BG18NUC-HC378 9921 2P BG18NUC-HC379 9922 2P BG18NUC-HC380 9923 RBD BG18NUC-HC381 9924 RBD BG18NUC-HC382 9925 2P BG18NUC-HC383 9926 RBD BG18NUC-HC384 9927 2P BG18NUC-HC385 9928 2P BG18NUC-HC386 9929 2P BG18NUC-HC387 9930 2P BG18NUC-HC388 9931 RBD BG18NUC-HC389 9932 2P BG18NUC-HC390 9933 RBD BG18NUC-HC391 9934 2P BG18NUC-HC392 9935 2P BG18NUC-HC393 9936 2P BG18NUC-HC394 9937 2P BG18NUC-HC395 9938 2P BG18NUC-HC396 9939 2P BG18NUC-HC397 9940 2P BG18NUC-HC398 9941 2P BG18NUC-HC399 9942 2P BG18NUC-HC400 9943 2P BG18NUC-HC401 9944 2P BG18NUC-HC402 9945 2P BG18NUC-HC403 9946 2P BG18NUC-HC404 9947 RBD BG18NUC-HC405 9948 2P BG18NUC-HC406 9949 RBD BG18NUC-HC407 9950 RBD BG18NUC-HC408 9951 RBD BG18NUC-HC409 9952 2P BG18NUC-HC410 9953 2P BG18NUC-HC411 9954 2P BG18NUC-HC412 9955 RBD BG18NUC-HC413 9956 RBD BG18NUC-HC414 9957 2P BG18NUC-HC415 9958 RBD BG18NUC-HC416 9959 2P BG18NUC-HC417 9960 2P BG18NUC-HC418 9961 2P BG18NUC-HC419 9962 RBD BG18NUC-HC420 9963 2P BG18NUC-HC421 9964 2P BG18NUC-HC422 9965 2P BG18NUC-HC423 9966 RBD BG18NUC-HC424 9967 2P BG18NUC-HC425 9968 2P BG18NUC-HC426 9969 2P BG18NUC-HC427 9970 RBD BG18NUC-HC428 9971 2P BG18NUC-HC429 9972 2P BG18NUC-HC430 9973 RBD BG18NUC-HC431 9974 2P BG18NUC-HC432 9975 2P BG18NUC-HC433 9976 RBD BG18NUC-HC434 9977 RBD BG18NUC-HC435 9978 2P BG18NUC-HC436 9979 2P BG18NUC-HC437 9980 2P BG18NUC-HC438 9981 2P BG18NUC-HC439 9982 2P BG18NUC-HC440 9983 2P BG18NUC-HC441 9984 2P BG18NUC-HC442 9985 2P BG18NUC-HC443 9986 2P BG18NUC-HC444 9987 2P BG18NUC-HC445 9988 RBD BG18NUC-HC446 9989 2P BG18NUC-HC447 9990 2P BG18NUC-HC448 9991 2P BG18NUC-HC449 9992 2P BG18NUC-HC450 9993 2P BG18NUC-HC451 9994 2P BG18NUC-HC452 9995 2P BG18NUC-HC453 9996 2P BG18NUC-HC454 9997 2P BG18NUC-HC455 9998 2P BG18NUC-HC456 9999 2P BG18NUC-HC457 10000 2P BG18NUC-HC458 10001 2P BG18NUC-HC459 10002 2P BG18NUC-HC460 10003 2P BG18NUC-HC461 10004 RBD BG18NUC-HC462 10005 RBD BG18NUC-HC463 10006 2P BG18NUC-HC464 10007 2P BG18NUC-HC465 10008 2P BG18NUC-HC466 10009 2P BG18NUC-HC467 10010 RBD BG18NUC-HC468 10011 RBD BG18NUC-HC469 10012 RBD BG18NUC-HC470 10013 2P BG18NUC-HC471 10014 2P BG18NUC-HC472 10015 2P BG18NUC-HC473 10016 2P BG18NUC-HC474 10017 RBD BG18NUC-HC475 10018 2P BG18NUC-HC476 10019 RBD BG18NUC-HC477 10020 RBD BG18NUC-HC478 10021 RBD BG18NUC-HC479 10022 RBD BG18NUC-HC480 10023 2P BG18NUC-HC481 10024 RBD BG18NUC-HC482 10025 2P BG18NUC-HC483 10026 2P BG18NUC-HC484 10027 2P BG18NUC-HC485 10028 2P BG18NUC-HC486 10029 2P BG18NUC-HC487 10030 2P BG18NUC-HC488 10031 2P BG18NUC-HC489 10032 2P BG18NUC-HC490 10033 2P BG18NUC-HC491 10034 RBD BG18NUC-HC492 10035 2P BG18NUC-HC493 10036 2P BG18NUC-HC494 10037 2P BG18NUC-HC495 10038 2P BG18NUC-HC496 10039 RBD BG18NUC-HC497 10040 2P BG18NUC-HC498 10041 2P BG18NUC-HC499 10042 2P BG18NUC-HC500 10043 2P BG18NUC-HC501 10044 RBD BG18NUC-HC502 10045 2P BG18NUC-HC503 10046 2P BG18NUC-HC504 10047 2P BG18NUC-HC505 10048 RBD BG18NUC-HC506 10049 2P BG18NUC-HC507 10050 2P BG18NUC-HC508 10051 2P BG18NUC-HC509 10052 2P BG18NUC-HC510 10053 2P BG18NUC-HC511 10054 2P BG18NUC-HC512 10055 2P BG18NUC-HC513 10056 2P BG18NUC-HC514 10057 2P BG18NUC-HC515 10058 RBD BG18NUC-HC516 10059 2P BG18NUC-HC517 10060 2P BG18NUC-HC518 10061 2P BG18NUC-HC519 10062 2P BG18NUC-HC520 10063 2P BG18NUC-HC521 10064 RBD BG18NUC-HC522 10065 2P BG18NUC-HC523 10066 2P BG18NUC-HC524 10067 2P BG18NUC-HC525 10068 RBD BG18NUC-HC526 10069 RBD BG18NUC-HC527 10070 2P BG18NUC-HC528 10071 2P BG18NUC-HC529 10072 2P BG18NUC-HC530 10073 2P BG18NUC-HC531 10074 2P BG18NUC-HC532 10075 RBD BG18NUC-HC533 10076 2P BG18NUC-HC534 10077 2P BG18NUC-HC535 10078 2P BG18NUC-HC536 10079 2P BG18NUC-HC537 10080 RBD BG18NUC-HC538 10081 RBD BG18NUC-HC539 10082 2F BG18NUC-HC540 10083 RBD BG18NUC-HC541 10084 RBD BG18NUC-HC542 10085 RBD BG18NUC-HC543 10086 RBD BG18NUC-HC544 10087 RBD BG18NUC-HC545 10088 RBD BG18NUC-HC546 10089 2P BG18NUC-HC547 10090 RBD BG18NUC-HC548 10091 RBD BG18NUC-HC549 10092 2P BG18NUC-HC550 10093 2P BG18NUC-HC551 10094 2P BG18NUC-HC552 10095 2P BG18NUC-HC553 10096 2P BG18NUC-HC554 10097 2P BG18NUC-HC555 10098 RBD BG18NUC-HC556 10099 2P BG18NUC-HC557 10100 RBD BG18NUC-HC558 10101 2P BG18NUC-HC559 10102 2P BG18NUC-HC560 10103 2P BG18NUC-HC561 10104 2P BG18NUC-HC562 10105 RBD BG18NUC-HC563 10106 2P BG18NUC-HC564 10107 2P BG18NUC-HC565 10108 2P BG18NUC-HC566 10109 2P BG18NUC-HC567 10110 2P BG18NUC-HC568 10111 2P BG18NUC-HC569 10112 2P BG18NUC-HC570 10113 2P BG18NUC-HC571 10114 2P BG18NUC-HC572 10115 2P BG18NUC-HC573 10116 RBD BG18NUC-HC574 10117 RBD BG18NUC-HC575 10118 2F BG18NUC-HC576 10119 RBD BG18NUC-HC577 10120 2P BG18NUC-HC578 10121 2P BG18NUC-HC579 10122 2P BG18NUC-HC580 10123 2P BG18NUC-HC581 10124 2P BG18NUC-HC582 10125 2P BG18NUC-HC583 10126 2P BG18NUC-HC584 10127 2P BG18NUC-HC585 10128 RBD BG18NUC-HC586 10129 2P BG18NUC-HC587 10130 2P BG18NUC-HC588 10131 2P BG18NUC-HC589 10132 2P BG18NUC-HC590 10133 2P BG18NUC-HC591 10134 2P BG18NUC-HC592 10135 2P BG18NUC-HC593 10136 2P BG18NUC-HC594 10137 2P BG18NUC-HC595 10138 RBD BG18NUC-HC596 10139 2P BG18NUC-HC597 10140 RBD BG18NUC-HC598 10141 RBD BG18NUC-HC599 10142 RBD BG18NUC-HC600 10143 2P BG18NUC-HC601 10144 2P BG18NUC-HC602 10145 2P BG18NUC-HC603 10146 2P BG18NUC-HC604 10147 2P BG18NUC-HC605 10148 RBD BG18NUC-HC606 10149 RBD BG18NUC-HC607 10150 2P BG18NUC-HC608 10151 RBD BG18NUC-HC609 10152 2P BG18NUC-HC610 10153 2P BG18NUC-HC611 10154 2P BG18NUC-HC612 10155 2P BG18NUC-HC613 10156 RBD BG18NUC-HC614 10157 2P BG18NUC-HC615 10158 RBD BG18NUC-HC616 10159 2P BG18NUC-HC617 10160 2P BG18NUC-HC618 10161 2P BG18NUC-HC619 10162 RBD BG18NUC-HC620 10163 2P BG18NUC-HC621 10164 2P BG18NUC-HC622 10165 2P BG18NUC-HC623 10166 2P BG18NUC-HC624 10167 2P BG18NUC-HC625 10168 RBD BG18NUC-HC626 10169 2P BG18NUC-HC627 10170 RBD BG18NUC-HC628 10171 2P BG18NUC-HC629 10172 2P BG18NUC-HC630 10173 RBD BG18NUC-HC631 10174 RBD BG18NUC-HC632 10175 2P BG18NUC-HC633 10176 2P BG18NUC-HC634 10177 2P BG18NUC-HC635 10178 2P BG18NUC-HC636 10179 2P BG18NUC-HC637 10180 2P BG18NUC-HC638 10181 RBD BG18NUC-HC639 10182 2P BG18NUC-HC640 10183 RBD BG18NUC-HC641 10184 2P BG18NUC-HC642 10185 2P BG18NUC-HC643 10186 2P BG18NUC-HC644 10187 2P BG18NUC-HC645 10188 2P BG18NUC-HC646 10189 2P BG18NUC-HC647 10190 RBD BG18NUC-HC648 10191 2P BG18NUC-HC649 10192 2P BG18NUC-HC650 10193 2P BG18NUC-HC651 10194 RBD BG18NUC-HC652 10195 2P BG18NUC-HC653 10196 RBD BG18NUC-HC654 10197 2P BG18NUC-HC655 10198 2P BG18NUC-HC656 10199 2P BG18NUC-HC657 10200 RBD BG18NUC-HC658 10201 2P BG18NUC-HC659 10202 2P BG18NUC-HC660 10203 2P BG18NUC-HC661 10204 2P BG18NUC-HC662 10205 RBD BG18NUC-HC663 10206 RBD BG18NUC-HC664 10207 RBD BG18NUC-HC665 10208 RBD BG18NUC-HC666 10209 RBD BG18NUC-HC667 10210 RBD BG18NUC-HC668 10211 RBD BG18NUC-HC669 10212 RBD BG18NUC-HC670 10213 2P BG18NUC-HC671 10214 2P BG18NUC-HC672 10215 2P BG18NUC-HC673 10216 RBD BG18NUC-HC674 10217 2P BG18NUC-HC675 10218 2P BG18NUC-HC676 10219 2P BG18NUC-HC677 10220 RBD BG18NUC-HC678 10221 2P BG18NUC-HC679 10222 2P BG18NUC-HC680 10223 2P BG18NUC-HC681 10224 RBD BG18NUC-HC682 10225 2P BG18NUC-HC683 10226 2P BG18NUC-HC684 10227 RBD BG18NUC-HC685 10228 2P BG18NUC-HC686 10229 2P BG18NUC-HC687 10230 2P BG18NUC-HC688 10231 2P BG18NUC-HC689 10232 2P BG18NUC-HC690 10233 RBD BG18NUC-HC691 10234 RBD BG18NUC-HC692 10235 RBD BG18NUC-HC693 10236 2P BG18NUC-HC694 10237 RBD BG18NUC-HC695 10238 2P BG18NUC-HC696 10239 2P BG18NUC-HC697 10240 2P BG18NUC-HC698 10241 2P BG18NUC-HC699 10242 2P BG18NUC-HC700 10243 2P BG18NUC-HC701 10244 2P BG18NUC-HC702 10245 2P BG18NUC-HC703 10246 2P BG18NUC-HC704 10247 2P BG18NUC-HC705 10248 2P BG18NUC-HC706 10249 RBD BG18NUC-HC707 10250 2P BG18NUC-HC708 10251 2P BG18NUC-HC709 10252 2P BG18NUC-HC710 10253 RBD BG18NUC-HC711 10254 2P BG18NUC-HC712 10255 RBD BG18NUC-HC713 10256 RBD BG18NUC-HC714 10257 RBD BG18NUC-HC715 10258 RBD BG18NUC-HC716 10259 RBD BG18NUC-HC717 10260 2P BG18NUC-HC718 10261 2P BG18NUC-HC719 10262 RBD BG18NUC-HC720 10263 RBD BG18NUC-HC721 10264 RBD BG18NUC-HC722 10265 2P BG18NUC-HC723 10266 RBD BG18NUC-HC724 10267 2P BG18NUC-HC725 10268 2P BG18NUC-HC726 10269 2P BG18NUC-HC727 10270 2P BG18NUC-HC728 10271 2P BG18NUC-HC729 10272 2P BG18NUC-HC730 10273 RBD BG18NUC-HC731 10274 RBD BG18NUC-HC732 10275 2P BG18NUC-HC733 10276 RBD BG18NUC-HC734 10277 2P BG18NUC-HC735 10278 2P BG18NUC-HC736 10279 2P BG18NUC-HC737 10280 2P BG18NUC-HC738 10281 RBD BG18NUC-HC739 10282 2P BG18NUC-HC740 10283 2P BG18NUC-HC741 10284 2P BG18NUC-HC742 10285 2F BG18NUC-HC743 10286 RBD BG18NUC-HC744 10287 2P BG18NUC-HC745 10288 RBD BG18NUC-HC746 10289 RBD BG18NUC-HC747 10290 RBD BG18NUC-HC748 10291 2P BG18NUC-HC749 10292 2P BG18NUC-HC750 10293 2P BG18NUC-HC751 10294 2P BG18NUC-LC1 10295 2P BG18NUC-LC2 10296 RBD BG18NUC-LC3 10297 2P BG18NUC-LC4 10298 2P BG18NUC-LC5 10299 RBD BG18NUC-LC6 10300 2P BG18NUC-LC7 10301 2P BG18NUC-LC8 10302 RBD BG18NUC-LC9 10303 2P BG18NUC-LC10 10304 2P BG18NUC-LC11 10305 2P BG18NUC-LC12 10306 2P BG18NUC-LC13 10307 2P BG18NUC-LC14 10308 2P BG18NUC-LC15 10309 2P BG18NUC-LC16 10310 RBD BG18NUC-LC17 10311 2P BG18NUC-LC18 10312 2P BG18NUC-LC19 10313 RBD BG18NUC-LC20 10314 2P BG18NUC-LC21 10315 RBD BG18NUC-LC22 10316 2P BG18NUC-LC23 10317 2P BG18NUC-LC24 10318 2P BG18NUC-LC25 10319 2P BG18NUC-LC26 10320 2P BG18NUC-LC27 10321 2P BG18NUC-LC28 10322 2P BG18NUC-LC29 10323 2P BG18NUC-LC30 10324 RBD BG18NUC-LC31 10325 RBD BG18NUC-LC32 10326 RBD BG18NUC-LC33 10327 2P BG18NUC-LC34 10328 2P BG18NUC-LC35 10329 2P BG18NUC-LC36 10330 2P BG18NUC-LC37 10331 2P BG18NUC-LC38 10332 2P BG18NUC-LC39 10333 2P BG18NUC-LC40 10334 RBD BG18NUC-LC41 10335 RBD BG18NUC-LC42 10336 2P BG18NUC-LC43 10337 2P BG18NUC-LC44 10338 2P BG18NUC-LC45 10339 RBD BG18NUC-LC46 10340 2P BG18NUC-LC47 10341 2P BG18NUC-LC48 10342 2P BG18NUC-LC49 10343 2P BG18NUC-LC50 10344 2P BG18NUC-LC51 10345 2P BG18NUC-LC52 10346 2P BG18NUC-LC53 10347 RBD BG18NUC-LC54 10348 2P BG18NUC-LC55 10349 2P BG18NUC-LC56 10350 2P BG18NUC-LC57 10351 2P BG18NUC-LC58 10352 RBD BG18NUC-LC59 10353 2P BG18NUC-LC60 10354 2P BG18NUC-LC61 10355 2P BG18NUC-LC62 10356 RBD BG18NUC-LC63 10357 RBD BG18NUC-LC64 10358 2P BG18NUC-LC65 10359 2P BG18NUC-LC66 10360 2P BG18NUC-LC67 10361 2P BG18NUC-LC68 10362 RBD BG18NUC-LC69 10363 2P BG18NUC-LC70 10364 RBD BG18NUC-LC71 10365 2P BG18NUC-LC72 10366 2P BG18NUC-LC73 10367 2P BG18NUC-LC74 10368 2P BG18NUC-LC75 10369 2P BG18NUC-LC76 10370 RBD BG18NUC-LC77 10371 RBD BG18NUC-LC78 10372 2P BG18NUC-LC79 10373 2P BG18NUC-LC80 10374 2P BG18NUC-LC81 10375 2P BG18NUC-LC82 10376 2P BG18NUC-LC83 10377 2P BG18NUC-LC84 10378 2P BG18NUC-LC85 10379 2P BG18NUC-LC86 10380 2P BG18NUC-LC87 10381 2P BG18NUC-LC88 10382 2P BG18NUC-LC89 10383 2P BG18NUC-LC90 10384 RBD BG18NUC-LC91 10385 RBD BG18NUC-LC92 10386 2P BG18NUC-LC93 10387 2P BG18NUC-LC94 10388 2P BG18NUC-LC95 10389 RBD BG18NUC-LC96 10390 2P BG18NUC-LC97 10391 2P BG18NUC-LC98 10392 2P BG18NUC-LC99 10393 2P BG18NUC-LC100 10394 RBD BG18NUC-LC101 10395 2P BG18NUC-LC102 10396 RBD BG18NUC-LC103 10397 RBD BG18NUC-LC104 10398 2P BG18NUC-LC105 10399 RBD BG18NUC-LC106 10400 RBD BG18NUC-LC107 10401 2P BG18NUC-LC108 10402 2P BG18NUC-LC109 10403 RBD BG18NUC-LC110 10404 2P BG18NUC-LC111 10405 2P BG18NUC-LC112 10406 2P BG18NUC-LC113 10407 2P BG18NUC-LC114 10408 2P BG18NUC-LC115 10409 RBD BG18NUC-LC116 10410 2P BG18NUC-LC117 10411 2P BG18NUC-LC118 10412 2P BG18NUC-LC119 10413 2P BG18NUC-LC120 10414 2P BG18NUC-LC121 10415 2P BG18NUC-LC122 10416 2P BG18NUC-LC123 10417 2P BG18NUC-LC124 10418 2P BG18NUC-LC125 10419 2P BG18NUC-LC126 10420 2P BG18NUC-LC127 10421 2P BG18NUC-LC128 10422 2P BG18NUC-LC129 10423 2P BG18NUC-LC130 10424 2P BG18NUC-LC131 10425 RBD BG18NUC-LC132 10426 2P BG18NUC-LC133 10427 RBD BG18NUC-LC134 10428 2P BG18NUC-LC135 10429 2P BG18NUC-LC136 10430 RBD BG18NUC-LC137 10431 2P BG18NUC-LC138 10432 RBD BG18NUC-LC139 10433 RBD BG18NUC-LC140 10434 RBD BG18NUC-LC141 10435 2P BG18NUC-LC142 10436 2P BG18NUC-LC143 10437 2P BG18NUC-LC144 10438 2P BG18NUC-LC145 10439 2P BG18NUC-LC146 10440 2P BG18NUC-LC147 10441 2P BG18NUC-LC148 10442 2P BG18NUC-LC149 10443 2P BG18NUC-LC150 10444 2P BG18NUC-LC151 10445 2P BG18NUC-LC152 10446 2P BG18NUC-LC153 10447 2P BG18NUC-LC154 10448 RBD BG18NUC-LC155 10449 2P BG18NUC-LC156 10450 2P BG18NUC-LC157 10451 2P BG18NUC-LC158 10452 2P BG18NUC-LC159 10453 2P BG18NUC-LC160 10454 2P BG18NUC-LC161 10455 2P BG18NUC-LC162 10456 RBD BG18NUC-LC163 10457 2P BG18NUC-LC164 10458 RBD BG18NUC-LC165 10459 RBD BG18NUC-LC166 10460 2P BG18NUC-LC167 10461 2P BG18NUC-LC168 10462 RBD BG18NUC-LC169 10463 2P BG18NUC-LC170 10464 2P BG18NUC-LC171 10465 2P BG18NUC-LC172 10466 2P BG18NUC-LC173 10467 2P BG18NUC-LC174 10468 2P BG18NUC-LC175 10469 2P BG18NUC-LC176 10470 2P BG18NUC-LC177 10471 2P BG18NUC-LC178 10472 2P BG18NUC-LC179 10473 RBD BG18NUC-LC180 10474 RBD BG18NUC-LC181 10475 2P BG18NUC-LC182 10476 2P BG18NUC-LC183 10477 2P BG18NUC-LC184 10478 2P BG18NUC-LC185 10479 RBD BG18NUC-LC186 10480 2P BG18NUC-LC187 10481 2P BG18NUC-LC188 10482 2P BG18NUC-LC189 10483 2P BG18NUC-LC190 10484 2P BG18NUC-LC191 10485 2P BG18NUC-LC192 10486 RBD BG18NUC-LC193 10487 2P BG18NUC-LC194 10488 2P BG18NUC-LC195 10489 RBD BG18NUC-LC196 10490 RBD BG18NUC-LC197 10491 RBD BG18NUC-LC198 10492 RBD BG18NUC-LC199 10493 2P BG18NUC-LC200 10494 RBD BG18NUC-LC201 10495 2P BG18NUC-LC202 10496 RBD BG18NUC-LC203 10497 2P BG18NUC-LC204 10498 RBD BG18NUC-LC205 10499 2P BG18NUC-LC206 10500 2P BG18NUC-LC207 10501 2P BG18NUC-LC208 10502 2P BG18NUC-LC209 10503 2P BG18NUC-LC210 10504 2P BG18NUC-LC211 10505 RBD BG18NUC-LC212 10506 2P BG18NUC-LC213 10507 RBD BG18NUC-LC214 10508 RBD BG18NUC-LC215 10509 RBD BG18NUC-LC216 10510 RBD BG18NUC-LC217 10511 2P BG18NUC-LC218 10512 RBD BG18NUC-LC219 10513 2P BG18NUC-LC220 10514 2P BG18NUC-LC221 10515 2P BG18NUC-LC222 10516 2P BG18NUC-LC223 10517 RBD BG18NUC-LC224 10518 RBD BG18NUC-LC225 10519 2P BG18NUC-LC226 10520 2P BG18NUC-LC227 10521 2P BG18NUC-LC228 10522 2P BG18NUC-LC229 10523 RBD BG18NUC-LC230 10524 2P BG18NUC-LC231 10525 RBD BG18NUC-LC232 10526 2P BG18NUC-LC233 10527 2P BG18NUC-LC234 10528 2P BG18NUC-LC235 10529 2P BG18NUC-LC236 10530 2P BG18NUC-LC237 10531 RBD BG18NUC-LC238 10532 RBD BG18NUC-LC239 10533 RBD BG18NUC-LC240 10534 2P BG18NUC-LC241 10535 RBD BG18NUC-LC242 10536 2P BG18NUC-LC243 10537 2P BG18NUC-LC244 10538 2P BG18NUC-LC245 10539 2P BG18NUC-LC246 10540 2P BG18NUC-LC247 10541 2P BG18NUC-LC248 10542 2P BG18NUC-LC249 10543 2P BG18NUC-LC250 10544 2P BG18NUC-LC251 10545 RBD BG18NUC-LC252 10546 2P BG18NUC-LC253 10547 RBD BG18NUC-LC254 10548 RBD BG18NUC-LC255 10549 2P BG18NUC-LC256 10550 2P BG18NUC-LC257 10551 2F BG18NUC-LC258 10552 RBD BG18NUC-LC259 10553 2P BG18NUC-LC260 10554 RBD BG18NUC-LC261 10555 2P BG18NUC-LC262 10556 RBD BG18NUC-LC263 10557 2P BG18NUC-LC264 10558 2P BG18NUC-LC265 10559 2P BG18NUC-LC266 10560 RBD BG18NUC-LC267 10561 2P BG18NUC-LC268 10562 2P BG18NUC-LC269 10563 2P BG18NUC-LC270 10564 2F BG18NUC-LC271 10565 2P BG18NUC-LC272 10566 2P BG18NUC-LC273 10567 2P BG18NUC-LC274 10568 2P BG18NUC-LC275 10569 2P BG18NUC-LC276 10570 2P BG18NUC-LC277 10571 2P BG18NUC-LC278 10572 RBD BG18NUC-LC279 10573 2P BG18NUC-LC280 10574 2P BG18NUC-LC281 10575 RBD BG18NUC-LC282 10576 2P BG18NUC-LC283 10577 RBD BG18NUC-LC284 10578 2P BG18NUC-LC285 10579 RBD BG18NUC-LC286 10580 RBD BG18NUC-LC287 10581 2P BG18NUC-LC288 10582 2P BG18NUC-LC289 10583 2P BG18NUC-LC290 10584 RBD BG18NUC-LC291 10585 RBD BG18NUC-LC292 10586 RBD BG18NUC-LC293 10587 2P BG18NUC-LC294 10588 2P BG18NUC-LC295 10589 2P BG18NUC-LC296 10590 2P BG18NUC-LC297 10591 2P BG18NUC-LC298 10592 RBD BG18NUC-LC299 10593 2P BG18NUC-LC300 10594 2P BG18NUC-LC301 10595 2P BG18NUC-LC302 10596 2P BG18NUC-LC303 10597 2P BG18NUC-LC304 10598 2P BG18NUC-LC305 10599 2P BG18NUC-LC306 10600 2P BG18NUC-LC307 10601 2P BG18NUC-LC308 10602 RBD BG18NUC-LC309 10603 2P BG18NUC-LC310 10604 RBD BG18NUC-LC311 10605 2P BG18NUC-LC312 10606 2P BG18NUC-LC313 10607 2P BG18NUC-LC314 10608 RBD BG18NUC-LC315 10609 2P BG18NUC-LC316 10610 2P BG18NUC-LC317 10611 2P BG18NUC-LC318 10612 2P BG18NUC-LC319 10613 2P BG18NUC-LC320 10614 2P BG18NUC-LC321 10615 RBD BG18NUC-LC322 10616 RBD BG18NUC-LC323 10617 RBD BG18NUC-LC324 10618 RBD BG18NUC-LC325 10619 2P BG18NUC-LC326 10620 2P BG18NUC-LC327 10621 RBD BG18NUC-LC328 10622 2P BG18NUC-LC329 10623 2P BG18NUC-LC330 10624 2P BG18NUC-LC331 10625 2P BG18NUC-LC332 10626 2P BG18NUC-LC333 10627 RBD BG18NUC-LC334 10628 2P BG18NUC-LC335 10629 RBD BG18NUC-LC336 10630 RBD BG18NUC-LC337 10631 2P BG18NUC-LC338 10632 2P BG18NUC-LC339 10633 2P BG18NUC-LC340 10634 RBD BG18NUC-LC341 10635 2P BG18NUC-LC342 10636 RBD BG18NUC-LC343 10637 2P BG18NUC-LC344 10638 2P BG18NUC-LC345 10639 2P BG18NUC-LC346 10640 2P BG18NUC-LC347 10641 2P BG18NUC-LC348 10642 2P BG18NUC-LC349 10643 2P BG18NUC-LC350 10644 RBD BG18NUC-LC351 10645 2P BG18NUC-LC352 10646 2P BG18NUC-LC353 10647 2P BG18NUC-LC354 10648 2P BG18NUC-LC355 10649 2P BG18NUC-LC356 10650 2P BG18NUC-LC357 10651 RBD BG18NUC-LC358 10652 2P BG18NUC-LC359 10653 2P BG18NUC-LC360 10654 2P BG18NUC-LC361 10655 2P BG18NUC-LC362 10656 2P BG18NUC-LC363 10657 RBD BG18NUC-LC364 10658 RBD BG18NUC-LC365 10659 2P BG18NUC-LC366 10660 2P BG18NUC-LC367 10661 2P BG18NUC-LC368 10662 2P BG18NUC-LC369 10663 2P BG18NUC-LC370 10664 2P BG18NUC-LC371 10665 2P BG18NUC-LC372 10666 RBD BG18NUC-LC373 10667 RBD BG18NUC-LC374 10668 RBD BG18NUC-LC375 10669 RBD BG18NUC-LC376 10670 RBD BG18NUC-LC377 10671 2P BG18NUC-LC378 10672 2P BG18NUC-LC379 10673 2P BG18NUC-LC380 10674 RBD BG18NUC-LC381 10675 RBD BG18NUC-LC382 10676 2P BG18NUC-LC383 10677 RBD BG18NUC-LC384 10678 2P BG18NUC-LC385 10679 2P BG18NUC-LC386 10680 2P BG18NUC-LC387 10681 2P BG18NUC-LC388 10682 RBD BG18NUC-LC389 10683 2P BG18NUC-LC390 10684 RBD BG18NUC-LC391 10685 2P BG18NUC-LC392 10686 2P BG18NUC-LC393 10687 2P BG18NUC-LC394 10688 2P BG18NUC-LC395 10689 2P BG18NUC-LC396 10690 2P BG18NUC-LC397 10691 2P BG18NUC-LC398 10692 2P BG18NUC-LC399 10693 2P BG18NUC-LC400 10694 2P BG18NUC-LC401 10695 2P BG18NUC-LC402 10696 2P BG18NUC-LC403 10697 2F BG18NUC-LC404 10698 RBD BG18NUC-LC405 10699 2P BG18NUC-LC406 10700 RBD BG18NUC-LC407 10701 RBD BG18NUC-LC408 10702 RBD BG18NUC-LC409 10703 2P BG18NUC-LC410 10704 2P BG18NUC-LC411 10705 2P BG18NUC-LC412 10706 RBD BG18NUC-LC413 10707 RBD BG18NUC-LC414 10708 2P BG18NUC-LC415 10709 RBD BG18NUC-LC416 10710 2P BG18NUC-LC417 10711 2P BG18NUC-LC418 10712 2P BG18NUC-LC419 10713 RBD BG18NUC-LC420 10714 2P BG18NUC-LC421 10715 2P BG18NUC-LC422 10716 2P BG18NUC-LC423 10717 RBD BG18NUC-LC424 10718 2P BG18NUC-LC425 10719 2P BG18NUC-LC426 10720 2P BG18NUC-LC427 10721 RBD BG18NUC-LC428 10722 2P BG18NUC-LC429 10723 2F BG18NUC-LC430 10724 RBD BG18NUC-LC431 10725 2P BG18NUC-LC432 10726 2P BG18NUC-LC433 10727 RBD BG18NUC-LC434 10728 RBD BG18NUC-LC435 10729 2P BG18NUC-LC436 10730 2P BG18NUC-LC437 10731 2P BG18NUC-LC438 10732 2P BG18NUC-LC439 10733 2P BG18NUC-LC440 10734 2P BG18NUC-LC441 10735 2P BG18NUC-LC442 10736 2P BG18NUC-LC443 10737 2F BG18NUC-LC444 10738 2P BG18NUC-LC445 10739 RBD BG18NUC-LC446 10740 2P BG18NUC-LC447 10741 2P BG18NUC-LC448 10742 2F BG18NUC-LC449 10743 2P BG18NUC-LC450 10744 2P BG18NUC-LC451 10745 2P BG18NUC-LC452 10746 2P BG18NUC-LC453 10747 2P BG18NUC-LC454 10748 2F BG18NUC-LC455 10749 2P BG18NUC-LC456 10750 2P BG18NUC-LC457 10751 2P BG18NUC-LC458 10752 2P BG18NUC-LC459 10753 2P BG18NUC-LC460 10754 2P BG18NUC-LC461 10755 RBD BG18NUC-LC462 10756 RBD BG18NUC-LC463 10757 2P BG18NUC-LC464 10758 2F BG18NUC-LC465 10759 2F BG18NUC-LC466 10760 2F BG18NUC-LC467 10761 RBD BG18NUC-LC468 10762 RBD BG18NUC-LC469 10763 RBD BG18NUC-LC470 10764 2P BG18NUC-LC471 10765 2P BG18NUC-LC472 10766 2P BG18NUC-LC473 10767 2P BG18NUC-LC474 10768 RBD BG18NUC-LC475 10769 2P BG18NUC-LC476 10770 RBD BG18NUC-LC477 10771 RBD BG18NUC-LC478 10772 RBD BG18NUC-LC479 10773 RBD BG18NUC-LC480 10774 2P BG18NUC-LC481 10775 RBD BG18NUC-LC482 10776 2P BG18NUC-LC483 10777 2P BG18NUC-LC484 10778 2P BG18NUC-LC485 10779 2P BG18NUC-LC486 10780 2P BG18NUC-LC487 10781 2P BG18NUC-LC488 10782 2P BG18NUC-LC489 10783 2P BG18NUC-LC490 10784 2P BG18NUC-LC491 10785 RBD BG18NUC-LC492 10786 2P BG18NUC-LC493 10787 2F BG18NUC-LC494 10788 2P BG18NUC-LC495 10789 2P BG18NUC-LC496 10790 RBD BG18NUC-LC497 10791 2F BG18NUC-LC498 10792 2F BG18NUC-LC499 10793 2P BG18NUC-LC500 10794 2P BG18NUC-LC501 10795 RBD BG18NUC-LC502 10796 2P BG18NUC-LC503 10797 2F BG18NUC-LC504 10798 2P BG18NUC-LC505 10799 RBD BG18NUC-LC506 10800 2P BG18NUC-LC507 10801 2P BG18NUC-LC508 10802 2F BG18NUC-LC509 10803 2P BG18NUC-LC510 10804 2P BG18NUC-LC511 10805 2P BG18NUC-LC512 10806 2P BG18NUC-LC513 10807 2P BG18NUC-LC514 10808 2P BG18NUC-LC515 10809 RBD BG18NUC-LC516 10810 2P BG18NUC-LC517 10811 2P BG18NUC-LC518 10812 2P BG18NUC-LC519 10813 2P BG18NUC-LC520 10814 2P BG18NUC-LC521 10815 RBD BG18NUC-LC522 10816 2P BG18NUC-LC523 10817 2P BG18NUC-LC524 10818 2P BG18NUC-LC525 10819 RBD BG18NUC-LC526 10820 RBD BG18NUC-LC527 10821 2P BG18NUC-LC528 10822 2P BG18NUC-LC529 10823 2P BG18NUC-LC530 10824 2P BG18NUC-LC531 10825 2P BG18NUC-LC532 10826 RBD BG18NUC-LC533 10827 2P BG18NUC-LC534 10828 2P BG18NUC-LC535 10829 2P BG18NUC-LC536 10830 2P BG18NUC-LC537 10831 RBD BG18NUC-LC538 10832 RBD BG18NUC-LC539 10833 2P BG18NUC-LC540 10834 RBD BG18NUC-LC541 10835 RBD BG18NUC-LC542 10836 RBD BG18NUC-LC543 10837 RBD BG18NUC-LC544 10838 RBD BG18NUC-LC545 10839 RBD BG18NUC-LC546 10840 2P BG18NUC-LC547 10841 RBD BG18NUC-LC548 10842 RBD BG18NUC-LC549 10843 2P BG18NUC-LC550 10844 2P BG18NUC-LC551 10845 2P BG18NUC-LC552 10846 2P BG18NUC-LC553 10847 2P BG18NUC-LC554 10848 2P BG18NUC-LC555 10849 RBD BG18NUC-LC556 10850 2P BG18NUC-LC557 10851 RBD BG18NUC-LC558 10852 2P BG18NUC-LC559 10853 2P BG18NUC-LC560 10854 2P BG18NUC-LC561 10855 2P BG18NUC-LC562 10856 RBD BG18NUC-LC563 10857 2P BG18NUC-LC564 10858 2P BG18NUC-LC565 10859 2P BG18NUC-LC566 10860 2P BG18NUC-LC567 10861 2P BG18NUC-LC568 10862 2P BG18NUC-LC569 10863 2P BG18NUC-LC570 10864 2P BG18NUC-LC571 10865 2P BG18NUC-LC572 10866 2P BG18NUC-LC573 10867 RBD BG18NUC-LC574 10868 RBD BG18NUC-LC575 10869 2P BG18NUC-LC576 10870 RBD BG18NUC-LC577 10871 2P BG18NUC-LC578 10872 2P BG18NUC-LC579 10873 2P BG18NUC-LC580 10874 2P BG18NUC-LC581 10875 2P BG18NUC-LC582 10876 2P BG18NUC-LC583 10877 2P BG18NUC-LC584 10878 2P BG18NUC-LC585 10879 RBD BG18NUC-LC586 10880 2P BG18NUC-LC587 10881 2P BG18NUC-LC588 10882 2P BG18NUC-LC589 10883 2P BG18NUC-LC590 10884 2P BG18NUC-LC591 10885 2P BG18NUC-LC592 10886 2P BG18NUC-LC593 10887 2P BG18NUC-LC594 10888 2P BG18NUC-LC595 10889 RBD BG18NUC-LC596 10890 2P BG18NUC-LC597 10891 RBD BG18NUC-LC598 10892 RBD BG18NUC-LC599 10893 RBD BG18NUC-LC600 10894 2P BG18NUC-LC601 10895 2P BG18NUC-LC602 10896 2P BG18NUC-LC603 10897 2P BG18NUC-LC604 10898 2P BG18NUC-LC605 10899 RBD BG18NUC-LC606 10900 RBD BG18NUC-LC607 10901 2P BG18NUC-LC608 10902 RBD BG18NUC-LC609 10903 2P BG18NUC-LC610 10904 2P BG18NUC-LC611 10905 2P BG18NUC-LC612 10906 2P BG18NUC-LC613 10907 RBD BG18NUC-LC614 10908 2P BG18NUC-LC615 10909 RBD BG18NUC-LC616 10910 2P BG18NUC-LC617 10911 2P BG18NUC-LC618 10912 2P BG18NUC-LC619 10913 RBD BG18NUC-LC620 10914 2P BG18NUC-LC621 10915 2P BG18NUC-LC622 10916 2P BG18NUC-LC623 10917 2P BG18NUC-LC624 10918 2P BG18NUC-LC625 10919 RBD BG18NUC-LC626 10920 2P BG18NUC-LC627 10921 RBD BG18NUC-LC628 10922 2P BG18NUC-LC629 10923 2P BG18NUC-LC630 10924 RBD BG18NUC-LC631 10925 RBD BG18NUC-LC632 10926 2P BG18NUC-LC633 10927 2P BG18NUC-LC634 10928 2P BG18NUC-LC635 10929 2P BG18NUC-LC636 10930 2P BG18NUC-LC637 10931 2P BG18NUC-LC638 10932 RBD BG18NUC-LC639 10933 2P BG18NUC-LC640 10934 RBD BG18NUC-LC641 10935 2P BG18NUC-LC642 10936 2P BG18NUC-LC643 10937 2P BG18NUC-LC644 10938 2P BG18NUC-LC645 10939 2P BG18NUC-LC646 10940 2P BG18NUC-LC647 10941 RBD BG18NUC-LC648 10942 2P BG18NUC-LC649 10943 2P BG18NUC-LC650 10944 2F BG18NUC-LC651 10945 RBD BG18NUC-LC652 10946 2P BG18NUC-LC653 10947 RBD BG18NUC-LC654 10948 2P BG18NUC-LC655 10949 2P BG18NUC-LC656 10950 2P BG18NUC-LC657 10951 RBD BG18NUC-LC658 10952 2P BG18NUC-LC659 10953 2P BG18NUC-LC660 10954 2P BG18NUC-LC661 10955 2P BG18NUC-LC662 10956 RBD BG18NUC-LC663 10957 RBD BG18NUC-LC664 10958 RBD BG18NUC-LC665 10959 RBD BG18NUC-LC666 10960 RBD BG18NUC-LC667 10961 RBD BG18NUC-LC668 10962 RBD BG18NUC-LC669 10963 RBD BG18NUC-LC670 10964 2P BG18NUC-LC671 10965 2P BG18NUC-LC672 10966 2P BG18NUC-LC673 10967 RBD BG18NUC-LC674 10968 2P BG18NUC-LC675 10969 2P BG18NUC-LC676 10970 2P BG18NUC-LC677 10971 RBD BG18NUC-LC678 10972 2P BG18NUC-LC679 10973 2P BG18NUC-LC680 10974 2P BG18NUC-LC681 10975 RBD BG18NUC-LC682 10976 2P BG18NUC-LC683 10977 2P BG18NUC-LC684 10978 RBD BG18NUC-LC685 10979 2P BG18NUC-LC686 10980 2P BG18NUC-LC687 10981 2P BG18NUC-LC688 10982 2P BG18NUC-LC689 10983 2P BG18NUC-LC690 10984 RBD BG18NUC-LC691 10985 RBD BG18NUC-LC692 10986 RBD BG18NUC-LC693 10987 2P BG18NUC-LC694 10988 RBD BG18NUC-LC695 10989 2P BG18NUC-LC696 10990 2P BG18NUC-LC697 10991 2P BG18NUC-LC698 10992 2P BG18NUC-LC699 10993 2P BG18NUC-LC700 10994 2P BG18NUC-LC701 10995 2P BG18NUC-LC702 10996 2P BG18NUC-LC703 10997 2P BG18NUC-LC704 10998 2P BG18NUC-LC705 10999 2P BG18NUC-LC706 11000 RBD BG18NUC-LC707 11001 2P BG18NUC-LC708 11002 2P BG18NUC-LC709 11003 2P BG18NUC-LC710 11004 RBD BG18NUC-LC711 11005 2P BG18NUC-LC712 11006 RBD BG18NUC-LC713 11007 RBD BG18NUC-LC714 11008 RBD BG18NUC-LC715 11009 RBD BG18NUC-LC716 11010 RBD BG18NUC-LC717 11011 2P BG18NUC-LC718 11012 2P BG18NUC-LC719 11013 RBD BG18NUC-LC720 11014 RBD BG18NUC-LC721 11015 RBD BG18NUC-LC722 11016 2P BG18NUC-LC723 11017 RBD BG18NUC-LC724 11018 2P BG18NUC-LC725 11019 2P BG18NUC-LC726 11020 2P BG18NUC-LC727 11021 2P BG18NUC-LC728 11022 2P BG18NUC-LC729 11023 2P BG18NUC-LC730 11024 RBD BG18NUC-LC731 11025 RBD BG18NUC-LC732 11026 2P BG18NUC-LC733 11027 RBD BG18NUC-LC734 11028 2P BG18NUC-LC735 11029 2P BG18NUC-LC736 11030 2P BG18NUC-LC737 11031 2P BG18NUC-LC738 11032 RBD BG18NUC-LC739 11033 2P BG18NUC-LC740 11034 2P BG18NUC-LC741 11035 2P BG18NUC-LC742 11036 2P BG18NUC-LC743 11037 RBD BG18NUC-LC744 11038 2P BG18NUC-LC745 11039 RBD BG18NUC-LC746 11040 RBD BG18NUC-LC747 11041 RBD BG18NUC-LC748 11042 2P BG18NUC-LC749 11043 2P BG18NUC-LC750 11044 2P BG18NUC-LC751 11045 2P BG19NUC-HC1 11046 RBD BG19NUC-HC2 11047 RBD BG19NUC-HC3 11048 RBD BG19NUC-HC4 11049 2P BG19NUC-HC5 11050 2P BG19NUC-HC6 11051 RBD BG19NUC-HC7 11052 RBD BG19NUC-HC8 11053 2P BG19NUC-HC9 11054 2P BG19NUC-HC10 11055 2P BG19NUC-HC11 11056 RBD BG19NUC-HC12 11057 RBD BG19NUC-HC13 11058 2P BG19NUC-HC14 11059 RBD BG19NUC-HC15 11060 RBD BG19NUC-HC16 11061 2P BG19NUC-HC17 11062 2P BG19NUC-HC18 11063 2P BG19NUC-HC19 11064 2P BG19NUC-HC20 11065 2P BG19NUC-HC21 11066 2P BG19NUC-HC22 11067 RBD BG19NUC-HC23 11068 2P BG19NUC-HC24 11069 2P BG19NUC-HC25 11070 RBD BG19NUC-HC26 11071 2P BG19NUC-HC27 11072 RBD BG19NUC-HC28 11073 2P BG19NUC-HC29 11074 RBD BG19NUC-HC30 11075 2P BG19NUC-HC31 11076 2P BG19NUC-HC32 11077 2P BG19NUC-HC33 11078 RBD BG19NUC-HC34 11079 2P BG19NUC-HC35 11080 RBD BG19NUC-HC36 11081 RBD BG19NUC-HC37 11082 2P BG19NUC-HC38 11083 2P BG19NUC-HC39 11084 RBD BG19NUC-HC40 11085 2P BG19NUC-HC41 11086 2P BG19NUC-HC42 11087 2P BG19NUC-HC43 11088 2P BG19NUC-HC44 11089 2P BG19NUC-HC45 11090 2P BG19NUC-HC46 11091 RBD BG19NUC-HC47 11092 RBD BG19NUC-HC48 11093 RBD BG19NUC-HC49 11094 2P BG19NUC-HC50 11095 2P BG19NUC-HC51 11096 2P BG19NUC-HC52 11097 2F BG19NUC-HC53 11098 RBD BG19NUC-HC54 11099 2P BG19NUC-HC55 11100 2P BG19NUC-HC56 11101 2P BG19NUC-HC57 11102 2P BG19NUC-HC58 11103 RBD BG19NUC-HC59 11104 RBD BG19NUC-HC60 11105 RBD BG19NUC-HC61 11106 2P BG19NUC-HC62 11107 2P BG19NUC-HC63 11108 RBD BG19NUC-HC64 11109 2P BG19NUC-HC65 11110 2P BG19NUC-HC66 11111 2P BG19NUC-HC67 11112 2P BG19NUC-HC68 11113 2P BG19NUC-HC69 11114 2P BG19NUC-HC70 11115 2F BG19NUC-HC71 11116 2P BG19NUC-HC72 11117 2P BG19NUC-HC73 11118 2P BG19NUC-HC74 11119 2P BG19NUC-HC75 11120 RBD BG19NUC-HC76 11121 2P BG19NUC-HC77 11122 RBD BG19NUC-HC78 11123 2P BG19NUC-HC79 11124 RBD BG19NUC-HC80 11125 2P BG19NUC-HC81 11126 2P BG19NUC-HC82 11127 2P BG19NUC-HC83 11128 2P BG19NUC-HC84 11129 2P BG19NUC-HC85 11130 2P BG19NUC-HC86 11131 2P BG19NUC-HC87 11132 2P BG19NUC-HC88 11133 2P BG19NUC-HC89 11134 2P BG19NUC-HC90 11135 2P BG19NUC-HC91 11136 RBD BG19NUC-HC92 11137 2P BG19NUC-HC93 11138 2P BG19NUC-HC94 11139 2P BG19NUC-HC95 11140 2P BG19NUC-HC96 11141 2P BG19NUC-HC97 11142 2P BG19NUC-HC98 11143 2P BG19NUC-HC99 11144 2P BG19NUC-HC100 11145 2P BG19NUC-HC101 11146 2P BG19NUC-HC102 11147 2P BG19NUC-HC103 11148 2P BG19NUC-HC104 11149 2P BG19NUC-HC105 11150 RBD BG19NUC-HC106 11151 RBD BG19NUC-HC107 11152 RBD BG19NUC-HC108 11153 2P BG19NUC-HC109 11154 RBD BG19NUC-HC110 11155 2P BG19NUC-HC111 11156 2F BG19NUC-HC112 11157 2F BG19NUC-HC113 11158 RBD BG19NUC-HC114 11159 2P BG19NUC-HC115 11160 2P BG19NUC-HC116 11161 2P BG19NUC-HC117 11162 RBD BG19NUC-HC118 11163 RBD BG19NUC-HC119 11164 RBD BG19NUC-HC120 11165 RBD BG19NUC-HC121 11166 2P BG19NUC-HC122 11167 2P BG19NUC-HC123 11168 2P BG19NUC-HC124 11169 2P BG19NUC-HC125 11170 RBD BG19NUC-HC126 11171 RBD BG19NUC-HC127 11172 2P BG19NUC-HC128 11173 2P BG19NUC-HC129 11174 2P BG19NUC-HC130 11175 2P BG19NUC-HC131 11176 RBD BG19NUC-HC132 11177 2P BG19NUC-HC133 11178 2P BG19NUC-HC134 11179 RBD BG19NUC-HC135 11180 RBD BG19NUC-HC136 11181 2P BG19NUC-HC137 11182 2P BG19NUC-HC138 11183 RBD BG19NUC-HC139 11184 2P BG19NUC-HC140 11185 RBD BG19NUC-HC141 11186 2P BG19NUC-HC142 11187 2P BG19NUC-HC143 11188 2P BG19NUC-HC144 11189 2P BG19NUC-HC145 11190 RBD BG19NUC-HC146 11191 2P BG19NUC-HC147 11192 2P BG19NUC-HC148 11193 2P BG19NUC-HC149 11194 2P BG19NUC-HC150 11195 2P BG19NUC-HC151 11196 RBD BG19NUC-HC152 11197 2P BG19NUC-HC153 11198 2P BG19NUC-HC154 11199 2P BG19NUC-HC155 11200 RBD BG19NUC-HC156 11201 2P BG19NUC-HC157 11202 2P BG19NUC-HC158 11203 2P BG19NUC-HC159 11204 2P BG19NUC-HC160 11205 2P BG19NUC-HC161 11206 2P BG19NUC-HC162 11207 2P BG19NUC-HC163 11208 RBD BG19NUC-HC164 11209 2P BG19NUC-HC165 11210 2P BG19NUC-HC166 11211 RBD BG19NUC-HC167 11212 2P BG19NUC-HC168 11213 2P BG19NUC-HC169 11214 2P BG19NUC-HC170 11215 2P BG19NUC-HC171 11216 2P BG19NUC-HC172 11217 2P BG19NUC-HC173 11218 RBD BG19NUC-HC174 11219 RBD BG19NUC-HC175 11220 2P BG19NUC-HC176 11221 RBD BG19NUC-HC177 11222 RBD BG19NUC-HC178 11223 2P BG19NUC-HC179 11224 2P BG19NUC-HC180 11225 2P BG19NUC-HC181 11226 2P BG19NUC-HC182 11227 RBD BG19NUC-HC183 11228 RBD BG19NUC-HC184 11229 RBD BG19NUC-HC185 11230 RBD BG19NUC-HC186 11231 RBD BG19NUC-HC187 11232 2P BG19NUC-HC188 11233 2P BG19NUC-HC189 11234 RBD BG19NUC-HC190 11235 RBD BG19NUC-HC191 11236 2P BG19NUC-HC192 11237 2P BG19NUC-HC193 11238 2P BG19NUC-HC194 11239 RBD BG19NUC-HC195 11240 RBD BG19NUC-HC196 11241 2P BG19NUC-HC197 11242 RBD BG19NUC-HC198 11243 2P BG19NUC-HC199 11244 RBD BG19NUC-HC200 11245 RBD BG19NUC-HC201 11246 RBD BG19NUC-HC202 11247 RBD BG19NUC-HC203 11248 2P BG19NUC-HC204 11249 2P BG19NUC-HC205 11250 2P BG19NUC-HC206 11251 2P BG19NUC-HC207 11252 2P BG19NUC-HC208 11253 2P BG19NUC-HC209 11254 2P BG19NUC-HC210 11255 2P BG19NUC-HC211 11256 2P BG19NUC-HC212 11257 2P BG19NUC-HC213 11258 RBD BG19NUC-HC214 11259 RBD BG19NUC-HC215 11260 2P BG19NUC-HC216 11261 2P BG19NUC-HC217 11262 RBD BG19NUC-HC218 11263 2P BG19NUC-HC219 11264 2P BG19NUC-HC220 11265 2P BG19NUC-HC221 11266 RBD BG19NUC-HC222 11267 RBD BG19NUC-HC223 11268 2P BG19NUC-HC224 11269 2P BG19NUC-HC225 11270 2P BG19NUC-HC226 11271 2P BG19NUC-HC227 11272 2P BG19NUC-HC228 11273 RBD BG19NUC-HC229 11274 2P BG19NUC-HC230 11275 2P BG19NUC-HC231 11276 RBD BG19NUC-HC232 11277 RBD BG19NUC-HC233 11278 2P BG19NUC-HC234 11279 2P BG19NUC-HC235 11280 2P BG19NUC-HC236 11281 RBD BG19NUC-HC237 11282 RBD BG19NUC-HC238 11283 RBD BG19NUC-HC239 11284 2P BG19NUC-HC240 11285 2P BG19NUC-HC241 11286 2P BG19NUC-HC242 11287 2P BG19NUC-HC243 11288 2P BG19NUC-HC244 11289 RBD BG19NUC-HC245 11290 RBD BG19NUC-HC246 11291 2P BG19NUC-HC247 11292 RBD BG19NUC-HC248 11293 2P BG19NUC-HC249 11294 2P BG19NUC-HC250 11295 2P BG19NUC-HC251 11296 2P BG19NUC-HC252 11297 2P BG19NUC-HC253 11298 RBD BG19NUC-HC254 11299 RBD BG19NUC-HC255 11300 2P BG19NUC-HC256 11301 2P BG19NUC-HC257 11302 RBD BG19NUC-HC258 11303 2P BG19NUC-HC259 11304 2P BG19NUC-HC260 11305 RBD BG19NUC-HC261 11306 2P BG19NUC-HC262 11307 2P BG19NUC-HC263 11308 RBD BG19NUC-HC264 11309 2P BG19NUC-HC265 11310 2P BG19NUC-HC266 11311 2P BG19NUC-HC267 11312 2P BG19NUC-HC268 11313 RBD BG19NUC-HC269 11314 2P BG19NUC-HC270 11315 RBD BG19NUC-HC271 11316 RBD BG19NUC-HC272 11317 RBD BG19NUC-HC273 11318 2P BG19NUC-HC274 11319 RBD BG19NUC-HC275 11320 2P BG19NUC-LC1 11321 RBD BG19NUC-LC2 11322 RBD BG19NUC-LC3 11323 RBD BG19NUC-LC4 11324 2F BG19NUC-LC5 11325 2P BG19NUC-LC6 11326 RBD BG19NUC-LC7 11327 RBD BG19NUC-LC8 11328 2P BG19NUC-LC9 11329 2P BG19NUC-LC10 11330 2F BG19NUC-LC11 11331 RBD BG19NUC-LC12 11332 RBD BG19NUC-LC13 11333 2P BG19NUC-LC14 11334 RBD BG19NUC-LC15 11335 RBD BG19NUC-LC16 11336 2P BG19NUC-LC17 11337 2P BG19NUC-LC18 11338 2P BG19NUC-LC19 11339 2F BG19NUC-LC20 11340 2F BG19NUC-LC21 11341 2P BG19NUC-LC22 11342 RBD BG19NUC-LC23 11343 2P BG19NUC-LC24 11344 2P BG19NUC-LC25 11345 RBD BG19NUC-LC26 11346 2P BG19NUC-LC27 11347 RBD BG19NUC-LC28 11348 2P BG19NUC-LC29 11349 RBD BG19NUC-LC30 11350 2P BG19NUC-LC31 11351 2P BG19NUC-LC32 11352 2P BG19NUC-LC33 11353 RBD BG19NUC-LC34 11354 2P BG19NUC-LC35 11355 RBD BG19NUC-LC36 11356 RBD BG19NUC-LC37 11357 2P BG19NUC-LC38 11358 2P BG19NUC-LC39 11359 RBD BG19NUC-LC40 11360 2P BG19NUC-LC41 11361 2P BG19NUC-LC42 11362 2P BG19NUC-LC43 11363 2P BG19NUC-LC44 11364 2P BG19NUC-LC45 11365 2P BG19NUC-LC46 11366 RBD BG19NUC-LC47 11367 RBD BG19NUC-LC48 11368 RBD BG19NUC-LC49 11369 2P BG19NUC-LC50 11370 2P BG19NUC-LC51 11371 2P BG19NUC-LC52 11372 2P BG19NUC-LC53 11373 RBD BG19NUC-LC54 11374 2P BG19NUC-LC55 11375 2P BG19NUC-LC56 11376 2P BG19NUC-LC57 11377 2P BG19NUC-LC58 11378 RBD BG19NUC-LC59 11379 RBD BG19NUC-LC60 11380 RBD BG19NUC-LC61 11381 2P BG19NUC-LC62 11382 2P BG19NUC-LC63 11383 RBD BG19NUC-LC64 11384 2P BG19NUC-LC65 11385 2P BG19NUC-LC66 11386 2P BG19NUC-LC67 11387 2P BG19NUC-LC68 11388 2P BG19NUC-LC69 11389 2P BG19NUC-LC70 11390 2P BG19NUC-LC71 11391 2P BG19NUC-LC72 11392 2P BG19NUC-LC73 11393 2P BG19NUC-LC74 11394 2P BG19NUC-LC75 11395 RBD BG19NUC-LC76 11396 2P BG19NUC-LC77 11397 RBD BG19NUC-LC78 11398 2P BG19NUC-LC79 11399 RBD BG19NUC-LC80 11400 2P BG19NUC-LC81 11401 2P BG19NUC-LC82 11402 2P BG19NUC-LC83 11403 2P BG19NUC-LC84 11404 2P BG19NUC-LC85 11405 2P BG19NUC-LC86 11406 2P BG19NUC-LC87 11407 2P BG19NUC-LC88 11408 2P BG19NUC-LC89 11409 2P BG19NUC-LC90 11410 2P BG19NUC-LC91 11411 RBD BG19NUC-LC92 11412 2P BG19NUC-LC93 11413 2P BG19NUC-LC94 11414 2P BG19NUC-LC95 11415 2P BG19NUC-LC96 11416 2P BG19NUC-LC97 11417 2P BG19NUC-LC98 11418 2P BG19NUC-LC99 11419 2P BG19NUC-LC100 11420 2P BG19NUC-LC101 11421 2P BG19NUC-LC102 11422 2P BG19NUC-LC103 11423 2P BG19NUC-LC104 11424 2F BG19NUC-LC105 11425 RBD BG19NUC-LC106 11426 RBD BG19NUC-LC107 11427 RBD BG19NUC-LC108 11428 2P BG19NUC-LC109 11429 RBD BG19NUC-LC110 11430 2P BG19NUC-LC111 11431 2P BG19NUC-LC112 11432 2P BG19NUC-LC113 11433 RBD BG19NUC-LC114 11434 2P BG19NUC-LC115 11435 2P BG19NUC-LC116 11436 2P BG19NUC-LC117 11437 RBD BG19NUC-LC118 11438 RBD BG19NUC-LC119 11439 RBD BG19NUC-LC120 11440 RBD BG19NUC-LC121 11441 2P BG19NUC-LC122 11442 2P BG19NUC-LC123 11443 2P BG19NUC-LC124 11444 2P BG19NUC-LC125 11445 RBD BG19NUC-LC126 11446 RBD BG19NUC-LC127 11447 2P BG19NUC-LC128 11448 2P BG19NUC-LC129 11449 2P BG19NUC-LC130 11450 2P BG19NUC-LC131 11451 RBD BG19NUC-LC132 11452 2P BG19NUC-LC133 11453 2P BG19NUC-LC134 11454 RBD BG19NUC-LC135 11455 RBD BG19NUC-LC136 11456 2P BG19NUC-LC137 11457 2P BG19NUC-LC138 11458 RBD BG19NUC-LC139 11459 2P BG19NUC-LC140 11460 RBD BG19NUC-LC141 11461 2P BG19NUC-LC142 11462 2P BG19NUC-LC143 11463 2P BG19NUC-LC144 11464 2P BG19NUC-LC145 11465 RBD BG19NUC-LC146 11466 2P BG19NUC-LC147 11467 2P BG19NUC-LC148 11468 2P BG19NUC-LC149 11469 2P BG19NUC-LC150 11470 2P BG19NUC-LC151 11471 RBD BG19NUC-LC152 11472 2P BG19NUC-LC153 11473 2P BG19NUC-LC154 11474 2P BG19NUC-LC155 11475 RBD BG19NUC-LC156 11476 2P BG19NUC-LC157 11477 2P BG19NUC-LC158 11478 2P BG19NUC-LC159 11479 2P BG19NUC-LC160 11480 2P BG19NUC-LC161 11481 2P BG19NUC-LC162 11482 2P BG19NUC-LC163 11483 RBD BG19NUC-LC164 11484 2P BG19NUC-LC165 11485 2P BG19NUC-LC166 11486 RBD BG19NUC-LC167 11487 2P BG19NUC-LC168 11488 2P BG19NUC-LC169 11489 2P BG19NUC-LC170 11490 2P BG19NUC-LC171 11491 2P BG19NUC-LC172 11492 2P BG19NUC-LC173 11493 RBD BG19NUC-LC174 11494 RBD BG19NUC-LC175 11495 2P BG19NUC-LC176 11496 RBD BG19NUC-LC177 11497 RBD BG19NUC-LC178 11498 2P BG19NUC-LC179 11499 2P BG19NUC-LC180 11500 2P BG19NUC-LC181 11501 2P BG19NUC-LC182 11502 RBD BG19NUC-LC183 11503 RBD BG19NUC-LC184 11504 RBD BG19NUC-LC185 11505 RBD BG19NUC-LC186 11506 RBD BG19NUC-LC187 11507 2P BG19NUC-LC188 11508 2P BG19NUC-LC189 11509 RBD BG19NUC-LC190 11510 RBD BG19NUC-LC191 11511 2P BG19NUC-LC192 11512 2P BG19NUC-LC193 11513 2P BG19NUC-LC194 11514 RBD BG19NUC-LC195 11515 RBD BG19NUC-LC196 11516 2P BG19NUC-LC197 11517 RBD BG19NUC-LC198 11518 2P BG19NUC-LC199 11519 RBD BG19NUC-LC200 11520 RBD BG19NUC-LC201 11521 RBD BG19NUC-LC202 11522 RBD BG19NUC-LC203 11523 2P BG19NUC-LC204 11524 2P BG19NUC-LC205 11525 2P BG19NUC-LC206 11526 2P BG19NUC-LC207 11527 2P BG19NUC-LC208 11528 2P BG19NUC-LC209 11529 2P BG19NUC-LC210 11530 2P BG19NUC-LC211 11531 2P BG19NUC-LC212 11532 2P BG19NUC-LC213 11533 RBD BG19NUC-LC214 11534 RBD BG19NUC-LC215 11535 2P BG19NUC-LC216 11536 2P BG19NUC-LC217 11537 RBD BG19NUC-LC218 11538 2P BG19NUC-LC219 11539 2P BG19NUC-LC220 11540 2P BG19NUC-LC221 11541 RBD BG19NUC-LC222 11542 RBD BG19NUC-LC223 11543 2P BG19NUC-LC224 11544 2P BG19NUC-LC225 11545 2P BG19NUC-LC226 11546 2P BG19NUC-LC227 11547 2P BG19NUC-LC228 11548 RBD BG19NUC-LC229 11549 2P BG19NUC-LC230 11550 2P BG19NUC-LC231 11551 RBD BG19NUC-LC232 11552 RBD BG19NUC-LC233 11553 2P BG19NUC-LC234 11554 2P BG19NUC-LC235 11555 2P BG19NUC-LC236 11556 RBD BG19NUC-LC237 11557 RBD BG19NUC-LC238 11558 RBD BG19NUC-LC239 11559 2P BG19NUC-LC240 11560 2P BG19NUC-LC241 11561 2P BG19NUC-LC242 11562 2P BG19NUC-LC243 11563 2P BG19NUC-LC244 11564 RBD BG19NUC-LC245 11565 RBD BG19NUC-LC246 11566 2P BG19NUC-LC247 11567 RBD BG19NUC-LC248 11568 2P BG19NUC-LC249 11569 2P BG19NUC-LC250 11570 2P BG19NUC-LC251 11571 2P BG19NUC-LC252 11572 2P BG19NUC-LC253 11573 RBD BG19NUC-LC254 11574 RBD BG19NUC-LC255 11575 2P BG19NUC-LC256 11576 2P BG19NUC-LC257 11577 RBD BG19NUC-LC258 11578 2P BG19NUC-LC259 11579 2P BG19NUC-LC260 11580 RBD BG19NUC-LC261 11581 2P BG19NUC-LC262 11582 2P BG19NUC-LC263 11583 RBD BG19NUC-LC264 11584 2P BG19NUC-LC265 11585 2P BG19NUC-LC266 11586 2P BG19NUC-LC267 11587 2P BG19NUC-LC268 11588 RBD BG19NUC-LC269 11589 2P BG19NUC-LC270 11590 RBD BG19NUC-LC271 11591 RBD BG19NUC-LC272 11592 RBD BG19NUC-LC273 11593 2P BG19NUC-LC274 11594 RBD BG19NUC-LC275 11595 2P BG20NUC-HC1 11596 2P BG20NUC-HC2 11597 2P BG20NUC-HC3 11598 RBD BG20NUC-HC4 11599 2P BG20NUC-HC5 11600 2P BG20NUC-HC6 11601 2P BG20NUC-HC7 11602 2P BG20NUC-HC8 11603 2P BG20NUC-HC9 11604 2P BG20NUC-HC10 11605 2P BG20NUC-HC11 11606 2P BG20NUC-HC12 11607 RBD BG20NUC-HC13 11608 2P BG20NUC-HC14 11609 2P BG20NUC-HC15 11610 2P BG20NUC-HC16 11611 2P BG20NUC-HC17 11612 RBD BG20NUC-HC18 11613 RBD BG20NUC-HC19 11614 RBD BG20NUC-HC20 11615 2P BG20NUC-HC21 11616 2P BG20NUC-HC22 11617 2P BG20NUC-HC23 11618 2F BG20NUC-HC24 11619 2P BG20NUC-HC25 11620 2F BG20NUC-HC26 11621 2P BG20NUC-HC27 11622 2F BG20NUC-HC28 11623 2P BG20NUC-HC29 11624 2P BG20NUC-HC30 11625 RBD BG20NUC-HC31 11626 2P BG20NUC-HC32 11627 2P BG20NUC-HC33 11628 RBD BG20NUC-HC34 11629 2P BG20NUC-HC35 11630 2P BG20NUC-HC36 11631 2P BG20NUC-HC37 11632 2P BG20NUC-HC38 11633 RBD BG20NUC-HC39 11634 2P BG20NUC-HC40 11635 2P BG20NUC-HC41 11636 2P BG20NUC-HC42 11637 2P BG20NUC-HC43 11638 2P BG20NUC-HC44 11639 RBD BG20NUC-HC45 11640 2P BG20NUC-HC46 11641 2P BG20NUC-HC47 11642 RBD BG20NUC-HC48 11643 RBD BG20NUC-HC49 11644 2P BG20NUC-HC50 11645 2P BG20NUC-HC51 11646 2P BG20NUC-HC52 11647 RBD BG20NUC-HC53 11648 2P BG20NUC-HC54 11649 2P BG20NUC-HC55 11650 2P BG20NUC-HC56 11651 RBD BG20NUC-HC57 11652 2P BG20NUC-HC58 11653 2F BG20NUC-HC59 11654 2P BG20NUC-HC60 11655 2P BG20NUC-HC61 11656 2P BG20NUC-HC62 11657 RBD BG20NUC-HC63 11658 2P BG20NUC-HC64 11659 2P BG20NUC-HC65 11660 2P BG20NUC-HC66 11661 2P BG20NUC-HC67 11662 2P BG20NUC-HC68 11663 2P BG20NUC-HC69 11664 2P BG20NUC-HC70 11665 RBD BG20NUC-HC71 11666 2P BG20NUC-HC72 11667 2P BG20NUC-HC73 11668 2P BG20NUC-HC74 11669 2P BG20NUC-HC75 11670 2P BG20NUC-HC76 11671 2P BG20NUC-HC77 11672 2P BG20NUC-HC78 11673 2P BG20NUC-HC79 11674 2P BG20NUC-HC80 11675 2P BG20NUC-HC81 11676 2P BG20NUC-HC82 11677 2P BG20NUC-HC83 11678 2P BG20NUC-HC84 11679 RBD BG20NUC-HC85 11680 RBD BG20NUC-HC86 11681 2P BG20NUC-HC87 11682 RBD BG20NUC-HC88 11683 RBD BG20NUC-HC89 11684 2P BG20NUC-HC90 11685 RBD BG20NUC-HC91 11686 RBD BG20NUC-HC92 11687 2P BG20NUC-HC93 11688 2P BG20NUC-HC94 11689 2P BG20NUC-HC95 11690 2P BG20NUC-HC96 11691 2P BG20NUC-HC97 11692 2P BG20NUC-HC98 11693 2P BG20NUC-HC99 11694 2P BG20NUC-HC100 11695 2F BG20NUC-HC101 11696 RBD BG20NUC-HC102 11697 2P BG20NUC-HC103 11698 2P BG20NUC-HC104 11699 RBD BG20NUC-HC105 11700 RBD BG20NUC-HC106 11701 RBD BG20NUC-HC107 11702 2P BG20NUC-HC108 11703 2P BG20NUC-HC109 11704 2P BG20NUC-HC110 11705 2P BG20NUC-HC111 11706 2F BG20NUC-HC112 11707 2P BG20NUC-HC113 11708 RBD BG20NUC-HC114 11709 2P BG20NUC-HC115 11710 2P BG20NUC-HC116 11711 2P BG20NUC-HC117 11712 RBD BG20NUC-HC118 11713 2P BG20NUC-HC119 11714 2P BG20NUC-HC120 11715 2P BG20NUC-HC121 11716 2P BG20NUC-HC122 11717 2P BG20NUC-HC123 11718 2P BG20NUC-HC124 11719 2F BG20NUC-HC125 11720 RBD BG20NUC-HC126 11721 2P BG20NUC-HC127 11722 2P BG20NUC-HC128 11723 2P BG20NUC-HC129 11724 RBD BG20NUC-HC130 11725 RBD BG20NUC-HC131 11726 RBD BG20NUC-HC132 11727 2P BG20NUC-HC133 11728 RBD BG20NUC-HC134 11729 2P BG20NUC-HC135 11730 2P BG20NUC-HC136 11731 RBD BG20NUC-HC137 11732 RBD BG20NUC-HC138 11733 RBD BG20NUC-HC139 11734 2P BG20NUC-HC140 11735 RBD BG20NUC-HC141 11736 2P BG20NUC-HC142 11737 2P BG20NUC-HC143 11738 2P BG20NUC-HC144 11739 2P BG20NUC-HC145 11740 2P BG20NUC-HC146 11741 2P BG20NUC-HC147 11742 RBD BG20NUC-HC148 11743 2P BG20NUC-HC149 11744 2F BG20NUC-HC150 11745 RBD BG20NUC-HC151 11746 2P BG20NUC-HC152 11747 RBD BG20NUC-HC153 11748 RBD BG20NUC-HC154 11749 2P BG20NUC-HC155 11750 RBD BG20NUC-HC156 11751 RBD BG20NUC-HC157 11752 RBD BG20NUC-HC158 11753 2P BG20NUC-HC159 11754 2P BG20NUC-HC160 11755 2P BG20NUC-HC161 11756 2P BG20NUC-HC162 11757 RBD BG20NUC-HC163 11758 2P BG20NUC-HC164 11759 RBD BG20NUC-HC165 11760 2P BG20NUC-HC166 11761 2P BG20NUC-HC167 11762 2P BG20NUC-HC168 11763 2P BG20NUC-HC169 11764 2P BG20NUC-HC170 11765 2P BG20NUC-HC171 11766 RBD BG20NUC-HC172 11767 2P BG20NUC-HC173 11768 RBD BG20NUC-HC174 11769 2P BG20NUC-HC175 11770 2P BG20NUC-HC176 11771 2P BG20NUC-LC1 11772 2F BG20NUC-LC2 11773 2P BG20NUC-LC3 11774 RBD BG20NUC-LC4 11775 2P BG20NUC-LC5 11776 2P BG20NUC-LC6 11777 2P BG20NUC-LC7 11778 2P BG20NUC-LC8 11779 2P BG20NUC-LC9 11780 2P BG20NUC-LC10 11781 2F BG20NUC-LC11 11782 2F BG20NUC-LC12 11783 RBD BG20NUC-LC13 11784 2P BG20NUC-LC14 11785 2P BG20NUC-LC15 11786 2P BG20NUC-LC16 11787 2P BG20NUC-LC17 11788 RBD BG20NUC-LC18 11789 RBD BG20NUC-LC19 11790 RBD BG20NUC-LC20 11791 2P BG20NUC-LC21 11792 2F BG20NUC-LC22 11793 2F BG20NUC-LC23 11794 2P BG20NUC-LC24 11795 2P BG20NUC-LC25 11796 2P BG20NUC-LC26 11797 2P BG20NUC-LC27 11798 2P BG20NUC-LC28 11799 2P BG20NUC-LC29 11800 2P BG20NUC-LC30 11801 RBD BG20NUC-LC31 11802 2P BG20NUC-LC32 11803 2F BG20NUC-LC33 11804 RBD BG20NUC-LC34 11805 2P BG20NUC-LC35 11806 2P BG20NUC-LC36 11807 2P BG20NUC-LC37 11808 2P BG20NUC-LC38 11809 RBD BG20NUC-LC39 11810 2P BG20NUC-LC40 11811 2P BG20NUC-LC41 11812 2P BG20NUC-LC42 11813 2P BG20NUC-LC43 11814 2F BG20NUC-LC44 11815 RBD BG20NUC-LC45 11816 2P BG20NUC-LC46 11817 2P BG20NUC-LC47 11818 RBD BG20NUC-LC48 11819 RBD BG20NUC-LC49 11820 2P BG20NUC-LC50 11821 2P BG20NUC-LC51 11822 2P BG20NUC-LC52 11823 RBD BG20NUC-LC53 11824 2P BG20NUC-LC54 11825 2P BG20NUC-LC55 11826 2P BG20NUC-LC56 11827 RBD BG20NUC-LC57 11828 2P BG20NUC-LC58 11829 2P BG20NUC-LC59 11830 2P BG20NUC-LC60 11831 2P BG20NUC-LC61 11832 2P BG20NUC-LC62 11833 RBD BG20NUC-LC63 11834 2P BG20NUC-LC64 11835 2P BG20NUC-LC65 11836 2P BG20NUC-LC66 11837 2P BG20NUC-LC67 11838 2P BG20NUC-LC68 11839 2P BG20NUC-LC69 11840 2F BG20NUC-LC70 11841 RBD BG20NUC-LC71 11842 2P BG20NUC-LC72 11843 2P BG20NUC-LC73 11844 2P BG20NUC-LC74 11845 2P BG20NUC-LC75 11846 2P BG20NUC-LC76 11847 2P BG20NUC-LC77 11848 2P BG20NUC-LC78 11849 2P BG20NUC-LC79 11850 2P BG20NUC-LC80 11851 2P BG20NUC-LC81 11852 2P BG20NUC-LC82 11853 2P BG20NUC-LC83 11854 2P BG20NUC-LC84 11855 RBD BG20NUC-LC85 11856 RBD BG20NUC-LC86 11857 2P BG20NUC-LC87 11858 RBD BG20NUC-LC88 11859 RBD BG20NUC-LC89 11860 2P BG20NUC-LC90 11861 RBD BG20NUC-LC91 11862 RBD BG20NUC-LC92 11863 2P BG20NUC-LC93 11864 2P BG20NUC-LC94 11865 2P BG20NUC-LC95 11866 2P BG20NUC-LC96 11867 2P BG20NUC-LC97 11868 2P BG20NUC-LC98 11869 2P BG20NUC-LC99 11870 2P BG20NUC-LC100 11871 2P BG20NUC-LC101 11872 RBD BG20NUC-LC102 11873 2P BG20NUC-LC103 11874 2F BG20NUC-LC104 11875 RBD BG20NUC-LC105 11876 RBD BG20NUC-LC106 11877 RBD BG20NUC-LC107 11878 2P BG20NUC-LC108 11879 2P BG20NUC-LC109 11880 2P BG20NUC-LC110 11881 2P BG20NUC-LC111 11882 2P BG20NUC-LC112 11883 2P BG20NUC-LC113 11884 RBD BG20NUC-LC114 11885 2P BG20NUC-LC115 11886 2P BG20NUC-LC116 11887 2P BG20NUC-LC117 11888 RBD BG20NUC-LC118 11889 2P BG20NUC-LC119 11890 2P BG20NUC-LC120 11891 2P BG20NUC-LC121 11892 2P BG20NUC-LC122 11893 2P BG20NUC-LC123 11894 2P BG20NUC-LC124 11895 2P BG20NUC-LC125 11896 RBD BG20NUC-LC126 11897 2P BG20NUC-LC127 11898 2P BG20NUC-LC128 11899 2P BG20NUC-LC129 11900 RBD BG20NUC-LC130 11901 RBD BG20NUC-LC131 11902 RBD BG20NUC-LC132 11903 2P BG20NUC-LC133 11904 RBD BG20NUC-LC134 11905 2P BG20NUC-LC135 11906 2P BG20NUC-LC136 11907 RBD BG20NUC-LC137 11908 RBD BG20NUC-LC138 11909 RBD BG20NUC-LC139 11910 2P BG20NUC-LC140 11911 RBD BG20NUC-LC141 11912 2P BG20NUC-LC142 11913 2P BG20NUC-LC143 11914 2P BG20NUC-LC144 11915 2P BG20NUC-LC145 11916 2P BG20NUC-LC146 11917 2P BG20NUC-LC147 11918 RBD BG20NUC-LC148 11919 2P BG20NUC-LC149 11920 2P BG20NUC-LC150 11921 RBD BG20NUC-LC151 11922 2P BG20NUC-LC152 11923 RBD BG20NUC-LC153 11924 RBD BG20NUC-LC154 11925 2P BG20NUC-LC155 11926 RBD BG20NUC-LC156 11927 RBD BG20NUC-LC157 11928 RBD BG20NUC-LC158 11929 2P BG20NUC-LC159 11930 2P BG20NUC-LC160 11931 2P BG20NUC-LC161 11932 2P BG20NUC-LC162 11933 RBD BG20NUC-LC163 11934 2P BG20NUC-LC164 11935 RBD BG20NUC-LC165 11936 2P BG20NUC-LC166 11937 2P BG20NUC-LC167 11938 2P BG20NUC-LC168 11939 2P BG20NUC-LC169 11940 2P BG20NUC-LC170 11941 2P BG20NUC-LC171 11942 RBD BG20NUC-LC172 11943 2P BG20NUC-LC173 11944 RBD BG20NUC-LC174 11945 2P BG20NUC-LC175 11946 2P BG20NUC-LC176 11947 2P BG21NUC-HC1 11948 2P BG21NUC-HC2 11949 RBD BG21NUC-HC3 11950 2P BG21NUC-HC4 11951 2P BG21NUC-HC5 11952 2P BG21NUC-HC6 11953 2P BG21NUC-HC7 11954 2P BG21NUC-HC8 11955 2P BG21NUC-HC9 11956 2P BG21NUC-HC10 11957 2P BG21NUC-HC11 11958 RBD BG21NUC-HC12 11959 2P BG21NUC-HC13 11960 2P BG21NUC-HC14 11961 2P BG21NUC-HC15 11962 2P BG21NUC-HC16 11963 2P BG21NUC-HC17 11964 2P BG21NUC-HC18 11965 2P BG21NUC-HC19 11966 2P BG21NUC-HC20 11967 2P BG21NUC-HC21 11968 RBD BG21NUC-HC22 11969 2P BG21NUC-HC23 11970 2P BG21NUC-HC24 11971 2P BG21NUC-HC25 11972 2P BG21NUC-HC26 11973 RBD BG21NUC-HC27 11974 2P BG21NUC-HC28 11975 2P BG21NUC-HC29 11976 2P BG21NUC-HC30 11977 2P BG21NUC-HC31 11978 2P BG21NUC-HC32 11979 RBD BG21NUC-HC33 11980 2P BG21NUC-HC34 11981 2P BG21NUC-HC35 11982 RBD BG21NUC-HC36 11983 2P BG21NUC-HC37 11984 2P BG21NUC-HC38 11985 2P BG21NUC-HC39 11986 2P BG21NUC-HC40 11987 2P BG21NUC-HC41 11988 RBD BG21NUC-HC42 11989 2P BG21NUC-HC43 11990 2P BG21NUC-HC44 11991 RBD BG21NUC-HC45 11992 2P BG21NUC-HC46 11993 2P BG21NUC-HC47 11994 2P BG21NUC-HC48 11995 2F BG21NUC-HC49 11996 2P BG21NUC-HC50 11997 RBD BG21NUC-HC51 11998 RBD BG21NUC-HC52 11999 2P BG21NUC-HC53 12000 RBD BG21NUC-HC54 12001 2F BG21NUC-HC55 12002 RBD BG21NUC-HC56 12003 2P BG21NUC-HC57 12004 RBD BG21NUC-HC58 12005 RBD BG21NUC-HC59 12006 RBD BG21NUC-HC60 12007 RBD BG21NUC-HC61 12008 RBD BG21NUC-HC62 12009 RBD BG21NUC-HC63 12010 2P BG21NUC-HC64 12011 2P BG21NUC-HC65 12012 RBD BG21NUC-HC66 12013 RBD BG21NUC-HC67 12014 RBD BG21NUC-HC68 12015 2P BG21NUC-HC69 12016 RBD BG21NUC-HC70 12017 RBD BG21NUC-HC71 12018 2P BG21NUC-HC72 12019 RBD BG21NUC-HC73 12020 2P BG21NUC-HC74 12021 2P BG21NUC-HC75 12022 2P BG21NUC-HC76 12023 2P BG21NUC-HC77 12024 2P BG21NUC-HC78 12025 2P BG21NUC-HC79 12026 2P BG21NUC-HC80 12027 RBD BG21NUC-HC81 12028 2P BG21NUC-HC82 12029 2P BG21NUC-HC83 12030 2P BG21NUC-HC84 12031 2P BG21NUC-HC85 12032 2P BG21NUC-HC86 12033 2P BG21NUC-HC87 12034 2P BG21NUC-HC88 12035 RBD BG21NUC-HC89 12036 2P BG21NUC-HC90 12037 2P BG21NUC-HC91 12038 2P BG21NUC-HC92 12039 2P BG21NUC-HC93 12040 2P BG21NUC-HC94 12041 RBD BG21NUC-HC95 12042 2P BG21NUC-HC96 12043 2P BG21NUC-HC97 12044 2P BG21NUC-HC98 12045 2P BG21NUC-HC99 12046 2P BG21NUC-HC100 12047 2P BG21NUC-HC101 12048 2P BG21NUC-HC102 12049 RBD BG21NUC-HC103 12050 RBD BG21NUC-HC104 12051 RBD BG21NUC-HC105 12052 RBD BG21NUC-HC106 12053 2P BG21NUC-HC107 12054 2P BG21NUC-HC108 12055 2P BG21NUC-HC109 12056 2P BG21NUC-HC110 12057 2P BG21NUC-HC111 12058 2P BG21NUC-HC112 12059 2P BG21NUC-HC113 12060 2P BG21NUC-HC114 12061 2P BG21NUC-HC115 12062 2P BG21NUC-HC116 12063 2P BG21NUC-HC117 12064 2P BG21NUC-HC118 12065 2P BG21NUC-HC119 12066 RBD BG21NUC-HC120 12067 2P BG21NUC-HC121 12068 2P BG21NUC-HC122 12069 2P BG21NUC-HC123 12070 2P BG21NUC-HC124 12071 RBD BG21NUC-HC125 12072 2P BG21NUC-HC126 12073 2P BG21NUC-HC127 12074 2P BG21NUC-HC128 12075 2P BG21NUC-HC129 12076 RBD BG21NUC-HC130 12077 RBD BG21NUC-HC131 12078 RBD BG21NUC-HC132 12079 2P BG21NUC-HC133 12080 2P BG21NUC-HC134 12081 RBD BG21NUC-HC135 12082 2P BG21NUC-HC136 12083 2P BG21NUC-HC137 12084 RBD BG21NUC-HC138 12085 2P BG21NUC-HC139 12086 2P BG21NUC-HC140 12087 2P BG21NUC-HC141 12088 RBD BG21NUC-HC142 12089 2P BG21NUC-HC143 12090 2P BG21NUC-HC144 12091 2P BG21NUC-HC145 12092 2F BG21NUC-HC146 12093 2P BG21NUC-HC147 12094 RBD BG21NUC-HC148 12095 RBD BG21NUC-HC149 12096 RBD BG21NUC-HC150 12097 2P BG21NUC-HC151 12098 2P BG21NUC-HC152 12099 2P BG21NUC-HC153 12100 2P BG21NUC-HC154 12101 2P BG21NUC-HC155 12102 RBD BG21NUC-HC156 12103 RBD BG21NUC-HC157 12104 RBD BG21NUC-HC158 12105 RBD BG21NUC-HC159 12106 RBD BG21NUC-HC160 12107 2P BG21NUC-HC161 12108 2P BG21NUC-HC162 12109 RBD BG21NUC-HC163 12110 2P BG21NUC-HC164 12111 2P BG21NUC-HC165 12112 RBD BG21NUC-HC166 12113 2P BG21NUC-HC167 12114 2P BG21NUC-HC168 12115 2P BG21NUC-HC169 12116 2P BG21NUC-HC170 12117 2P BG21NUC-HC171 12118 2P BG21NUC-HC172 12119 2P BG21NUC-HC173 12120 2P BG21NUC-HC174 12121 2P BG21NUC-HC175 12122 2P BG21NUC-HC176 12123 2P BG21NUC-HC177 12124 2P BG21NUC-HC178 12125 2P BG21NUC-HC179 12126 2P BG21NUC-HC180 12127 2P BG21NUC-HC181 12128 2P BG21NUC-HC182 12129 2P BG21NUC-HC183 12130 RBD BG21NUC-HC184 12131 2P BG21NUC-HC185 12132 2P BG21NUC-HC186 12133 RBD BG21NUC-HC187 12134 RBD BG21NUC-HC188 12135 RBD BG21NUC-HC189 12136 2P BG21NUC-HC190 12137 2P BG21NUC-HC191 12138 RBD BG21NUC-HC192 12139 RBD BG21NUC-HC193 12140 2P BG21NUC-HC194 12141 2P BG21NUC-HC195 12142 2P BG21NUC-HC196 12143 2P BG21NUC-HC197 12144 2P BG21NUC-HC198 12145 2P BG21NUC-HC199 12146 RBD BG21NUC-HC200 12147 RBD BG21NUC-HC201 12148 2P BG21NUC-HC202 12149 RBD BG21NUC-HC203 12150 2P BG21NUC-HC204 12151 2P BG21NUC-HC205 12152 2P BG21NUC-HC206 12153 2P BG21NUC-HC207 12154 2P BG21NUC-HC208 12155 2P BG21NUC-HC209 12156 2P BG21NUC-HC210 12157 RBD BG21NUC-HC211 12158 2P BG21NUC-HC212 12159 2P BG21NUC-HC213 12160 2P BG21NUC-HC214 12161 2P BG21NUC-HC215 12162 2P BG21NUC-HC216 12163 2P BG21NUC-HC217 12164 2P BG21NUC-HC218 12165 RBD BG21NUC-HC219 12166 2P BG21NUC-HC220 12167 RBD BG21NUC-HC221 12168 2P BG21NUC-HC222 12169 RBD BG21NUC-HC223 12170 2P BG21NUC-HC224 12171 2P BG21NUC-HC225 12172 2P BG21NUC-HC226 12173 2P BG21NUC-HC227 12174 2P BG21NUC-HC228 12175 2P BG21NUC-HC229 12176 2P BG21NUC-HC230 12177 2P BG21NUC-HC231 12178 2P BG21NUC-HC232 12179 2P BG21NUC-HC233 12180 2P BG21NUC-HC234 12181 2P BG21NUC-HC235 12182 2P BG21NUC-HC236 12183 2P BG21NUC-HC237 12184 2P BG21NUC-HC238 12185 2P BG21NUC-HC239 12186 RBD BG21NUC-HC240 12187 2P BG21NUC-HC241 12188 2P BG21NUC-HC242 12189 RBD BG21NUC-HC243 12190 RBD BG21NUC-HC244 12191 2P BG21NUC-HC245 12192 RBD BG21NUC-HC246 12193 RBD BG21NUC-HC247 12194 RBD BG21NUC-HC248 12195 2P BG21NUC-HC249 12196 2P BG21NUC-HC250 12197 RBD BG21NUC-HC251 12198 2P BG21NUC-HC252 12199 2P BG21NUC-HC253 12200 2P BG21NUC-HC254 12201 2P BG21NUC-HC255 12202 2P BG21NUC-HC256 12203 RBD BG21NUC-HC257 12204 2P BG21NUC-HC258 12205 2P BG21NUC-HC259 12206 2P BG21NUC-HC260 12207 2P BG21NUC-HC261 12208 2P BG21NUC-HC262 12209 RBD BG21NUC-HC263 12210 2P BG21NUC-HC264 12211 2P BG21NUC-HC265 12212 RBD BG21NUC-HC266 12213 2P BG21NUC-HC267 12214 2P BG21NUC-HC268 12215 2P BG21NUC-HC269 12216 2P BG21NUC-HC270 12217 2P BG21NUC-HC271 12218 2P BG21NUC-HC272 12219 2P BG21NUC-HC273 12220 2P BG21NUC-HC274 12221 2P BG21NUC-HC275 12222 2P BG21NUC-HC276 12223 2P BG21NUC-HC277 12224 2P BG21NUC-HC278 12225 2P BG21NUC-HC279 12226 RBD BG21NUC-HC280 12227 2P BG21NUC-HC281 12228 RBD BG21NUC-HC282 12229 2P BG21NUC-HC283 12230 2P BG21NUC-HC284 12231 RBD BG21NUC-HC285 12232 2P BG21NUC-HC286 12233 RBD BG21NUC-HC287 12234 RBD BG21NUC-HC288 12235 2P BG21NUC-HC289 12236 2P BG21NUC-HC290 12237 2P BG21NUC-HC291 12238 RBD BG21NUC-HC292 12239 2P BG21NUC-HC293 12240 2P BG21NUC-HC294 12241 RBD BG21NUC-HC295 12242 2P BG21NUC-HC296 12243 2P BG21NUC-HC297 12244 2P BG21NUC-HC298 12245 2P BG21NUC-HC299 12246 2P BG21NUC-HC300 12247 2P BG21NUC-HC301 12248 2P BG21NUC-HC302 12249 2P BG21NUC-HC303 12250 2P BG21NUC-HC304 12251 RBD BG21NUC-HC305 12252 2P BG21NUC-HC306 12253 2P BG21NUC-HC307 12254 RBD BG21NUC-HC308 12255 RBD BG21NUC-HC309 12256 RBD BG21NUC-HC310 12257 2P BG21NUC-HC311 12258 2P BG21NUC-HC312 12259 2P BG21NUC-HC313 12260 2P BG21NUC-HC314 12261 RBD BG21NUC-HC315 12262 2P BG21NUC-HC316 12263 RBD BG21NUC-HC317 12264 2P BG21NUC-HC318 12265 2P BG21NUC-HC319 12266 2P BG21NUC-HC320 12267 RBD BG21NUC-HC321 12268 2F BG21NUC-HC322 12269 2P BG21NUC-HC323 12270 2P BG21NUC-HC324 12271 2P BG21NUC-HC325 12272 RBD BG21NUC-HC326 12273 2P BG21NUC-HC327 12274 RBD BG21NUC-HC328 12275 2P BG21NUC-HC329 12276 2P BG21NUC-HC330 12277 2P BG21NUC-HC331 12278 2P BG21NUC-HC332 12279 2P BG21NUC-HC333 12280 2P BG21NUC-HC334 12281 RBD BG21NUC-HC335 12282 2P BG21NUC-HC336 12283 RBD BG21NUC-HC337 12284 RBD BG21NUC-HC338 12285 RBD BG21NUC-HC339 12286 2P BG21NUC-HC340 12287 2P BG21NUC-HC341 12288 2P BG21NUC-HC342 12289 2P BG21NUC-HC343 12290 2P BG21NUC-HC344 12291 RBD BG21NUC-HC345 12292 2P BG21NUC-HC346 12293 2P BG21NUC-HC347 12294 2P BG21NUC-HC348 12295 2P BG21NUC-HC349 12296 2P BG21NUC-HC350 12297 2P BG21NUC-HC351 12298 2P BG21NUC-HC352 12299 RBD BG21NUC-HC353 12300 2P BG21NUC-HC354 12301 2P BG21NUC-HC355 12302 2P BG21NUC-HC356 12303 2P BG21NUC-HC357 12304 2P BG21NUC-HC358 12305 2P BG21NUC-HC359 12306 2P BG21NUC-HC360 12307 RBD BG21NUC-HC361 12308 2F BG21NUC-HC362 12309 2P BG21NUC-HC363 12310 2P BG21NUC-LC1 12311 2P BG21NUC-LC2 12312 RBD BG21NUC-LC3 12313 2P BG21NUC-LC4 12314 2P BG21NUC-LC5 12315 2P BG21NUC-LC6 12316 2P BG21NUC-LC7 12317 2P BG21NUC-LC8 12318 2P BG21NUC-LC9 12319 2P BG21NUC-LC10 12320 2F BG21NUC-LC11 12321 RBD BG21NUC-LC12 12322 2P BG21NUC-LC13 12323 2P BG21NUC-LC14 12324 2P BG21NUC-LC15 12325 2P BG21NUC-LC16 12326 2P BG21NUC-LC17 12327 2P BG21NUC-LC18 12328 2P BG21NUC-LC19 12329 2P BG21NUC-LC20 12330 2P BG21NUC-LC21 12331 RBD BG21NUC-LC22 12332 2P BG21NUC-LC23 12333 2F BG21NUC-LC24 12334 2P BG21NUC-LC25 12335 2P BG21NUC-LC26 12336 RBD BG21NUC-LC27 12337 2P BG21NUC-LC28 12338 2P BG21NUC-LC29 12339 2P BG21NUC-LC30 12340 2P BG21NUC-LC31 12341 2P BG21NUC-LC32 12342 RBD BG21NUC-LC33 12343 2P BG21NUC-LC34 12344 2P BG21NUC-LC35 12345 RBD BG21NUC-LC36 12346 2P BG21NUC-LC37 12347 2P BG21NUC-LC38 12348 2P BG21NUC-LC39 12349 2P BG21NUC-LC40 12350 2P BG21NUC-LC41 12351 RBD BG21NUC-LC42 12352 2P BG21NUC-LC43 12353 2P BG21NUC-LC44 12354 RBD BG21NUC-LC45 12355 2P BG21NUC-LC46 12356 2P BG21NUC-LC47 12357 2P BG21NUC-LC48 12358 2P BG21NUC-LC49 12359 2P BG21NUC-LC50 12360 RBD BG21NUC-LC51 12361 RBD BG21NUC-LC52 12362 2P BG21NUC-LC53 12363 RBD BG21NUC-LC54 12364 2P BG21NUC-LC55 12365 RBD BG21NUC-LC56 12366 2P BG21NUC-LC57 12367 RBD BG21NUC-LC58 12368 RBD BG21NUC-LC59 12369 RBD BG21NUC-LC60 12370 RBD BG21NUC-LC61 12371 RBD BG21NUC-LC62 12372 RBD BG21NUC-LC63 12373 2P BG21NUC-LC64 12374 2P BG21NUC-LC65 12375 RBD BG21NUC-LC66 12376 RBD BG21NUC-LC67 12377 RBD BG21NUC-LC68 12378 2P BG21NUC-LC69 12379 RBD BG21NUC-LC70 12380 RBD BG21NUC-LC71 12381 2P BG21NUC-LC72 12382 RBD BG21NUC-LC73 12383 2P BG21NUC-LC74 12384 2P BG21NUC-LC75 12385 2P BG21NUC-LC76 12386 2P BG21NUC-LC77 12387 2P BG21NUC-LC78 12388 2P BG21NUC-LC79 12389 2P BG21NUC-LC80 12390 RBD BG21NUC-LC81 12391 2P BG21NUC-LC82 12392 2P BG21NUC-LC83 12393 2P BG21NUC-LC84 12394 2P BG21NUC-LC85 12395 2P BG21NUC-LC86 12396 2P BG21NUC-LC87 12397 2P BG21NUC-LC88 12398 RBD BG21NUC-LC89 12399 2P BG21NUC-LC90 12400 2P BG21NUC-LC91 12401 2P BG21NUC-LC92 12402 2P BG21NUC-LC93 12403 2P BG21NUC-LC94 12404 RBD BG21NUC-LC95 12405 2P BG21NUC-LC96 12406 2P BG21NUC-LC97 12407 2P BG21NUC-LC98 12408 2P BG21NUC-LC99 12409 2P BG21NUC-LC100 12410 2P BG21NUC-LC101 12411 2P BG21NUC-LC102 12412 RBD BG21NUC-LC103 12413 RBD BG21NUC-LC104 12414 RBD BG21NUC-LC105 12415 RBD BG21NUC-LC106 12416 2P BG21NUC-LC107 12417 2P BG21NUC-LC108 12418 2P BG21NUC-LC109 12419 2P BG21NUC-LC110 12420 2P BG21NUC-LC111 12421 2P BG21NUC-LC112 12422 2P BG21NUC-LC113 12423 2P BG21NUC-LC114 12424 2P BG21NUC-LC115 12425 2P BG21NUC-LC116 12426 2P BG21NUC-LC117 12427 2P BG21NUC-LC118 12428 2P BG21NUC-LC119 12429 RBD BG21NUC-LC120 12430 2P BG21NUC-LC121 12431 2P BG21NUC-LC122 12432 2P BG21NUC-LC123 12433 2P BG21NUC-LC124 12434 RBD BG21NUC-LC125 12435 2P BG21NUC-LC126 12436 2P BG21NUC-LC127 12437 2P BG21NUC-LC128 12438 2P BG21NUC-LC129 12439 RBD BG21NUC-LC130 12440 RBD BG21NUC-LC131 12441 RBD BG21NUC-LC132 12442 2P BG21NUC-LC133 12443 2P BG21NUC-LC134 12444 RBD BG21NUC-LC135 12445 2P BG21NUC-LC136 12446 2P BG21NUC-LC137 12447 RBD BG21NUC-LC138 12448 2P BG21NUC-LC139 12449 2P BG21NUC-LC140 12450 2P BG21NUC-LC141 12451 RBD BG21NUC-LC142 12452 2P BG21NUC-LC143 12453 2P BG21NUC-LC144 12454 2P BG21NUC-LC145 12455 2P BG21NUC-LC146 12456 2F BG21NUC-LC147 12457 RBD BG21NUC-LC148 12458 RBD BG21NUC-LC149 12459 RBD BG21NUC-LC150 12460 2P BG21NUC-LC151 12461 2P BG21NUC-LC152 12462 2P BG21NUC-LC153 12463 2P BG21NUC-LC154 12464 2P BG21NUC-LC155 12465 RBD BG21NUC-LC156 12466 RBD BG21NUC-LC157 12467 RBD BG21NUC-LC158 12468 RBD BG21NUC-LC159 12469 RBD BG21NUC-LC160 12470 2P BG21NUC-LC161 12471 2P BG21NUC-LC162 12472 RBD BG21NUC-LC163 12473 2P BG21NUC-LC164 12474 2P BG21NUC-LC165 12475 RBD BG21NUC-LC166 12476 2P BG21NUC-LC167 12477 2P BG21NUC-LC168 12478 2P BG21NUC-LC169 12479 2P BG21NUC-LC170 12480 2P BG21NUC-LC171 12481 2P BG21NUC-LC172 12482 2P BG21NUC-LC173 12483 2P BG21NUC-LC174 12484 2F BG21NUC-LC175 12485 2F BG21NUC-LC176 12486 2P BG21NUC-LC177 12487 2P BG21NUC-LC178 12488 2F BG21NUC-LC179 12489 2F BG21NUC-LC180 12490 2F BG21NUC-LC181 12491 2P BG21NUC-LC182 12492 2P BG21NUC-LC183 12493 RBD BG21NUC-LC184 12494 2P BG21NUC-LC185 12495 2P BG21NUC-LC186 12496 RBD BG21NUC-LC187 12497 RBD BG21NUC-LC188 12498 RBD BG21NUC-LC189 12499 2P BG21NUC-LC190 12500 2P BG21NUC-LC191 12501 RBD BG21NUC-LC192 12502 RBD BG21NUC-LC193 12503 2P BG21NUC-LC194 12504 2P BG21NUC-LC195 12505 2P BG21NUC-LC196 12506 2F BG21NUC-LC197 12507 2P BG21NUC-LC198 12508 2P BG21NUC-LC199 12509 RBD BG21NUC-LC200 12510 RBD BG21NUC-LC201 12511 2P BG21NUC-LC202 12512 RBD BG21NUC-LC203 12513 2P BG21NUC-LC204 12514 2F BG21NUC-LC205 12515 2P BG21NUC-LC206 12516 2P BG21NUC-LC207 12517 2P BG21NUC-LC208 12518 2F BG21NUC-LC209 12519 2P BG21NUC-LC210 12520 RBD BG21NUC-LC211 12521 2P BG21NUC-LC212 12522 2F BG21NUC-LC213 12523 2P BG21NUC-LC214 12524 2P BG21NUC-LC215 12525 2P BG21NUC-LC216 12526 2P BG21NUC-LC217 12527 2P BG21NUC-LC218 12528 RBD BG21NUC-LC219 12529 2P BG21NUC-LC220 12530 RBD BG21NUC-LC221 12531 2P BG21NUC-LC222 12532 RBD BG21NUC-LC223 12533 2P BG21NUC-LC224 12534 2F BG21NUC-LC225 12535 2P BG21NUC-LC226 12536 2F BG21NUC-LC227 12537 2F BG21NUC-LC228 12538 2F BG21NUC-LC229 12539 2F BG21NUC-LC230 12540 2P BG21NUC-LC231 12541 2P BG21NUC-LC232 12542 2P BG21NUC-LC233 12543 2P BG21NUC-LC234 12544 2P BG21NUC-LC235 12545 2P BG21NUC-LC236 12546 2P BG21NUC-LC237 12547 2P BG21NUC-LC238 12548 2P BG21NUC-LC239 12549 RBD BG21NUC-LC240 12550 2P BG21NUC-LC241 12551 2P BG21NUC-LC242 12552 RBD BG21NUC-LC243 12553 RBD BG21NUC-LC244 12554 2P BG21NUC-LC245 12555 RBD BG21NUC-LC246 12556 RBD BG21NUC-LC247 12557 RBD BG21NUC-LC248 12558 2P BG21NUC-LC249 12559 2P BG21NUC-LC250 12560 RBD BG21NUC-LC251 12561 2P BG21NUC-LC252 12562 2P BG21NUC-LC253 12563 2P BG21NUC-LC254 12564 2P BG21NUC-LC255 12565 2P BG21NUC-LC256 12566 RBD BG21NUC-LC257 12567 2P BG21NUC-LC258 12568 2P BG21NUC-LC259 12569 2P BG21NUC-LC260 12570 2P BG21NUC-LC261 12571 2P BG21NUC-LC262 12572 RBD BG21NUC-LC263 12573 2P BG21NUC-LC264 12574 2P BG21NUC-LC265 12575 RBD BG21NUC-LC266 12576 2P BG21NUC-LC267 12577 2P BG21NUC-LC268 12578 2P BG21NUC-LC269 12579 2P BG21NUC-LC270 12580 2P BG21NUC-LC271 12581 2P BG21NUC-LC272 12582 2P BG21NUC-LC273 12583 2P BG21NUC-LC274 12584 2P BG21NUC-LC275 12585 2P BG21NUC-LC276 12586 2P BG21NUC-LC277 12587 2P BG21NUC-LC278 12588 2P BG21NUC-LC279 12589 RBD BG21NUC-LC280 12590 2P BG21NUC-LC281 12591 RBD BG21NUC-LC282 12592 2P BG21NUC-LC283 12593 2P BG21NUC-LC284 12594 RBD BG21NUC-LC285 12595 2F BG21NUC-LC286 12596 RBD BG21NUC-LC287 12597 RBD BG21NUC-LC288 12598 2P BG21NUC-LC289 12599 2P BG21NUC-LC290 12600 2P BG21NUC-LC291 12601 RBD BG21NUC-LC292 12602 2P BG21NUC-LC293 12603 2P BG21NUC-LC294 12604 RBD BG21NUC-LC295 12605 2P BG21NUC-LC296 12606 2P BG21NUC-LC297 12607 2P BG21NUC-LC298 12608 2P BG21NUC-LC299 12609 2P BG21NUC-LC300 12610 2P BG21NUC-LC301 12611 2P BG21NUC-LC302 12612 2P BG21NUC-LC303 12613 2P BG21NUC-LC304 12614 RBD BG21NUC-LC305 12615 2P BG21NUC-LC306 12616 2P BG21NUC-LC307 12617 RBD BG21NUC-LC308 12618 RBD BG21NUC-LC309 12619 RBD BG21NUC-LC310 12620 2P BG21NUC-LC311 12621 2P BG21NUC-LC312 12622 2P BG21NUC-LC313 12623 2P BG21NUC-LC314 12624 RBD BG21NUC-LC315 12625 2P BG21NUC-LC316 12626 RBD BG21NUC-LC317 12627 2P BG21NUC-LC318 12628 2P BG21NUC-LC319 12629 2P BG21NUC-LC320 12630 RBD BG21NUC-LC321 12631 2P BG21NUC-LC322 12632 2F BG21NUC-LC323 12633 2P BG21NUC-LC324 12634 2F BG21NUC-LC325 12635 RBD BG21NUC-LC326 12636 2F BG21NUC-LC327 12637 RBD BG21NUC-LC328 12638 2F BG21NUC-LC329 12639 2P BG21NUC-LC330 12640 2F BG21NUC-LC331 12641 2P BG21NUC-LC332 12642 2F BG21NUC-LC333 12643 2F BG21NUC-LC334 12644 RBD BG21NUC-LC335 12645 2P BG21NUC-LC336 12646 RBD BG21NUC-LC337 12647 RBD BG21NUC-LC338 12648 RBD BG21NUC-LC339 12649 2F BG21NUC-LC340 12650 2P BG21NUC-LC341 12651 2F BG21NUC-LC342 12652 2P BG21NUC-LC343 12653 2F BG21NUC-LC344 12654 RBD BG21NUC-LC345 12655 2P BG21NUC-LC346 12656 2P BG21NUC-LC347 12657 2F BG21NUC-LC348 12658 2P BG21NUC-LC349 12659 2F BG21NUC-LC350 12660 2P BG21NUC-LC351 12661 2F BG21NUC-LC352 12662 RBD BG21NUC-LC353 12663 2F BG21NUC-LC354 12664 2F BG21NUC-LC355 12665 2F BG21NUC-LC356 12666 2P BG21NUC-LC357 12667 2P BG21NUC-LC358 12668 2P BG21NUC-LC359 12669 2P BG21NUC-LC360 12670 RBD BG21NUC-LC361 12671 2F BG21NUC-LC362 12672 2P BG21NUC-LC363

    TABLE-US-00009 TABLE8B SEQ BAIT Produced SEQ BAIT Produced IDNO USED SEQUENCENAME AntibodyName IDNO USED SEQUENCENAME AntibodyName 447 RBD BG1NUC-HC1 BG1-1 2271 2P BG4NUC-LC40 BG4-12 456 RBD BG1NUC-HC10 BG1-3 2273 RBD BG4NUC-LC42 BG4-13 459 RBD BG1NUC-HC13 BG1-4 2275 2P BG4NUC-LC44 BG4-14 462 RBD BG1NUC-HC16 BG1-5 2277 2P BG4NUC-LC46 BG4-15 466 RBD BG1NUC-HC20 BG1-6 2279 RBD BG4NUC-LC48 BG4-16 467 2P BG1NUC-HC21 BG1-7 2281 2P BG4NUC-LC50 BG4-17 469 2P BG1NUC-HC23 BG1-8 2283 2P BG4NUC-LC52 BG4-18 471 RBD BG1NUC-HC25 BG1-9 2285 RBD BG4NUC-LC54 BG4-19 473 RBD BG1NUC-HC27 BG1-10 2288 2P BG4NUC-LC57 BG4-20 475 RBD BG1NUC-HC29 BG1-11 2289 RBD BG4NUC-LC58 BG4-21 477 RBD BG1NUC-HC31 BG1-12 2364 2P BG4NUC-LC133 BG4-22 479 2P BG1NUC-HC33 BG1-13 2389 RBD BG4NUC-LC158 BG4-23 481 RBD BG1NUC-HC35 BG1-14 2448 RBD BG4NUC-LC217 BG4-24 483 RBD BG1NUC-HC37 BG1-15 2460 2P BG4NUC-LC229 BG4-25 485 2P BG1NUC-HC39 BG1-16 2537 RBD BG4NUC-LC306 BG4-26 487 RBD BG1NUC-HC41 BG1-17 2614 2P BG4NUC-LC383 BG4-27 489 2F BG1NUC-HC43 BG1-18 4085 2P BG7NUC-HC1 BG7-1 514 RBD BG1NUC-HC68 BG1-19 4097 2P BG7NUC-HC13 BG7-2 528 2P BG1NUC-HC82 BG1-20 4106 2P BG7NUC-HC22 BG7-3 536 RBD BG1NUC-HC90 BG1-21 4115 2P BG7NUC-HC31 BG7-4 542 RBD BG1NUC-HC96 BG1-22 4121 2P BG7NUC-HC37 BG7-5 548 RBD BG1NUC-HC102 BG1-23 4126 2P BG7NUC-HC42 BG7-6 571 RBD BG1NUC-HC125 BG1-24 4129 2P BG7NUC-HC45 BG7-8 602 RBD BG1NUC-HC156 BG1-25 4132 2P BG7NUC-HC48 BG7-9 634 RBD BG1NUC-HC188 BG1-26 4134 2P BG7NUC-HC50 BG7-10 690 RBD BG1NUC-HC244 BG1-27 4136 2P BG7NUC-HC52 BG7-11 701 RBD BG1NUC-HC255 BG1-28 4138 2P BG7NUC-HC54 BG7-12 755 RBD BG1NUC-LC1 BG1-1 4140 2P BG7NUC-HC56 BG7-13 764 RBD BG1NUC-LC10 BG1-3 4346 RBD BG7NUC-HC262 BG7-14 767 RBD BG1NUC-LC13 BG1-4 4369 RBD BG7NUC-HC285 BG7-15 770 RBD BG1NUC-LC16 BG1-5 4372 RBD BG7NUC-HC288 BG7-16 774 RBD BG1NUC-LC20 BG1-6 4386 RBD BG7NUC-HC302 BG7-17 775 2P BG1NUC-LC21 BG1-7 4393 RBD BG7NUC-HC309 BG7-18 777 2P BG1NUC-LC23 BG1-8 4402 RBD BG7NUC-HC318 BG7-19 779 RBD BG1NUC-LC25 BG1-9 4414 RBD BG7NUC-HC330 BG7-20 781 RBD BG1NUC-LC27 BG1-10 4482 2P BG7NUC-LC1 BG7-1 783 RBD BG1NUC-LC29 BG1-11 4494 2P BG7NUC-LC13 BG7-2 785 RBD BG1NUC-LC31 BG1-12 4503 2P BG7NUC-LC22 BG7-3 787 2P BG1NUC-LC33 BG1-13 4512 2P BG7NUC-LC31 BG7-4 789 RBD BG1NUC-LC35 BG1-14 4518 2P BG7NUC-LC37 BG7-5 791 RBD BG1NUC-LC37 BG1-15 4523 2P BG7NUC-LC42 BG7-6 793 2P BG1NUC-LC39 BG1-16 4526 2P BG7NUC-LC45 BG7-8 795 RBD BG1NUC-LC41 BG1-17 4529 2P BG7NUC-LC48 BG7-9 797 2P BG1NUC-LC43 BG1-18 4531 2P BG7NUC-LC50 BG7-10 822 RBD BG1NUC-LC68 BG1-19 4533 2P BG7NUC-LC52 BG7-11 836 2P BG1NUC-LC82 BG1-20 4535 2P BG7NUC-LC54 BG7-12 844 RBD BG1NUC-LC90 BG1-21 4537 2P BG7NUC-LC56 BG7-13 850 RBD BG1NUC-LC96 BG1-22 4743 RBD BG7NUC-LC262 BG7-14 856 RBD BG1NUC-LC102 BG1-23 4766 RBD BG7NUC-LC285 BG7-15 879 RBD BG1NUC-LC125 BG1-24 4769 RBD BG7NUC-LC288 BG7-16 910 RBD BG1NUC-LC156 BG1-25 4783 RBD BG7NUC-LC302 BG7-17 942 RBD BG1NUC-LC188 BG1-26 4790 RBD BG7NUC-LC309 BG7-18 998 RBD BG1NUC-LC244 BG1-27 4799 RBD BG7NUC-LC318 BG7-19 1009 RBD BG1NUC-LC255 BG1-28 4811 RBD BG7NUC-LC330 BG7-20 1823 2F BG4NUC-HC1 BG4-1 5347 RBD BG10NUC-HC1 BG10-1 1834 2P BG4NUC-HC12 BG4-2 5383 RBD BG10NUC-HC37 BG10-2 1838 2P BG4NUC-HC16 BG4-3 5398 RBD BG10NUC-HC52 BG10-3 1843 2F BG4NUC-HC21 BG4-4 5407 RBD BG10NUC-HC61 BG10-4 1845 RBD BG4NUC-HC23 BG4-5 5416 RBD BG10NUC-HC70 BG10-5 1847 RBD BG4NUC-HC25 BG4-6 5424 RBD BG10NUC-HC78 BG10-6 1850 RBD BG4NUC-HC28 BG4-7 5431 RBD BG10NUC-HC85 BG10-7 1853 RBD BG4NUC-HC31 BG4-8 5436 RBD BG10NUC-HC90 BG10-8 1856 RBD BG4NUC-HC34 BG4-9 5441 2P BG10NUC-HC95 BG10-9 1859 RBD BG4NUC-HC37 BG4-10 5446 RBD BG10NUC-HC100 BG10-10 1860 RBD BG4NUC-HC38 BG4-11 5450 RBD BG10NUC-HC104 BG10-11 1862 2P BG4NUC-HC40 BG4-12 5453 2P BG10NUC-HC107 BG10-12 1864 RBD BG4NUC-HC42 BG4-13 5457 RBD BG10NUC-HC111 BG10-13 1866 2P BG4NUC-HC44 BG4-14 5459 2P BG10NUC-HC113 BG10-14 1868 2F BG4NUC-HC46 BG4-15 5461 RBD BG10NUC-HC115 BG10-15 1870 RBD BG4NUC-HC48 BG4-16 5467 2P BG10NUC-HC121 BG10-16 1872 2F BG4NUC-HC50 BG4-17 5471 2P BG10NUC-HC125 BG10-17 1874 2P BG4NUC-HC52 BG4-18 5473 RBD BG10NUC-HC127 BG10-18 1876 RBD BG4NUC-HC54 BG4-19 5475 RBD BG10NUC-HC129 BG10-19 1879 2P BG4NUC-HC57 BG4-20 5774 RBD BG10NUC-LC1 BG10-1 1880 RBD BG4NUC-HC58 BG4-21 5810 RBD BG10NUC-LC37 BG10-2 1955 2P BG4NUC-HC133 BG4-22 5825 RBD BG10NUC-LC52 BG10-3 1980 RBD BG4NUC-HC158 BG4-23 5834 RBD BG10NUC-LC61 BG10-4 2039 RBD BG4NUC-HC217 BG4-24 5843 RBD BG10NUC-LC70 BG10-5 2051 2P BG4NUC-HC229 BG4-25 5851 RBD BG10NUC-LC78 BG10-6 2128 RBD BG4NUC-HC306 BG4-26 5858 RBD BG10NUC-LC85 BG10-7 2205 2P BG4NUC-HC383 BG4-27 5863 RBD BG10NUC-LC90 BG10-8 2232 2P BG4NUC-LC1 BG4-1 5868 2P BG10NUC-LC95 BG10-9 2243 2P BG4NUC-LC12 BG4-2 5873 RBD BG10NUC-LC100 BG10-10 2247 2P BG4NUC-LC16 BG4-3 5877 RBD BG10NUC-LC104 BG10-11 2252 2P BG4NUC-LC21 BG4-4 5880 2P BG10NUC-LC107 BG10-12 2254 RBD BG4NUC-LC23 BG4-5 5884 RBD BG10NUC-LC111 BG10-13 2256 RBD BG4NUC-LC25 BG4-6 5886 2P BG10NUC-LC113 BG10-14 2259 RBD BG4NUC-LC28 BG4-7 5888 RBD BG10NUC-LC115 BG10-15 2262 RBD BG4NUC-LC31 BG4-8 5894 2P BG10NUC-LC121 BG10-16 2265 RBD BG4NUC-LC34 BG4-9 5898 2P BG10NUC-LC125 BG10-17 2268 RBD BG4NUC-LC37 BG4-10 5900 RBD BG10NUC-LC127 BG10-18 2269 RBD BG4NUC-LC38 BG4-11 5902 RBD BG10NUC-LC129 BG10-19

    REFERENCES

    [0216] Adams, P. D., Afonine, P. V., Bunkoczi, G., Chen, V. B., Davis, I. W., Echols, N., Headd, J. J., Hung, L. W., Kapral, G. J., Grosse-Kunstleve, R. W., et al. (2010). PHENIX: a comprehensive Python-based system for macromolecular structure solution. Acta Crystallogr D Biol Crystallogr 66, 213-221. [0217] Barnes, C. O., Jette, C. A., Abernathy, M. E., Dam, K.-M. A., Esswein, S. R., Gristick, H. B., Malyutin, A. G., Sharaf, N. G., Huey-Tubman, K. E., Lee, Y. E., et al. (2020a). SARS-COV-2 neutralizing antibody structures inform therapeutic strategies. Nature. [0218] Barnes, C. O., West, A. P., Jr., Huey-Tubman, K. E., Hoffmann, M. A. G., Sharaf, N. G., Hoffman, P. R., Koranda, N., Gristick, H. B., Gaebler, C., Muecksch, F., et al. (2020b). Structures of Human Antibodies Bound to SARS-COV-2 Spike Reveal Common Epitopes and Recurrent Features of Antibodies. Cell 182, 828-842 e816. [0219] Baum, A., Fulton, B. O., Wloga, E., Copin, R., Pascal, K. E., Russo, V., Giordano, S., Lanza, K., Negron, N., Ni, M., et al. (2020). Antibody cocktail to SARS-COV-2 spike protein prevents rapid mutational escape seen with individual antibodies. Science 369, 1014-1018. [0220] Bournazos, S., Gupta, A., and Ravetch, J. V. (2020). The role of IgG Fc receptors in antibody-dependent enhancement. Nat Rev Immunol 20, 633-643. [0221] Brouwer, P. J. M., Caniels, T. G., van der Straten, K., Snitselaar, J. L., Aldon, Y., Bangaru, S., Torres, J. L., Okba, N. M. A., Claireaux, M., Kerster, G., et al. (2020). Potent neutralizing antibodies from COVID-19 patients define multiple targets of vulnerability. Science 369, 643-650. [0222] Butler, A., Hoffman, P., Smibert, P., Papalexi, E., and Satija, R. (2018). Integrating single-cell transcriptomic data across different conditions, technologies, and species. Nat Biotechnol 36, 411-420. [0223] Cao, Y., Su, B., Guo, X., Sun, W., Deng, Y., Bao, L., Zhu, Q., Zhang, X., Zheng, Y., Geng, C., et al. (2020a). Potent neutralizing antibodies against SARS-COV-2 identified by high-throughput single-cell sequencing of convalescent patients' B cells. Cell. [0224] Cao, Y., Su, B., Guo, X., Sun, W., Deng, Y., Bao, L., Zhu, Q., Zhang, X., Zheng, Y., Geng, C., et al. (2020b). Potent Neutralizing Antibodies against SARS-COV-2 Identified by High-Throughput Single-Cell Sequencing of Convalescent Patients' B Cells. Cell 182, 73-84 e16. [0225] Caskey, M., Klein, F., and Nussenzweig, M. C. (2019). Broadly neutralizing anti-HIV-1 monoclonal antibodies in the clinic. Nat Med 25, 547-553. [0226] Chao, A., Gotelli, N. J., Hsieh, T. C., Sander, E. L., Ma, K. H., Colwell, R. K., and Ellison, A. M. (2014). Rarefaction and extrapolation with Hill numbers: a framework for sampling and estimation in species diversity studies. Ecological Monographs 84, 45-67. [0227] Chao, A., Hsieh, T. C., Chazdon, R. L., Colwell, R. K., and Gotelli, N. J. (2015). Unveiling the species-rank abundance distribution by generalizing the Good-Turing sample coverage theory. Ecology 96, 1189-1201. [0228] Chen, F., Tzarum, N., Wilson, I. A., and Law, M. (2019). VH1-69 antiviral broadly neutralizing antibodies: genetics, structures, and relevance to rational vaccine design. Curr Opin Virol 34, 149-159. [0229] Chen, P., Nirula, A., Heller, B., Gottlieb, R. L., Boscia, J., Morris, J., Huhn, G., Cardona, J., Mocherla, B., Stosor, V., et al. (2020). SARS-COV-2 Neutralizing Antibody LY-CoV555 in Outpatients with Covid-19. N Engl J Med. [0230] Chen, V. B., Arendall, W. B., 3rd, Headd, J. J., Keedy, D. A., Immormino, R. M., Kapral, G. J., Murray, L. W., Richardson, J. S., and Richardson, D. C. (2010). MolProbity: all-atom structure validation for macromolecular crystallography. Acta Crystallogr D Biol Crystallogr 66, 12-21. [0231] Chen, Y. Q., Wohlbold, T. J., Zheng, N. Y., Huang, M., Huang, Y., Neu, K. E., Lee, J., Wan, H., Rojas, K. T., Kirkpatrick, E., et al. (2018). Influenza Infection in Humans Induces Broadly Cross-Reactive and Protective Neuraminidase-Reactive Antibodies. Cell 173, 417-429 e410. [0232] Chi, X., Yan, R., Zhang, J., Zhang, G., Zhang, Y., Hao, M., Zhang, Z., Fan, P., Dong, Y., Yang, Y., et al. (2020). A neutralizing human antibody binds to the N-terminal domain of the Spike protein of SARS-COV-2. Science 369, 650-655. [0233] Cohen, A. A., Gnanapragasam, P. N. P., Lee, Y. E., Hoffman, P. R., Ou, S., Kakutani, L. M., Keeffe, J. R., Barnes, C. O., Nussenzweig, M. C., and Bjorkman, P. J. (2020). Mosaic RBD nanoparticles elicit neutralizing antibodies against SARS-COV-2 and zoonotic coronaviruses. bioRxiv. [0234] Corti, D., and Lanzavecchia, A. (2013). Broadly neutralizing antiviral antibodies. Annu Rev Immunol 31, 705-742. [0235] Corti, D., Zhao, J., Pedotti, M., Simonelli, L., Agnihothram, S., Fett, C., Fernandez-Rodriguez, B., Foglierini, M., Agatic, G., Vanzetta, F., et al. (2015). Prophylactic and postexposure efficacy of a potent human monoclonal antibody against MERS coronavirus. Proc Natl Acad Sci USA 112, 10473-10478. [0236] Crawford, K. H. D., Dingens, A. S., Eguia, R., Wolf, C. R., Wilcox, N., Logue, J. K., Shuey, K., Casto, A. M., Fiala, B., Wrenn, S., et al. (2020a). Dynamics of neutralizing antibody titers in the months after SARS-COV-2 infection. J Infect Dis. [0237] Crawford, K. H. D., Eguia, R., Dingens, A. S., Loes, A. N., Malone, K. D., Wolf, C. R., Chu, H. Y., Tortorici, M. A., Veesler, D., Murphy, M., et al. (2020b). Protocol and Reagents for Pseudotyping Lentiviral Particles with SARS-COV-2 Spike Protein for Neutralization Assays. Viruses 12. [0238] Davies, N. G., Abbott, S., Barnard, R. C., Jarvis, C. I., Kucharski, A. J., Munday, J., Pearson, C. A. B., Russell, T. W., Tully, D. C., Washburne, A. D., et al. (2021). Estimated transmissibility and severity of novel SARS-COV-2 Variant of Concern 202012/01 in England. medRxiv, 2020.2012.2024.20248822. [0239] de Wit, E., van Doremalen, N., Falzarano, D., and Munster, V. J. (2016). SARS and MERS: recent insights into emerging coronaviruses. Nat Rev Microbiol 14, 523-534. [0240] Diskin, R., Klein, F., Horwitz, J. A., Halper-Stromberg, A., Sather, D. N., Marcovecchio, P. M., Lee, T., West, A. P., Jr., Gao, H., Seaman, M. S., et al. (2013). Restricting HIV-1 pathways for escape using rationally designed anti-HIV-1 antibodies. J Exp Med 210, 1235-1249. [0241] Dunbar, J., Krawczyk, K., Leem, J., Baker, T., Fuchs, A., Georges, G., Shi, J., and Deane, C. M. (2014). SAbDab: the structural antibody database. Nucleic Acids Res 42, D1140-1146. [0242] Ellebedy, A. H., Jackson, K. J., Kissick, H. T., Nakaya, H. I., Davis, C. W., Roskin, K. M., McElroy, A. K., Oshansky, C. M., Elbein, R., Thomas, S., et al. (2016). Defining antigen-specific plasmablast and memory B cell subsets in human blood after viral infection or vaccination. Nat Immunol 17, 1226-1234. [0243] Emsley, P., Lohkamp, B., Scott, W. G., and Cowtan, K. (2010). Features and development of Coot. Acta Crystallogr D Biol Crystallogr 66, 486-501. [0244] Goddard, T. D., Huang, C. C., Meng, E. C., Pettersen, E. F., Couch, G. S., Morris, J. H., and Ferrin, T. E. (2018). UCSF ChimeraX: Meeting modern challenges in visualization and analysis. Protein Sci 27, 14-25. [0245] Greaney, A. J., Starr, T. N., Gilchuk, P., Zost, S. J., Binshtein, E., Loes, A. N., Hilton, S. K., Huddleston, J., Eguia, R., Crawford, K. H. D., et al. (2020). Complete Mapping of Mutations to the SARS-COV-2 Spike Receptor-Binding Domain that Escape Antibody Recognition. Cell Host Microbe. [0246] Gristick, H. B., von Boehmer, L., West, A. P., Jr., Schamber, M., Gazumyan, A., Golijanin, J., Seaman, M. S., Fatkenheuer, G., Klein, F., Nussenzweig, M. C., et al. (2016). Natively glycosylated HIV-1 Env structure reveals new mode for antibody recognition of the CD4-binding site. Nat Struct Mol Biol 23, 906-915. [0247] Gupta, N. T., Vander Heiden, J. A., Uduman, M., Gadala-Maria, D., Yaari, G., and Kleinstein, S. H. (2015). Change-O: a toolkit for analyzing large-scale B cell immunoglobulin repertoire sequencing data. Bioinformatics 31, 3356-3358. [0248] Guthmiller, J. J., Lan, L. Y., Fernandez-Quintero, M. L., Han, J., Utset, H. A., Bitar, D. J., Hamel, N. J., Stovicek, O., Li, L., Tepora, M., et al. (2020). Polyreactive Broadly Neutralizing B cells Are Selected to Provide Defense against Pandemic Threat Influenza Viruses. Immunity 53, 1230-1244 e1235. [0249] Hansen, J., Baum, A., Pascal, K. E., Russo, V., Giordano, S., Wloga, E., Fulton, B. O., Yan, Y., Koon, K., Patel, K., et al. (2020). Studies in humanized mice and convalescent humans yield a SARS-COV-2 antibody cocktail. Science. [0250] Hill, M. O. (1973). Diversity and Evenness: A Unifying Notation and Its Consequences. Ecology 54, 427-432. [0251] Horns, F., Dekker, C. L., and Quake, S. R. (2020). Memory B Cell Activation, Broad Anti-influenza Antibodies, and Bystander Activation Revealed by Single-Cell Transcriptomics. Cell Rep 30, 905-913 e906. [0252] Horwitz, J. A., Halper-Stromberg, A., Mouquet, H., Gitlin, A. D., Tretiakova, A., Eisenreich, T. R., Malbec, M., Gravemann, S., Billerbeck, E., Dorner, M., et al. (2013). HIV-1 suppression and durable control by combining single broadly neutralizing antibodies and antiretroviral drugs in humanized mice. Proc Natl Acad Sci USA 110, 16538-16543. [0253] Hotzel, I., Theil, F. P., Bernstein, L. J., Prabhu, S., Deng, R., Quintana, L., Lutman, J., Sibia, R., Chan, P., Bumbaca, D., et al. (2012). A strategy for risk mitigation of antibodies with fast clearance. MAbs 4, 753-760. [0254] Hsieh, C. L., Goldsmith, J. A., Schaub, J. M., DiVenere, A. M., Kuo, H. C., Javanmardi, K., Le, K. C., Wrapp, D., Lee, A. G., Liu, Y., et al. (2020). Structure-based design of prefusion-stabilized SARS-COV-2 spikes. Science 369, 1501-1505. [0255] Hurlburt, N. K., Seydoux, E., Wan, Y. H., Edara, V. V., Stuart, A. B., Feng, J., Suthar, M. S., McGuire, A. T., Stamatatos, L., and Pancera, M. (2020). Structural basis for potent neutralization of SARS-COV-2 and role of antibody affinity maturation. Nat Commun 11, 5413. [0256] Izawa, K., Martin, E., Soudais, C., Bruneau, J., Boutboul, D., Rodriguez, R., Lenoir, C., Hislop, A. D., Besson, C., Touzot, F., et al. (2017). Inherited CD70 deficiency in humans reveals a critical role for the CD70-CD27 pathway in immunity to Epstein-Barr virus infection. J Exp Med 214, 73-89. [0257] Johnson, W. E., Li, C., and Rabinovic, A. (2007). Adjusting batch effects in microarray expression data using empirical Bayes methods. Biostatistics 8, 118-127. [0258] Ju, B., Zhang, Q., Ge, J., Wang, R., Sun, J., Ge, X., Yu, J., Shan, S., Zhou, B., Song, S., et al. (2020). Human neutralizing antibodies elicited by SARS-COV-2 infection. Nature 584, 115-119 [0259] Kabsch, W. (2010). XDS. Acta Crystallogr D Biol Crystallogr 66, 125-132. [0260] Klein, J. S., and Bjorkman, P. J. (2010). Few and far between: how HIV may be evading antibody avidity. PLOS Pathog 6, e1000908. [0261] Kremmidiotis, G., and Zola, H. (1995). Changes in CD44 expression during B cell differentiation in the human tonsil. Cell Immunol 161, 147-157. [0262] Krissinel, E., and Henrick, K. (2007). Inference of macromolecular assemblies from crystalline state. Journal of molecular biology 372, 774-797. [0263] Kulkarni, P. S., Hurwitz, J. L., Simoes, E. A. F., and Piedra, P. A. (2018). Establishing Correlates of Protection for Vaccine Development: Considerations for the Respiratory Syncytial Virus Vaccine Field. Viral Immunol 31, 195-203. [0264] Kyte, J., and Doolittle, R. F. (1982). A simple method for displaying the hydropathic character of a protein. Journal of molecular biology 157, 105-132. [0265] Lam, J. H., and Baumgarth, N. (2019). The Multifaceted B Cell Response to Influenza Virus. J Immunol 202, 351-359. [0266] Lefranc, M. P., Giudicelli, V., Duroux, P., Jabado-Michaloud, J., Folch, G., Aouinti, S., Carillon, E., Duvergey, H., Houles, A., Paysan-Lafosse, T., et al. (2015). IMGT(R), the international ImMunoGeneTics information system(R) 25 years on. Nucleic Acids Res 43, D413-422. [0267] Leyendeckers, H., Odendahl, M., Lohndorf, A., Irsch, J., Spangfort, M., Miltenyi, S., Hunzelmann, N., Assenmacher, M., Radbruch, A., and Schmitz, J. (1999). Correlation analysis between frequencies of circulating antigen-specific IgG-bearing memory B cells and serum titers of antigen-specific IgG. Eur J Immunol 29, 1406-1417. [0268] Li, B., Gould, J., Yang, Y., Sarkizova, S., Tabaka, M., Ashenberg, O., Rosen, Y., Slyper, M., Kowalczyk, M. S., Villani, A. C., et al. (2020). Cumulus provides cloud-based data analysis for large-scale single-cell and single-nucleus RNA-seq. Nat Methods 17, 793-798. [0269] Li, W., Moore, M. J., Vasilieva, N., Sui, J., Wong, S. K., Berne, M. A., Somasundaran, M., Sullivan, J. L., Luzuriaga, K., Greenough, T. C., et al. (2003). Angiotensin-converting enzyme 2 is a functional receptor for the SARS coronavirus. Nature 426, 450-454. [0270] Liu, L., Wang, P., Nair, M. S., Yu, J., Rapp, M., Wang, Q., Luo, Y., Chan, J. F., Sahi, V., Figueroa, A., et al. (2020). Potent neutralizing antibodies against multiple epitopes on SARS-COV-2 spike. Nature 584, 450-456. [0271] Liu, Y., Liu, J., Xia, H., Zhang, X., Fontes-Garfias, C. R., Swanson, K. A., Cai, H., Sarkar, R., Chen, W., Cutler, M., et al. (2021). Neutralizing Activity of BNT162b2-Elicited SerumPreliminary Report. N Engl J Med. [0272] Lv, Z., Deng, Y. Q., Ye, Q., Cao, L., Sun, C. Y., Fan, C., Huang, W., Sun, S., Sun, Y., Zhu, L., et al. (2020). Structural basis for neutralization of SARS-COV-2 and SARS-COV by a potent therapeutic antibody. Science 369, 1505-1509. [0273] Mastronarde, D. N. (2005). Automated electron microscope tomography using robust prediction of specimen movements. J Struct Biol 152, 36-51. [0274] Mathew, N. R., Jayanthan, J. K., Smirnov, I., Robinson, J. L., Axelsson, H., Nakka, S. S., Emmanouilidi, A., Czarnewski, P., Yewdell, W. T., Lebrero-Fern?ndez, C., et al. (2020). Single cell BCR and transcriptome analysis after respiratory virus infection reveals spatiotemporal dynamics of antigen-specific B cell responses. bioRxiv, 2020.2008.2024.264069. [0275] McCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C., and Read, R. J. (2007). Phaser crystallographic software. J Appl Crystallogr 40, 658-674. [0276] Moir, S., Ho, J., Malaspina, A., Wang, W., DiPoto, A. C., O'Shea, M. A., Roby, G., Kottilil, S., Arthos, J., Proschan, M. A., et al. (2008). Evidence for HIV-associated B cell exhaustion in a dysfunctional memory B cell compartment in HIV-infected viremic individuals. J Exp Med 205, 1797-1805. [0277] Moore, D. S. (1985). Amino acid and peptide net charges: A simple calculational procedure. Biochemical Education 13, 10-11. [0278] Moroney, J. B., Vasudev, A., Pertsemlidis, A., Zan, H., and Casali, P. (2020). Integrative transcriptome and chromatin landscape analysis reveals distinct epigenetic regulations in human memory B cells. Nat Commun 11, 5435. [0279] Mouquet, H., Scheid, J. F., Zoller, M. J., Krogsgaard, M., Ott, R. G., Shukair, S., Artyomov, M. N., Pietzsch, J., Connors, M., Pereyra, F., et al. (2010). Polyreactivity increases the apparent affinity of anti-HIV antibodies by heteroligation. Nature 467, 591-595. [0280] Muehlinghaus, G., Cigliano, L., Huehn, S., Peddinghaus, A., Leyendeckers, H., Hauser, A. E., Hiepe, F., Radbruch, A., Arce, S., and Manz, R. A. (2005). Regulation of CXCR3 and CXCR4 expression during terminal differentiation of memory B cells into plasma cells. Blood 105, 3965-3971. [0281] Mulangu, S., Dodd, L. E., Davey, R. T., Jr., Tshiani Mbaya, O., Proschan, M., Mukadi, D., Lusakibanza Manzo, M., Nzolo, D., Tshomba Oloma, A., Ibanda, A., et al. (2019). A Randomized, Controlled Trial of Ebola Virus Disease Therapeutics. N Engl J Med 381, 2293-2303. [0282] Nagasawa, T., Nakajima, T., Tachibana, K., Iizasa, H., Bleul, C. C., Yoshie, O., Matsushima, K., Yoshida, N., Springer, T. A., and Kishimoto, T. (1996). Molecular cloning and characterization of a murine pre-B-cell growth-stimulating factor/stromal cell-derived factor 1 receptor, a murine homolog of the human immunodeficiency virus 1 entry coreceptor fusin. Proc Natl Acad Sci USA 93, 14726-14729. [0283] Neu, K. E., Guthmiller, J. J., Huang, M., La, J., Vieira, M. C., Kim, K., Zheng, N. Y., Cortese, M., Tepora, M. E., Hamel, N. J., et al. (2019). Spec-seq unveils transcriptional subpopulations of antibody-secreting cells following influenza vaccination. J Clin Invest 129, 93-105. [0284] Nie, Y., Waite, J., Brewer, F., Sunshine, M. J., Littman, D. R., and Zou, Y. R. (2004). The role of CXCR4 in maintaining peripheral B cell compartments and humoral immunity. J Exp Med 200, 1145-1156. [0285] Nouri, N., and Kleinstein, S. H. (2018). A spectral clustering-based method for identifying clones from high-throughput B cell repertoire sequencing data. Bioinformatics 34, 1341-1349. [0286] Piccoli, L., Park, Y.-J., Tortorici, M. A., Czudnochowski, N., Walls, A. C., Beltramello, M., Silacci-Fregni, C., Pinto, D., Rosen, L. E., Bowen, J. E., et al. (2020). Mapping neutralizing and immunodominant sites on the SARS-COV-2 spike receptor-binding domain by structure-guided high-resolution serology. Cell. [0287] Pinto, D., Park, Y.-J., Beltramello, M., Walls, A. C., Tortorici, M. A., Bianchi, S., Jaconi, S., Culap, K., Zatta, F., De Marco, A., et al. (2020a). Cross-neutralization of SARS-COV-2 by a human monoclonal SARS-COV antibody. Nature 583, 290-295. [0288] Pinto, D., Park, Y. J., Beltramello, M., Walls, A. C., Tortorici, M. A., Bianchi, S., Jaconi, S., Culap, K., Zatta, F., De Marco, A., et al. (2020b). Cross-neutralization of SARS-COV-2 by a human monoclonal SARS-COV antibody. Nature 583, 290-295. [0289] Prabakaran, P., Gan, J., Feng, Y., Zhu, Z., Choudhry, V., Xiao, X., Ji, X., and Dimitrov, D. S. (2006). Structure of severe acute respiratory syndrome coronavirus receptor-binding domain complexed with neutralizing antibody. J Biol Chem 281, 15829-15836. [0290] Prigent, J., Jarossay, A., Planchais, C., Eden, C., Dufloo, J., Kok, A., Lorin, V., Vratskikh, O., Couderc, T., Bruel, T., et al. (2018). Conformational Plasticity in Broadly Neutralizing HIV-1 Antibodies Triggers Polyreactivity. Cell Rep 23, 2568-2581. [0291] Punjani, A., Rubinstein, J. L., Fleet, D. J., and Brubaker, M. A. (2017). cryoSPARC: algorithms for rapid unsupervised cryo-EM structure determination. Nat Methods 14, 290-296. [0292] Robbiani, D. F., Bozzacco, L., Keeffe, J. R., Khouri, R., Olsen, P. C., Gazumyan, A., Schaefer-Babajew, D., Avila-Rios, S., Nogueira, L., Patel, R., et al. (2017). Recurrent Potent Human Neutralizing Antibodies to Zika Virus in Brazil and Mexico. Cell 169, 597-609 e511. [0293] Robbiani, D. F., Gaebler, C., Muecksch, F., Lorenzi, J. C. C., Wang, Z., Cho, A., Agudelo, M., Barnes, C. O., Gazumyan, A., Finkin, S., et al. (2020). Convergent antibody responses to SARS-COV-2 in convalescent individuals. Nature 584, 437-442. [0294] Rockx, B., Corti, D., Donaldson, E., Sheahan, T., Stadler, K., Lanzavecchia, A., and Baric, R. (2008). Structural basis for potent cross-neutralizing human monoclonal antibody protection against lethal human and zoonotic severe acute respiratory syndrome coronavirus challenge. J Virol 82, 3220-3235. [0295] Rogers, T. F., Zhao, F., Huang, D., Beutler, N., Burns, A., He, W. T., Limbo, O., Smith, C., Song, G., Woehl, J., et al. (2020). Isolation of potent SARS-COV-2 neutralizing antibodies and protection from disease in a small animal model. Science 369, 956-963. [0296] Roy, V., Fischinger, S., Atyeo, C., Slein, M., Loos, C., Balazs, A., Luedemann, C., Astudillo, M. G., Yang, D., Wesemann, D. R., et al. (2020). SARS-COV-2-specific ELISA development. J Immunol Methods 484-485, 112832. [0297] Rubelt, F., Sievert, V., Knaust, F., Diener, C., Lim, T. S., Skriner, K., Klipp, E., Reinhardt, R., Lehrach, H., and Konthur, Z. (2012). Onset of immune senescence defined by unbiased pyrosequencing of human immunoglobulin mRNA repertoires. PLOS One 7, e49774. [0298] Scheid, J. F., Horwitz, J. A., Bar-On, Y., Kreider, E. F., Lu, C. L., Lorenzi, J. C., Feldmann, A., Braunschweig, M., Nogueira, L., Oliveira, T., et al. (2016). HIV-1 antibody 3BNC117 suppresses viral rebound in humans during treatment interruption. Nature 535, 556-560. [0299] Scheid, J. F., Mouquet, H., Feldhahn, N., Seaman, M. S., Velinzon, K., Pietzsch, J., Ott, R. G., Anthony, R. M., Zebroski, H., Hurley, A., et al. (2009a). Broad diversity of neutralizing antibodies isolated from memory B cells in HIV-infected individuals. Nature 458, 636-640. [0300] Scheid, J. F., Mouquet, H., Feldhahn, N., Walker, B. D., Pereyra, F., Cutrell, E., Seaman, M. S., Mascola, J. R., Wyatt, R. T., Wardemann, H., et al. (2009b). A method for identification of HIV gp140 binding memory B cells in human blood. J Immunol Methods 343, 65-67. [0301] Scheid, J. F., Mouquet, H., Ueberheide, B., Diskin, R., Klein, F., Oliveira, T. Y., Pietzsch, J., Fenyo, D., Abadir, A., Velinzon, K., et al. (2011). Sequence and structural convergence of broad and potent HIV antibodies that mimic CD4 binding. Science 333, 1633-1637. [0302] Schmidt, F., Weisblum, Y., Muecksch, F., Hoffmann, H. H., Michailidis, E., Lorenzi, J. C. C., Mendoza, P., Rutkowska, M., Bednarski, E., Gaebler, C., et al. (2020). Measuring SARS-CoV-2 neutralizing antibody activity using pseudotyped and chimeric viruses. J Exp Med 217. [0303] Shi, R., Shan, C., Duan, X., Chen, Z., Liu, P., Song, J., Song, T., Bi, X., Han, C., Wu, L., et al. (2020). A human neutralizing antibody targets the receptor-binding site of SARS-COV-2. Nature 584, 120-124. [0304] Shingai, M., Donau, O. K., Plishka, R. J., Buckler-White, A., Mascola, J. R., Nabel, G. J., Nason, M. C., Montefiori, D., Moldt, B., Poignard, P., et al. (2014). Passive transfer of modest titers of potent and broadly neutralizing anti-HIV monoclonal antibodies block SHIV infection in macaques. J Exp Med 211, 2061-2074. [0305] Stuart, T., Butler, A., Hoffman, P., Hafemeister, C., Papalexi, E., Mauck, W. M., 3rd, Hao, Y., Stoeckius, M., Smibert, P., and Satija, R. (2019). Comprehensive Integration of Single-Cell Data. Cell 177, 1888-1902 e1821. [0306] Sui, J., Li, W., Murakami, A., Tamin, A., Matthews, L. J., Wong, S. K., Moore, M. J., Tallarico, A. S., Olurinde, M., Choe, H., et al. (2004). Potent neutralization of severe acute respiratory syndrome (SARS) coronavirus by a human mAb to S1 protein that blocks receptor association. Proc Natl Acad Sci USA 101, 2536-2541. [0307] Tada, T., Fan, C., Chen, J. S., Kaur, R., Stapleford, K. A., Gristick, H., Dcosta, B. M., Wilen, C. B., Nimigean, C. M., and Landau, N. R. (2020). An ACE2 Microbody Containing a Single Immunoglobulin Fc Domain Is a Potent Inhibitor of SARS-COV-2. Cell Rep 33, 108528. [0308] Tan, T. J. C., Yuan, M., Kuzelka, K., Padron, G. C., Beal, J. R., Chen, X., Wang, Y., Rivera-Cardona, J., Zhu, X., Stadtmueller, B. M., et al. (2021). Sequence signatures of two IGHV3-53/3-66 public clonotypes to SARS-COV-2 receptor binding domain. bioRxiv. [0309] Tang, X. C., Agnihothram, S. S., Jiao, Y., Stanhope, J., Graham, R. L., Peterson, E. C., Avnir, Y., Tallarico, A. S., Sheehan, J., Zhu, Q., et al. (2014). Identification of human neutralizing antibodies against MERS-COV and their role in virus adaptive evolution. Proc Natl Acad Sci USA III, E2018-2026. [0310] Tegally, H., Wilkinson, E., Giovanetti, M., Iranzadeh, A., Fonseca, V., Giandhari, J., Doolabh, D., Pillay, S., San, E. J., Msomi, N., et al. (2020). Emergence and rapid spread of a new severe acute respiratory syndrome-related coronavirus 2 (SARS-COV-2) lineage with multiple spike mutations in South Africa. medRxiv, 2020.2012.2021.20248640. [0311] Terwilliger, T. C., Adams, P. D., Afonine, P. V., and Sobolev, O. V. (2018). A fully automatic method yielding initial models from high-resolution cryo-electron microscopy maps. Nat Methods 15, 905-908. [0312] Tian, X., Li, C., Huang, A., Xia, S., Lu, S., Shi, Z., Lu, L., Jiang, S., Yang, Z., Wu, Y., et al. (2020). Potent binding of 2019 novel coronavirus spike protein by a SARS coronavirus-specific human monoclonal antibody. Emerg Microbes Infect 9, 382-385. [0313] Tiller, T., Meffre, E., Yurasov, S., Tsuiji, M., Nussenzweig, M. C., and Wardemann, H. (2008). Efficient generation of monoclonal antibodies from single human B cells by single cell RT-PCR and expression vector cloning. J Immunol Methods 329, 112-124. [0314] Tiller, T., Tsuiji, M., Yurasov, S., Velinzon, K., Nussenzweig, M. C., and Wardemann, H. (2007). Autoreactivity in human IgG+ memory B cells. Immunity 26, 205-213. [0315] Tirosh, I., Izar, B., Prakadan, S. M., Wadsworth, M. H., 2.sup.nd, Treacy, D., Trombetta, J. J., Rotem, A., Rodman, C., Lian, C., Murphy, G., et al. (2016). Dissecting the multicellular ecosystem of metastatic melanoma by single-cell RNA-seq. Science 352, 189-196. [0316] Tortorici, M. A. (2020). Ultrapotent human antibodies protect against SARS-COV-2 challenge via multiple mechanisms. [0317] Traag, V. A., Waltman, L., and van Eck, N. J. (2019). From Louvain to Leiden: guaranteeing well-connected communities. Sci Rep 9, 5233. [0318] Traggiai, E., Becker, S., Subbarao, K., Kolesnikova, L., Uematsu, Y., Gismondo, M. R., Murphy, B. R., Rappuoli, R., and Lanzavecchia, A. (2004). An efficient method to make human monoclonal antibodies from memory B cells: potent neutralization of SARS coronavirus. Nat Med 10, 871-875. [0319] Triller, G., Scally, S. W., Costa, G., Pissarev, M., Kreschel, C., Bosch, A., Marois, E., Sack, B. K., Murugan, R., Salman, A. M., et al. (2017). Natural Parasite Exposure Induces Protective Human Anti-Malarial Antibodies. Immunity 47, 1197-1209 e1110. [0320] van Gisbergen, K. P., Klarenbeek, P. L., Kragten, N. A., Unger, P. P., Nieuwenhuis, M. B., Wensveen, F. M., ten Brinke, A., Tak, P. P., Eldering, E., Nolte, M. A., et al. (2011). The costimulatory molecule CD27 maintains clonally diverse CD8(+) T cell responses of low antigen affinity to protect against viral variants. Immunity 35, 97-108. [0321] Verschoor, C. P., Singh, P., Russell, M. L., Bowdish, D. M., Brewer, A., Cyr, L., Ward, B. J., and Loeb, M. (2015). Microneutralization assay titres correlate with protection against seasonal influenza H1N1 and H3N2 in children. PLOS One 10, e0131531. [0322] Victora, G. D., and Nussenzweig, M. C. (2012). Germinal centers. Annu Rev Immunol 30, 429-457. [0323] Waickman, A. T., Gromowski, G. D., Rutvisuttinunt, W., Li, T., Siegfried, H., Victor, K., Kuklis, C., Gomootsukavadee, M., McCracken, M. K., Gabriel, B., et al. (2020). Transcriptional and clonal characterization of B cell plasmablast diversity following primary and secondary natural DENV infection. EBioMedicine 54, 102733. [0324] Wan, J., Xing, S., Ding, L., Wang, Y., Gu, C., Wu, Y., Rong, B., Li, C., Wang, S., Chen, K., et al. (2020). Human-IgG-Neutralizing Monoclonal Antibodies Block the SARS-COV-2 Infection. Cell Rep 32, 107918. [0325] Wang, Q., Michailidis, E., Yu, Y., Wang, Z., Hurley, A. M., Oren, D. A., Mayer, C. T., Gazumyan, A., Liu, Z., Zhou, Y., et al. (2020a). A Combination of Human Broadly Neutralizing Antibodies against Hepatitis B Virus HBsAg with Distinct Epitopes Suppresses Escape Mutations. Cell Host Microbe 28, 335-349 e336. [0326] Wang, Z., Lorenzi, J. C. C., Muecksch, F., Finkin, S., Viant, C., Gaebler, C., Cipolla, M., Hoffman, H. H., Oliveira, T. Y., Oren, D. A., et al. (2020b). Enhanced SARS-COV-2 Neutralization by Secretory IgA in vitro. bioRxiv. [0327] Wang, Z., Schmidt, F., Weisblum, Y., Muecksch, F., Barnes, C. O., Finkin, S., Schaefer-Babajew, D., Cipolla, M., Gaebler, C., Lieberman, J. A., et al. (2021). mRNA vaccine-elicited antibodies to SARS-COV-2 and circulating variants. Nature. [0328] Wardemann, H., Yurasov, S., Schaefer, A., Young, J. W., Meffre, E., and Nussenzweig, M. C. (2003). Predominant autoantibody production by early human B cell precursors. Science 301, 1374-1377. [0329] Weisblum, Y., Schmidt, F., Zhang, F., DaSilva, J., Poston, D., Lorenzi, J. C., Muecksch, F., Rutkowska, M., Hoffmann, H. H., Michailidis, E., et al. (2020). Escape from neutralizing antibodies by SARS-COV-2 spike protein variants. Elife 9. [0330] West, A. P., Jr., Galimidi, R. P., Foglesong, C. P., Gnanapragasam, P. N., Klein, J. S., and Bjorkman, P. J. (2010). Evaluation of CD4-CD4i antibody architectures yields potent, broadly cross-reactive anti-human immunodeficiency virus reagents. J Virol 84, 261-269. [0331] West, A. P., Jr., Scharf, L., Horwitz, J., Klein, F., Nussenzweig, M. C., and Bjorkman, P. J. (2013). Computational analysis of anti-HIV-1 antibody neutralization panel data to identify potential functional epitope residues. Proc Natl Acad Sci USA 110, 10598-10603. [0332] Wibmer, C. K., Ayres, F., Hermanus, T., Madzivhandila, M., Kgagudi, P., Lambson, B. E., Vermeulen, M., van den Berg, K., Rossouw, T., Boswell, M., et al. (2021). SARS-COV-2 501Y. V2 escapes neutralization by South African COVID-19 donor plasma. bioRxiv. [0333] Winn, M. D., Ballard, C. C., Cowtan, K. D., Dodson, E. J., Emsley, P., Evans, P. R., Keegan, R. M., Krissinel, E. B., Leslie, A. G., McCoy, A., et al. (2011). Overview of the CCP4 suite and current developments. Acta Crystallogr D Biol Crystallogr 67, 235-242. [0334] Wrammert, J., Smith, K., Miller, J., Langley, W. A., Kokko, K., Larsen, C., Zheng, N. Y., Mays, I., Garman, L., Helms, C., et al. (2008). Rapid cloning of high-affinity human monoclonal antibodies against influenza virus. Nature 453, 667-671. [0335] Wrapp, D., Wang, N., Corbett, K. S., Goldsmith, J. A., Hsieh, C. L., Abiona, O., Graham, B. S., and Mclellan, J. S. (2020). Cryo-EM structure of the 2019-nCOV spike in the prefusion conformation. Science 367, 1260-1263. [0336] Wu, K., Werner, A. P., Koch, M., Choi, A., Narayanan, E., Stewart-Jones, G. B. E., Colpitts, T., Bennett, H., Boyoglu-Barnum, S., Shi, W., et al. (2021). Serum Neutralizing Activity Elicited by mRNA-1273 Vaccine-Preliminary Report. N Engl J Med. [0337] Wu, N. C., Yuan, M., Liu, H., Lee, C. D., Zhu, X., Bangaru, S., Torres, J. L., Caniels, T. G., Brouwer, P. J. M., van Gils, M. J., et al. (2020a). An Alternative Binding Mode of IGHV3-53 Antibodies to the SARS-COV-2 Receptor Binding Domain. Cell Rep 33, 108274. [0338] Wu, Y., Wang, F., Shen, C., Peng, W., Li, D., Zhao, C., Li, Z., Li, S., Bi, Y., Yang, Y., et al. (2020b). A noncompeting pair of human neutralizing antibodies block COVID-19 virus binding to its receptor ACE2. Science. [0339] Yaari, G., Uduman, M., and Kleinstein, S. H. (2012). Quantifying selection in high-throughput Immunoglobulin sequencing data sets. Nucleic Acids Res 40, e134. [0340] Yan, R., Zhang, Y., Li, Y., Xia, L., Guo, Y., and Zhou, Q. (2020). Structural basis for the recognition of the SARS-COV-2 by full-length human ACE2. Science. [0341] Yuan, M., Liu, H., Wu, N. C., Lee, C.-C. D., Zhu, X., Zhao, F., Huang, D., Yu, W., Hua, Y., Tien, H., et al. (2020). Structural basis of a shared antibody response to SARS-COV-2. Science, eabd2321. [0342] Zost, S. J., Gilchuk, P., Case, J. B., Binshtein, E., Chen, R. E., Nkolola, J. P., Schafer, A., Reidy, J. X., Trivette, A., Nargi, R. S., et al. (2020). Potently neutralizing and protective human antibodies against SARS-COV-2. Nature 584, 443-449. [0343] Zuccarino-Catania, G. V., Sadanand, S., Weisel, F. J., Tomayko, M. M., Meng, H., Kleinstein, S. H., Good-Jacobson, K. L., and Shlomchik, M. J. (2014). CD80 and PD-L2 define functionally distinct memory B cell subsets that are independent of antibody isotype. Nat Immunol 15, 631-637.

    [0344] Various modifications and variations of the described methods, pharmaceutical compositions, and kits of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific embodiments, it will be understood that it is capable of further modifications and that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention that are obvious to those skilled in the art are intended to be within the scope of the invention. This application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the present disclosure come within known customary practice within the art to which the invention pertains and may be applied to the essential features herein before set forth.