CHEMOENZYMATIC SYNTHESIS OF PEPTIDE BETA-LACTONES AND BETA-HYDROXY ACIDS

Abstract

Methods of producing peptide beta-lactones and beta-hydroxy acids are disclosed that include contacting a beta-hydroxy-alpha-amino acid, an aryl carrier protein (ObiD), and ATP with a non-ribosomal protein synthetase. A continuous flow reactor is disclosed that includes an elongate conduit with at least one region that includes a first region with a non-ribosomal protein synthetase immobilized to a substrate. The non-ribosomal protein synthetase of the continuous flow reactor is configured to contact a flow of a reaction mixture that includes a beta-hydroxy-alpha-amino acid and an aryl carrier protein. The non-ribosomal protein synthetase is further configured to release a peptide beta-lactone into the flow of the reaction mixture.

Claims

1. A method of producing a peptide beta-lactone, the method comprising contacting a beta-hydroxy-alpha-amino acid, a benzoic acid derivative, an aryl carrier protein, and ATP with a non-ribosomal protein synthetase, wherein: the beta-hydroxy-alpha-amino acid is selected from the group consisting of beta-OH-p-NO.sub.2-homoPhe and beta-OH-homoPhe; the aryl carrier protein is selected from the group consisting of ObiD, a homolog of ObiD, recombinant ObiD, and any variation thereof comprising the amino acid sequence of SEQ ID NO: 1 or fragment thereof; the non-ribosomal protein synthetase is selected from the group consisting of ObiF, a homolog of ObiF, recombinant ObiF, and any variation thereof comprising the amino acid sequence of SEQ ID NO:2 or fragment thereof; and the benzoic acid derivative is 2,3-dihydroxoybenzoic acid.

2. The method of claim 1, wherein the peptide beta-lactone is selected from the group consisting of an obafluorin and an obafluorin analog, the obafluorin analog comprising a compound with the structure: ##STR00006## wherein n=0, 1, or 2; and R= ##STR00007##

3. The method of claim 1, further comprising forming the beta-hydroxy-alpha-amino acid by contacting an aliphatic or aryl aldehyde or derivative thereof, an amino acid, and a pyridoxyl phosphate (PLP) cofactor with a serine hydroxymethyltransferase/threonine aldoloase, wherein: the aliphatic or aryl aldehyde or derivative thereof is selected from the group consisting of aliphatic aldehydes, aromatic benzaldehydes, aromatic phenylacetaldehydes, and aromatic cinnamaldehydes; the amino acid is selected from the group consisting of threonine, serine, glycine, and any isomer thereof; and the serine hydroxymethyltransferase/threonine aldoloase is selected from the group consisting of ObiH, a homolog of ObiH, and any variation thereof comprising the amino acid sequence of SEQ ID NO:3 or fragment thereof.

4. The method of claim 3, further comprising forming the aliphatic or aryl aldehyde or derivative thereof by contacting an aliphatic or aryl pyruvate or derivative thereof and thiamine pyrophosphate (TPP) with a thiamine dependent pyruvate decarboxylase, wherein: the phenyl pyruvate or derivative thereof is selected from the group consisting of: p-nitrophenylpyruvate, p-hydroxyphenylpyruvate, and phenylpyruvate; and the thiamine dependent pyruvate decarboxylase is selected from the group consisting of ObiG, a homolog of ObiG, and any variation thereof comprising the amino acid sequence of SEQ ID NO:4 or a fragment thereof.

5. The method of claim 4, further comprising forming the aliphatic or aryl pyruvate derivative consisting of p-nitrophenylpyruvate by contacting p-aminophenylpyruvate, oxygen, and Fe(II) with a p-aminobenzoate N-oxygenase, wherein the p-aminobenzoate N-oxygenase is selected from the group consisting of ObiL, a homolog of ObiL, and any variation thereof comprising the amino acid sequence of SEQ ID NO:5 or fragment thereof.

6. The method of claim 1, further comprising hydrolyzing the peptide beta-lactone to form a beta-hydroxy-acid, the beta-hydroxy-acid comprising a compound with any one of the structures given by: ##STR00008## n=0, 1, 2; and R= ##STR00009##

7. A method of producing a peptide beta-lactone, the method comprising: forming a reaction mixture comprising: a beta-hydroxy-alpha-amino acid selected from the group consisting of beta-OH-p-NO.sub.2-homoPhe and beta-OH-homoPhe; a benzoic acid derivative consisting of 2,3-dihydroxoybenzoic acid; ATP; an aryl carrier protein selected from the group consisting of ObiD, a homolog of ObiD, recombinant ObiD, and any variation thereof comprising the amino acid sequence of SEQ ID NO: 1 or fragment thereof; and a non-ribosomal protein synthetase selected from the group consisting of ObiF, a homolog of ObiF, recombinant ObiF, and any variation thereof comprising the amino acid sequence of SEQ ID NO:2 or fragment thereof, the non-ribosomal protein synthetase further comprising a condensation domain (C), a first adenylation domain (A.sub.1), a peptidyl carrier domain (PCP), a thioesterase domain (TE), and a second adenylation domain (A.sub.2); contacting the beta-hydroxy-alpha-amino acid with the non-ribosomal protein synthetase at the peptidyl carrier domain (PCP) with ATP activation by the first adenylation domain (A.sub.1) to form a PCP-beta-hydroxy-alpha-amino acid thioester comprising an alpha-amino moiety; ATP-activating the benzoic acid derivative at the second adenylation domain (A.sub.2) and contacting the ATP-activated benzoic acid derivative with the aryl carrier protein (ObiD) to form a benzoic acid derivative-aryl carrier protein (ObiD) thioester comprising a carbonyl moiety; contacting the benzoic acid derivative-aryl carrier protein (ObiD) thioester with the condensation domain (C) to catalyze an amide bond between the alpha-amino moiety and the carbonyl moiety to form a PCP-peptide beta-lactone precursor thioester; contacting the PCP-peptide beta-lactone precursor thioester with the thioesterase domain (TE) to form a transthioesterified peptide beta-lactone precursor; and releasing the transthioesterified peptide beta-lactone precursor as a peptide beta-lactone from the non-ribosomal protein synthetase (ObiF).

8. The method of claim 7, wherein the aryl carrier protein comprises the recombinant ObiD, and the method further comprises contacting the recombinant ObiD with a phosphopantetheinyl transferase (Sfp) enzyme.

9. The method of claim 7, wherein the non-ribosomal protein synthetase comprises the recombinant ObiF, and the method further comprises contacting the recombinant ObiF with a phosphopantetheinyl transferase (Sfp) enzyme.

10. The method of claim 7, wherein the peptide beta-lactone is selected from the group consisting of an obafluorin and an obafluorin analog, wherein the obafluorin analog comprises a compound with the structure: ##STR00010## wherein n=0, 1, or 2; and R= ##STR00011##

11. The method of claim 7, further comprising forming the beta-hydroxy-alpha-amino acid in the reaction mixture by contacting an aliphatic or aryl aldehyde or derivative thereof, an amino acid, and a pyridoxyl phosphate (PLP) cofactor with a serine hydroxymethyltransferase/threonine aldoloase, wherein: the aliphatic or aryl aldehyde or derivative thereof is selected from the group consisting of aliphatic aldehydes, aromatic benzaldehydes, aromatic phenylacetaldehydes, and aromatic cinnamaldehydes the amino acid is selected from the group consisting of threonine, serine, glycine, and any isomer thereof; the serine hydroxymethyltransferase/threonine aldoloase is selected from the group consisting of ObiH, a homolog of ObiH, and any variation thereof comprising the amino acid sequence of SEQ ID NO:3 or fragment thereof; and the reaction mixture further comprises the aliphatic or aryl aldehyde or derivative thereof, the amino acid and the serine hydroxymethyltransferase/threonine aldoloase and the pyridoxyl phosphate (PLP) cofactor.

12. The method of claim 11, further comprising forming the aliphatic or aryl aldehyde in the reaction mixture by contacting an aliphatic or aryl pyruvate and thiamine pyrophosphate (TPP) with a thiamine dependent pyruvate decarboxylase, wherein: the phenyl pyruvate or derivative thereof is selected from the group consisting of: p-nitrophenylpyruvate, p-hydroxyphenylpyruvate, and phenylpyruvate; the thiamine dependent pyruvate decarboxylase is selected from the group consisting of ObiG, a homolog of ObiG, and any variation thereof comprising the amino acid sequence of SEQ ID NO:4 or a fragment thereof; and the reaction mixture further comprises the aliphatic or aryl pyruvate, the thiamine pyrophosphate (TPP), and the thiamine dependent pyruvate decarboxylase.

13. The method of claim 12, further comprising forming the aliphatic or aryl pyruvate derivative consisting of a p-nitrophenylpyruvate derivative in the reaction mixture by contacting a p-aminophenylpyruvate derivative, oxygen, and Fe(II) with a p-aminobenzoate N-oxygenase, wherein: the p-aminobenzoate N-oxygenase is selected from the group consisting of ObiL, a homolog of ObiL, and any variation thereof comprising the amino acid sequence of SEQ ID NO:5 or fragment thereof; and the reaction mixture further comprises the p-nitrophenylpyruvate derivative, p-aminophenylpyruvate derivative, the oxygen, the Fe(II), and the p-aminobenzoate N-oxygenase.

14. The method of claim 13, further comprising hydrolyzing the peptide beta-lactone to form a beta-hydroxy acid, the beta-hydroxy acid comprising a compound with any one of the structures given by: ##STR00012## n=0, 1, 2; and R= ##STR00013##

15. A continuous flow reactor comprising an elongate conduit comprising at least one region, the at least one region comprising a first region comprising a non-ribosomal protein synthetase immobilized to a substrate, the non-ribosomal protein synthetase selected from the group consisting of ObiF, a homolog of ObiF, recombinant ObiF, and any variation thereof comprising the amino acid sequence of SEQ ID NO:2 or fragment thereof, wherein the immobilized non-ribosomal protein synthetase is configured to contact a flow of a reaction mixture comprising a beta-hydroxy-alpha-amino acid selected from the group consisting of beta-OH-p-NO.sub.2-homoPhe and beta-OH-homoPhe, and an aryl carrier protein selected from the group consisting of ObiD, a homolog of ObiD, recombinant ObiD, and any variation thereof comprising the amino acid sequence of SEQ ID NO: 1 or fragment thereof; and to release a peptide beta-lactone into the flow of the reaction mixture.

16. The continuous flow reactor of claim 15, wherein the non-ribosomal protein synthetase comprises the recombinant ObiF, and the method further comprises contacting the recombinant ObiF with a phosphopantetheinyl transferase (Sfp) enzyme.

17. The continuous flow reactor of claim 15, wherein the at least one region further comprises a second region positioned upstream of the first region, the second region comprising a serine hydroxymethyltransferase/threonine aldoloase immobilized to a second substrate, the serine hydroxymethyltransferase/threonine aldoloase selected from the group consisting of ObiH, a homolog of ObiH, and any variation thereof comprising the amino acid sequence of SEQ ID NO:3 or fragment thereof, wherein the immobilized serine hydroxymethyltransferase/threonine aldoloase is configured to contact an aliphatic or aryl aldehyde selected from the group consisting of aliphatic aldehydes, aromatic benzaldehydes, aromatic phenylacetaldehydes, and aromatic cinnamaldehydes; a pyridoxyl phosphate (PLP) cofactor and an amino acid selected from the group consisting of threonine, serine, glycine, and any isomer thereof, and to release the beta-hydroxy-alpha-amino acid into the flow of the reaction mixture.

18. The continuous flow reactor of claim 17, wherein the at least one region further comprises a third region positioned upstream of the second region, the third region comprising a thiamine-dependent pyruvate immobilized to a third substrate, the thiamine-dependent pyruvate decarboxylase selected from the group consisting of ObiG, a homolog of ObiG, and any variation thereof comprising the amino acid sequence of SEQ ID NO:4 or a fragment thereof, wherein the immobilized thiamine dependent pyruvate decarboxylase is configured to contact a phenyl pyruvate or aliphatic or aryl pyruvate derivative selected from the group consisting of p-nitrophenylpyruvate and p-hydroxyphenylpyruvate, and thiamine pyrophosphate (TPP) and to release the aliphatic or aryl aldehyde into the flow of the reaction mixture.

19. The continuous flow reactor of claim 18, wherein the at least one region further comprises a fourth region positioned upstream of the third region, the fourth region comprising a p-aminobenzoate N-oxygenase selected from the group consisting of ObiL, a homolog of ObiL, and any variation thereof comprising the amino acid sequence of SEQ ID NO:5 immobilized to a fourth substrate, wherein the immobilized p-aminobenzoate N-oxygenase is configured to contact p-aminophenylpyruvate, oxygen, and Fe(II) and to release p-nitrophenylpyruvate into the flow of the reaction mixture.

20. The continuous flow reactor of claim 19, wherein the at least one region further comprises a fifth region positioned downstream of the first region, the fifth region comprising a hydrolysis enzyme immobilized to a fifth substrate, wherein the hydrolysis enzyme is configured to contact peptide beta-lactone and to release a beta-hydroxy acid into the flow of the reaction mixture.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0015] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.

[0016] The figures described herein below illustrate various aspects of the disclosure.

[0017] FIG. 1A is a schematic illustration of the retrobiosynthesis of ring-closed obafluorin (RC-Obi) from predicted protein homology and biochemical characterization in an aspect.

[0018] FIG. 1B is an annotated biosynthetic gene cluster of Obi identified from whole genome sequencing of P. fluorescens ATCC 39502.

[0019] FIG. 1C is an annotated biosynthetic gene cluster of Obi identified from whole genome sequencing of P. fluorescens ATCC 39502.

[0020] FIG. 1D is a chemical structure diagram illustrating the arrangement of atoms within a 3D model of the RC-Obi structure with color-coded surfaces corresponding to CDSs involved in fragment biosynthesis.

[0021] FIG. 1E is a schematic diagram illustrating the non-enzymatic hydrolysis of obafluorin -lactone (RC-Obi) to form a -hydroxy carboxylic acid, the open-ring form of obafluorin (RO-Obi).

[0022] FIG. 2A is a graph summarizing the extracted ion chromatograms (EICs) vs retention time for the predicted products of a double enzyme reaction with ObiG and ObiH.

[0023] FIG. 2B is a graph summarizing the extracted ion chromatograms (EICs) vs retention time for the predicted products of a triple enzyme reaction with ObiL/ObiG/ObiH.

[0024] FIG. 2C is a diagram illustrating enzymatic conversion of -OH-p-NO.sub.2-homoPhe and 2,3-DHB to ring-closed obafluorin (RC-Obi, m/z=359 for [M+H].sup.+) and ring-opened obafluorin (RO-Obi, m/z=377 for [M+H].sup.+).

[0025] FIG. 2D is a graph summarizing the extracted ion chromatograms (EICs) vs retention time obtained for ring-closed obafluorin (RC-Obi, m/z=359) produced during the two-enzyme reaction summarized in FIG. 2C using three genetic variants of ObiF.

[0026] FIG. 2E is a graph summarizing the extracted ion chromatograms (EICs) vs retention time obtained for ring-opened obafluorin (RO-Obi, m/z=377) produced during the two-enzyme reaction summarized in FIG. 2C using three genetic variants of ObiF.

[0027] FIG. 2F is a diagram illustrating the process of enzymatic conversion of PAPPA to -OH-p-NO.sub.2-homoPhe using recombinant oxidase ObiL, decarboxylase ObiG, and aldolase ObiH.

[0028] FIG. 2G is an extracted ion chromatogram (EIC) showing the formation of the -OH-p-NO.sub.2-homoPhe [M+H].sup.+ ion m/z=241 from starting PAPPA when all three enzymes, ObiL/ObiG/ObiH, and necessary cofactors and cosubstrates are present.

[0029] FIG. 2H is an extracted ion chromatogram (EIC) showing EIC product concentrations resulting from the double enzyme reaction with ObiG and ObiH.

[0030] FIG. 2I is a bar graph showing the relative amount of L-Thr consumed during the ObiG/ObiH double enzyme reactions with L-Thr and either PAPPA or PNPPA.

[0031] FIG. 2J is an extracted ion chromatogram (EIC) showing the -OH-p-NO.sub.2-homoPhe product concentrations resulting from the double enzyme reaction with ObiG and ObiH using PNPPA and a panel of amino acid substrates.

[0032] FIG. 2K is a bar graph summarizing ATP-[.sup.32P]PP.sub.i exchange data for the incubation of recombinant ObiF (directly purified from E. coli cell lysates without treatment with Sfp) with [.sup.32P]PP.sub.i, unlabeled ATP, and carboxylate substrate followed by absorption onto activated charcoal.

[0033] FIG. 3A is a schematic illustration showing an obafluorin -lactone biosynthetic process.

[0034] FIG. 3B is a schematic illustration showing a mechanistic model for -lactone ring during antibiotic cleavage from the ObiF NRPS assembly line.

[0035] FIG. 3C is a schematic diagram showing a model for RC-Obi biosynthesis and the catalytic cycle of NRPS assembly line ObiF.

[0036] FIG. 3D is a schematic illustration showing an overview of the in vitro reconstitution of five enzymes (ObiL, ObiG, ObiH, ObiF, ObiD).

[0037] FIG. 4A is a graph showing E. coli ATCC 25922 growth curves generated by monitoring OD.sub.600 in M9 minimal media in the presence of 150 M RC-Obi, 150 M RO-Obi, or buffer control.

[0038] FIG. 4B is a fluorescence microscope images of E. coli ATCC 25922 fixed and stained with DAPI and FM 4-64.sub.fx after treatment with buffer control (rhodamine filter).

[0039] FIG. 4C is a fluorescence microscope images of E. coli ATCC 25922 fixed and stained with DAPI and FM 4-64.sub.fx after treatment with buffer control (DAPI filter).

[0040] FIG. 4D is a fluorescence microscope image of E. coli ATCC 25922 fixed and stained with DAPI and FM 4-64.sub.fx after treatment with ampicillin (rhodamine filter).

[0041] FIG. 4E is a fluorescence microscope image of E. coli ATCC 25922 fixed and stained with DAPI and FM 4-64.sub.fx after treatment with ampicillin (DAPI filter).

[0042] FIG. 4F is a fluorescence microscope image of E. coli ATCC 25922 fixed and stained with DAPI and FM 4-64.sub.fx after treatment with closed-ring obafluorin RC-Obi (rhodamine filter).

[0043] FIG. 4G is a fluorescence microscope images of E. coli ATCC 25922 fixed and stained with DAPI and FM 4-64.sub.fx after treatment with RC-Obi (DAPI filter).

[0044] FIG. 4H is a fluorescence microscope images of E. coli ATCC 25922 fixed and stained with DAPI and FM 4-64.sub.fx after treatment with RO-Obi (rhodamine filter).

[0045] FIG. 4I is a fluorescence microscope images of E. coli ATCC 25922 fixed and stained with DAPI and FM 4-64.sub.fx after treatment with Obi-COOH (DAPI filter).

[0046] FIG. 5A is a schematic illustration showing the biosynthesis of a transmonocyclic -lactone (Ebelactone A) by a Streptomyces aburaviensis -lactone biosynthetic cluster that lacks a terminal TE-domain.

[0047] FIG. 5B is a schematic illustration showing the biosynthesis of a spirocyclic -lactone (Oxazolomycin) by a Streptomyces spp. -lactone biosynthetic cluster that lacks a terminal TE-domain.

[0048] FIG. 5C is a schematic illustration showing the biosynthesis of a cis-bicyclic -lactone (Salinosporamide A) by a Salinospora tropica -lactone biosynthetic cluster that lacks a terminal TE-domain.

[0049] FIG. 5D is a schematic illustration showing the biosynthesis of a cis-monocyclic -lactone (Obafluorin) by a Pseudomonas fluorescens -lactone biosynthetic cluster that includes a terminal TE-domain. The TE-domain includes a rare catalytic Cys residue that participates in the -lactone ring formation.

[0050] FIG. 5E is a chemical structure diagram showing lipstatin, a trans-monocyclic -lactone.

[0051] FIG. 6A is a graph showing an EIC chromatogram for RC-Obi, [M+H].sup.+=359, showing that the -lactone form of obafluorin (i.e. RC-Obi) is present about 10 minutes after initiation of the reaction.

[0052] FIG. 6B is a graph showing an EIC chromatogram for RO-Obi, [M+H].sup.+=377, showing that the -lactone of the RC-Obi rapidly hydrolyzes to the corresponding -OH-carboxylate (i.e. RO-Obi) in LB broth at pH7 with a t.sub.1/2<2 hours. The hydrolyzed 3-OH-carboxylate form (i.e. RO-Obi) predominates after 150 min.

[0053] FIG. 7A is an illustration showing the transcriptional alignment of the Obi gene cluster with homologous clusters from environmental bacteria species Chitinphilus shinanonensis and the pathogenic bacteria species Burkholderia diffusa.

[0054] FIG. 7B is an illustration showing the primary amino acid sequence alignments of the NRPS TE domains from the three Obi clusters illustrated in FIG. 7A.

[0055] FIG. 8A is an illustration showing the biosynthesis of 2,3-DHB by the enzymes ObiA, ObiB, ObiC, and ObiE encoded in the obafluorin (Obi) biosynthetic gene cluster.

[0056] FIG. 8B is an illustration showing the biosynthesis of PAPPA by the enzymes ObiI, ObiJ, and ObiK encoded in the obafluorin (Obi) biosynthetic gene cluster.

[0057] FIG. 9A is a schematic illustration showing the enzymatic biosynthesis of -OH-p-NO.sub.2-homoPhe from PAPPA via a triple enzyme ObiL/ObiG/ObiH reaction with additional reagents to enable a colorimetric assay as illustrated in FIG. 9B.

[0058] FIG. 9B is a photograph of two rows of reaction tubes containing the products of the triple enzyme ObiL/ObiG/ObiH reaction with PAPPA at the 1 hr. time point.

[0059] FIG. 10A is a schematic illustration showing the enzymatic biosynthesis of various phenylacetaldehydes via an enzyme (ObiG) reaction and the subsequent treatment of the phenylacetaldehydes with Purpald.

[0060] FIG. 10B is a photograph of reaction tubes containing reaction products resulting from the ObiG reaction illustrated in FIG. 10A that have been treated with Purpald.

[0061] FIG. 11A is a schematic illustration showing the ObiG/ObiH double enzyme reactions with L-Thr and a panel of phenyl pyruvic acids (PNPPA, PPA, PHPPA, and PAPPA).

[0062] FIG. 11B contains extracted ion chromatograms (EIC) generated for the predicted product [M+H].sup.+ ion (m/z=241) of the four -OH-p-NO.sub.2-homoPhe produced by the ObiG/ObiH double enzyme reaction illustrated in FIG. 11A.

[0063] FIG. 12 is a schematic illustration of an ObiG and ObiH double enzyme reactions using PNPPA and a panel of amino acid substrates to enzymatically transform PNPPA into -OH-p-NO.sub.2-homoPhe.

[0064] FIG. 13A is a schematic illustration showing formation of an ObiH quinonoid.

[0065] FIG. 13B is a graph of optical absorption spectrum of ObiH treated with: PLP and L-Thr (blue trace), PLP (black trace), PLP and phenylacetylaldehyde (PAA) (green trace), and PLP, PAA, and L-Thr (red trace).

[0066] FIG. 13C is a chemical reaction diagram showing a mechanism of ObiG modeled after threonine aldolase. ObiG is a PLP-dependent L-Thr aldolase that converts L-Thr and PNPAA to -OH-p-NO.sub.2-homoPhe and acetaldehyde.

[0067] FIG. 13D is a chemical reaction diagram showing that the ObiG Lys-aldimine can equilibrate to the Thr aldimine.

[0068] FIG. 14A shows a primary sequence alignment of the ObiF (GenBank KX134687), AB3403 (GenBank WP_001060991.1), and EntF (GenBank AAB40785.1) TE-domains generated using ClustalW in MegAlign software.

[0069] FIG. 14B is a homology model of the ObiF TE domain generated with SWISS-MODEL using AB3403 TE-domain X-ray structure as template.

[0070] FIG. 14C is an X-ray crystal structure of the AB3403 TE domain (PDB 4ZXI).

[0071] FIG. 14D is an X-ray crystal structure of the EntF TE domain (PDB 3TEJ).

[0072] FIG. 14E is an overlay of the ObiF-TE homology model with the X-ray structures of AB3403-TE (PDB 4ZXI) and EntF-TE (PDB 3TEJ).

[0073] FIG. 15A is a schematic diagram illustrating the enzymatic synthesis of -lactone analogs of RC-Obi using obafluorin NRPS enzymes ObiF and ObiD machinery.

[0074] FIG. 15B is an EIC spectrum showing the amount of -NO.sub.2Obi -lactone analog ([M+H].sup.+ m/z=314) produced by the reaction illustrated in FIG. 15A.

[0075] FIG. 15C is an EIC spectrum showing the amount of hydrolyzed ring-opened obafluorin analog product ([M+H].sup.+ m/z=332) produced by the reaction illustrated in FIG. 15A.

[0076] FIG. 16A is a graph showing E. coli ATCC 25922 growth curves generated by monitoring OD.sub.600 in the presence of various concentrations of RC-Obi, or buffer control.

[0077] FIG. 16B is a graph showing 6 passaged E. coli ATCC 25922 growth curves generated by monitoring OD.sub.600 in the presence of various concentrations of RC-Obi, or buffer control.

[0078] FIG. 16C is a graph showing E. coli X580 growth curves generated by monitoring OD.sub.600 in the presence of various concentrations of RC-Obi, or buffer control.

[0079] FIG. 17 is a schematic illustration showing a comparison of the P. fluorescens ATCC 39502 genome with the genomes of other Pseudomonads.

[0080] FIG. 18A is an image of a gel showing purified proteins associated with the biosynthesis of RC-Obi, shown separated on SDS-PAGE gels (any kD, Bio-Rad) and stained with Coomassie blue.

[0081] FIG. 18B is an image of a gel showing purified proteins associated with the biosynthesis of RC-Obi, shown separated on SDS-PAGE gels (any kD, Bio-Rad) and stained with Coomassie blue.

[0082] FIG. 18C is an image of a gel showing purified proteins associated with the biosynthesis of RC-Obi, shown separated on SDS-PAGE gels (any kD, Bio-Rad) and stained with Coomassie blue.

[0083] FIG. 18D is an image of a gel showing purified proteins from a Ni-NTA purification column of CS_ObiF, shown separated on SDS-PAGE gels (any kD, Bio-Rad) and stained with Coomassie blue.

[0084] FIG. 19A is an image showing an E. coli BL21 cell pellet after an induced growth period, in which the E. coli BL21 cells were induced to overexpress ObiH.

[0085] FIG. 19B is an image showing the resuspended cell pellet of FIG. 19A in lysis buffer.

[0086] FIG. 19C is an image showing a cell lysate of the resuspended cell pellet of FIG. 19B.

[0087] FIG. 19D is an image showing a pellet and lysate after ultracentrifugation of the cell lysate of FIG. 19C.

[0088] FIG. 19E is an image showing an Ni-agarose resin prior to loading the lysate of FIG. 19D.

[0089] FIG. 19F is an image showing the Ni-agarose resin of FIG. 19E after loading the lysate of FIG. 19D.

[0090] FIG. 19G is an image showing the Ni-agarose resin of FIG. 19F in a column suspension.

[0091] FIG. 19H is an image showing the fractions from Ni-agarose resin purification, from left to right: column flowthrough, wash 1, wash 2, elution 1, elution 2, elution 3, elution 4, and elution 5.

[0092] FIG. 19I is an image showing an ObiH protein solution from FIG. 19H in the dialysis tubing suspended in 1.8 L of size-exclusion buffer.

[0093] FIG. 20 is a .sup.1H NMR spectrum obtained from a sample containing the closed-ring obafluorin protein (RC-Obi).

[0094] FIG. 21 is a .sup.13C NMR spectrum obtained from a sample containing the closed-ring obafluorin protein (RC-Obi).

[0095] FIG. 22 is a .sup.1H-.sup.13C HSQC spectrum obtained from a sample containing the closed-ring obafluorin protein (RC-Obi).

[0096] FIG. 23 is a .sup.1H-.sup.13C COSY spectrum obtained from a sample containing the closed-ring obafluorin protein (RC-Obi).

[0097] FIG. 24 is a .sup.1H-.sup.13C HMBC spectrum obtained from a sample containing the closed-ring obafluorin protein (RC-Obi).

[0098] FIG. 25 is a .sup.1H-.sup.13C NOESY spectrum obtained from a sample containing the closed-ring obafluorin protein (RC-Obi).

[0099] FIG. 26 is a .sup.1H NMR spectrum obtained from a sample containing the opened-ring obafluorin protein (RO-Obi).

[0100] FIG. 27 is a .sup.13C NMR spectrum obtained from a sample containing the opened-ring obafluorin protein (RO-Obi).

[0101] FIG. 28 is a .sup.1H-.sup.13C HSQC spectrum obtained from a sample containing the opened-ring obafluorin protein (RO-Obi).

[0102] FIG. 29 is a .sup.1H-.sup.13C COSY spectrum obtained from a sample containing the opened-ring obafluorin protein (RO-Obi).

[0103] FIG. 30 is a .sup.1H-.sup.13C HMBC spectrum obtained from a sample containing the opened-ring obafluorin protein (RO-Obi).

[0104] FIG. 31 is a .sup.1H-.sup.13C NOESY spectrum obtained from a sample containing the opened-ring obafluorin protein (RO-Obi).

[0105] FIG. 32 is a .sup.1H NMR spectrum obtained from a sample containing -OH-p-NO.sub.2-homoPhe.

[0106] FIG. 33 is a .sup.13C NMR spectrum obtained from a sample containing -OH-p-NO.sub.2-homoPhe.

[0107] FIG. 34 is a .sup.1H-.sup.13C HSQC spectrum obtained from a sample containing -OH-p-NO.sub.2-homoPhe.

[0108] FIG. 35 is a .sup.1H-.sup.13C COSY spectrum obtained from a sample containing -OH-p-NO.sub.2-homoPhe.

[0109] FIG. 36 is a .sup.1H-.sup.13C HMBC spectrum obtained from a sample containing -OH-p-NO.sub.2-homoPhe.

[0110] FIG. 37 is a .sup.1H-.sup.13C NOESY spectrum obtained from a sample containing -OH-p-NO.sub.2-homoPhe.

[0111] FIG. 38A is a schematic diagram showing a reaction scheme for the synthesis of Obi-SNAC and the hydrolysis of RC-Obi and Obi-SNAC to RO-Obi.

[0112] FIG. 38B is a graph showing a hydrolysis of RC-Obi as depicted in FIG. 38A above as monitored using HPLC with detection by optical absorbance spectroscopy at 270 nm using an Fmoc-L-Ala internal standard.

[0113] FIG. 38C is a graph showing a hydrolysis of Obi-SNAC as depicted in FIG. 38A above as monitored using HPLC with detection by optical absorbance spectroscopy at 270 nm using an Fmoc-L-Ala internal standard.

[0114] FIG. 39 is a schematic diagram showing an arrangement of domains within an ObiF enzyme.

[0115] FIG. 40 is a schematic diagram showing an arrangement of domains within an ObiD enzyme.

[0116] FIG. 41 is a schematic diagram showing a modification of the RC-Obi biosynthetic process by removal of domains from ObiF.

[0117] FIG. 42 is a schematic diagram showing a method of producing a peptide beta-lactone from a beta-hydroxy-alpha-amino acid in one aspect.

[0118] FIG. 43 is a schematic diagram showing an overview of the enzymatic biosynthesis of RC-Obi from 2,3-dihydroxybenzoic acid (2,3-DHB) and -OH-p-NO.sub.2-homoPhenylalanine precursors using the enzymes ObiG, ObiH, ObiL, ObiF, and ObiD in one aspect.

[0119] FIG. 44 is a schematic diagram showing an overview of the enzymatic biosynthesis of an RC-Obi analog from benzoic acid derivative and beta-hydroxy-alpha-amino acid precursors using the enzymes ObiH, ObiF, and ObiD in one aspect.

[0120] FIG. 45 is a schematic diagram showing transthioesterification and beta-lactone formation by a TE domain of an ObiF enzyme in an aspect.

[0121] FIG. 46 is a .sup.1H NMR spectrum obtained from a sample containing the obafluorin SNAC thioester protein (Obi-SNAC).

[0122] FIG. 47 is a .sup.13C NMR spectrum obtained from a sample containing the obafluorin SNAC thioester protein (Obi-SNAC).

[0123] FIG. 48 is a .sup.1H-.sup.13C HSQC spectrum obtained from a sample containing the obafluorin SNAC thioester protein (Obi-SNAC).

[0124] FIG. 49 is a .sup.1H-.sup.13C COSY spectrum obtained from a sample containing the obafluorin SNAC thioester protein (Obi-SNAC).

[0125] FIG. 50 is a .sup.1H-.sup.13C HMBC spectrum obtained from a sample containing the obafluorin SNAC thioester protein (Obi-SNAC).

[0126] FIG. 51 is a graph showing a series of HPLC elution profiles for holo-ObiF-catalyzed conversion of 2,3-DHB and -OH-p-NO.sub.2-homoPhe to RC-Obi.

[0127] FIG. 52 is a graph showing a series of HPLC elution profiles for the holo-ObiF mutant C1141S-catalyzed conversion of 2,3-DHB and -OH-p-NO.sub.2-homoPhe to RC-Obi.

[0128] FIG. 53 is a graph showing a series of HPLC elution profiles for the holo-ObiF mutant C1141A-catalyzed conversion of 2,3-DHB and -OH-p-NO.sub.2-homoPhe to RC-Obi.

[0129] FIG. 54 is a graph showing a series of HPLC elution profiles of pure analytical standards corresponding to various reactants and intermediate products associated with the relevant to catalyzed conversion of 2,3-DHB and -OH-p-NO.sub.2-homoPhe to RC-Obi.

[0130] FIG. 55 is a primary protein sequence (GenBank KX134687) in which the NRPS domains are highlighted with colors matching the ObiF homology model shown in FIG. 56.

[0131] FIG. 56 is a structure homology model of the ObiF NRPS with the domains highlighted by color.

[0132] FIG. 57 is a structure homology model of ObiG modeled as a homotetramer to a homodimer of phenylpyruvate decarboxylase (PDB 2q5o). The 3-deaza-ThDP and 3-phenylpyruvic acid ligands are shown as red sticks.

[0133] FIG. 58 is a structure homology model of ObiL modeled as a monomer to p-aminobenzoate N-oxygenase AurF (PDB 3cht). The p-nitrobenzoate ligand is shown as red sticks.

[0134] FIG. 59 is a structure homology model of ObiD modeled to the aryl carrier protein domain of EntB (PDB 2fq1).

[0135] FIG. 60 is a structure homology model of ObiH modeled as a homodimer to serine hydroxymethyltransferase from Burkholderia cenocepacia (PDB 4ot8). PLP and Ser ligands are shown as red sticks.

[0136] FIG. 61 is a structure homology model of ObiF C-A-T-TE domains modeled to the AB3403 NRPS from Acinetobacter baumannii (PDB 4zxi) and MbtH-AAr domains modeled to a structure of the EntF/YbdZ complex (PDB 5ja1).

[0137] FIG. 62 is a chemical reaction diagram showing a proposed mechanism of ObiG modeled after phenylpyruvate decarboxylase.

[0138] FIG. 63 is a chemical structural diagram of thiamine pyrophosphate.

[0139] FIG. 64 is a chemical structural diagram showing the production of RC-Obi and RO-Obi using recombinant ObiF and ObiD from C. shinanonensis genome.

[0140] FIG. 65 is a graph showing LC-MS traces from samples of a reaction mixture obtained at various times of the reaction illustrated in FIG. 64, characterizing a time-dependent buildup of the RC-Obi peak (rt=0.5 min; m/z for [M+H]+=359).

[0141] FIG. 66 is a graph showing LC-MS traces from samples of a reaction mixture obtained at various times of the reaction illustrated in FIG. 64, characterizing a time-dependent buildup of the RO-Obi peak (rt=9.0 min; m/z for [M+H]+=377).

[0142] FIG. 67 is a schematic diagram showing a proposed model for -OH-p-NO.sub.2-homoPhe selection by ObiF A domain specificity-conferring code.

[0143] FIG. 68 is a graph showing a LC-MS chromatogram of an ethyl acetate extraction of the culture supernatant from Obi-producing P. fluorescens ATCC 39502.

[0144] FIG. 69 is a graph showing a LC-MS chromatogram (extracted ion counts (y-axis) versus retention time (x-axis)) of an ethyl acetate extraction of the culture supernatant from Obi-producing P. fluorescens ATCC 39502.

[0145] FIG. 70 is a graph showing a LC-MS chromatogram (absorbance at 263 nm (y-axis) versus retention time (x-axis)) of RC-Obi purified via RP-C18 prep-HPLC from P. fluorescens culture supernatant.

[0146] FIG. 71 is a graph showing a LC-MS chromatogram (extracted ion counts (y-axis) versus retention time (x-axis)) of RC-Obi purified via RP-C18 prep-HPLC from P. fluorescens culture supernatant.

[0147] FIG. 72 is a graph showing a LC-MS chromatogram (absorbance at 263 nm (y-axis) versus retention time (x-axis)) of RO-Obi purified via RP-C18 prep-HPLC from P. fluorescens culture supernatant.

[0148] FIG. 73 is a graph showing a LC-MS chromatogram (extracted ion counts (y-axis) versus retention time (x-axis)) of RO-Obi purified via RP-C18 prep-HPLC from P. fluorescens culture supernatant.

[0149] FIG. 74 is a graph showing a LC-MS chromatogram (absorbance at 263 nm (y-axis) versus retention time (x-axis)) of Obi-SNAC purified via RP-C18 prep-HPLC from P. fluorescens culture supernatant.

[0150] FIG. 75 is a graph showing a LC-MS chromatogram (extracted ion counts (y-axis) versus retention time (x-axis)) of Obi-SNAC purified via RP-C18 prep-HPLC from P. fluorescens culture supernatant.

[0151] FIG. 76 is a schematic diagram showing the domain orientation in NRPS modules for ObiF (C-A-T-TE-AAr) and ObiD (T.sub.Ar) from P. fluorescens ATCC 39502 (GenBank KX134687 and KX134685).

[0152] FIG. 77 is a schematic diagram showing the domain orientation in NRPS modules for ObiF (C-A-T-TEf and separate A.sub.Ar) and ObiD (T.sub.Ar) from B. diffusa RF8-non_BP2 (GenBank WP_059467198.1, WP_059467197.1, and WP_059467195.1).

[0153] FIG. 78 is a schematic diagram showing the domain orientation in NRPS modules for ObiF (CA-T-TE-A.sub.Ar) and ObiD (T.sub.Ar) from C. shinanonensis SAY3 (GenBank WP_020608490.1 and WP_018749564.1).

[0154] FIG. 79 is a schematic diagram showing the domain orientation in NRPS modules for EntF (C-A-T-TE), EntE (A.sub.Ar), and EntB (T.sub.Ar) (PDB 5ja1 and 2fq1).

[0155] FIG. 80A is a reaction diagram illustrating enzymatic synthesis of a -lactone ring used to screen various substrates.

[0156] FIG. 80B is a list of the substrates screened using the reaction illustrated in FIG. 80A.

[0157] FIG. 81A is a reaction diagram illustrating the reaction for producing a beta-hydroxy-alpha-amino acid from L-Thr used to screen various substrates.

[0158] FIG. 81B is a bar graph the product concentrations produced by the reaction described in FIG. 81A for various substrates illustrated in FIG. 80B.

[0159] FIG. 82A is a diagram illustrating a reaction for producing a beta-hydroxy-alpha-amino acid from L-Thr to be optimized.

[0160] FIG. 82B is a graph illustrating the use of variable levels of DMSO or MeOH to optimize the reaction described in FIG. 82A.

[0161] FIG. 82C is a graph illustrating the product concentrations resulting from use of variable levels of L-Thr and PAA in the reaction described in FIG. 82A.

[0162] FIG. 83A is a diagram illustrating a reaction for the enzymatic synthesis of a -lactone ring using various substrates.

[0163] FIG. 83B is a list of substrates which were evaluated using the reaction illustrated in FIG. 83A; substrates shown in blue were demonstrated to provide useful concentrations of all corresponding products throughout the reaction illustrated in FIG. 83A.

[0164] FIG. 84 is a diagram illustrating a reaction for the enzymatic synthesis of an alkyne-tagged ObiH product and alkyne-tagged ObiH products.

[0165] FIG. 85 is an .sup.1H NMR spectrum obtained from a sample containing an alkyne-tagged ObiH product.

[0166] FIG. 86 is a .sup.13C NMR spectrum obtained from a sample containing an alkyne-tagged ObiH product.

[0167] FIG. 87 is an .sup.1H-.sup.13C COSY spectrum obtained from a sample containing an alkyne-tagged ObiH product.

[0168] FIG. 88 is an .sup.1H-.sup.13C HSQC spectrum obtained from a sample containing the alkyne-tagged ObiH product.

[0169] FIG. 89 is an .sup.1H-.sup.13C HMBC spectrum obtained from a sample containing the alkyne-tagged ObiH product.

[0170] FIG. 90 is an .sup.1H-.sup.13C TOCSY spectrum obtained from a sample containing the alkyne-tagged ObiH product.

[0171] FIG. 91 is a graph of the ObiH reaction as depicted in FIG. 84 above as monitored using HPLC with detection by optical absorbance spectroscopy, showing a peak corresponding to the alkyne-tagged ObiH product 6.

[0172] FIG. 92 is a graph showing a LC-MS chromatogram (total ion counts (y-axis) versus retention time (x-axis)) of the reaction mixture from the ObiH reaction as depicted in FIG. 84, showing a peak corresponding to the alkyne-tagged ObiH product 6.

[0173] FIG. 93 is a graph showing a LC-MS chromatogram (extracted ion counts at m/z=220 (y-axis) versus retention time (x-axis)) of the reaction mixture from the ObiH reaction as depicted in FIG. 84, showing a peak corresponding to the alkyne-tagged ObiH product 6.

[0174] FIG. 94 is a graph of the ObiFD reaction as depicted in FIG. 84 above as monitored using HPLC with detection by optical absorbance spectroscopy, showing peaks corresponding to the alkyne-tagged ObiFD products 7 and 8.

[0175] FIG. 95 is a graph showing a LC-MS chromatogram (total ion counts (y-axis) versus retention time (x-axis)) of the reaction mixture from the ObiFD reaction as depicted in FIG. 84.

[0176] FIG. 96 is a graph showing a LC-MS chromatogram (extracted ion counts at m/z=356 (y-axis) versus retention time (x-axis)) of the reaction mixture from the ObiFD reaction as depicted in FIG. 84, showing a peak corresponding to the alkyne-tagged ObiFD product 8.

[0177] FIG. 97 is a graph showing a LC-MS chromatogram (extracted ion counts at m/z=338 (y-axis) versus retention time (x-axis)) of the reaction mixture from the ObiFD reaction as depicted in FIG. 84, showing peaks corresponding to the alkyne-tagged ObiFD products 7 and 8.

DETAILED DESCRIPTION OF THE DISCLOSURE

[0178] The present disclosure is directed to methods of producing peptide beta-lactones and peptide beta-hydroxy acids that include contacting a beta-hydroxy-alpha-amino acid, an aryl carrier protein (ObiD), and ATP with a non-ribosomal protein synthetase. A continuous flow reactor is also disclosed that includes an elongate conduit with at least one region that includes a first region with a non-ribosomal protein synthetase immobilized to a substrate. The non-ribosomal protein synthetase of the continuous flow reactor is configured to contact a flow of a reaction mixture that includes a beta-hydroxy-alpha-amino acid and an aryl carrier protein. The non-ribosomal protein synthetase is further configured to release a peptide beta-lactone into the flow of the reaction mixture.

Abbreviations

[0179] Definitions of various abbreviations used herein are provided as follows: A, adenylation; ACP, acyl carrier protein; 4-ADC, 4-aminodeoxychorismate synthase; AHL, acylhomoserine lactone; C, condensation; CDS, coding sequence; cpm, counts per minute; DAHP, 3-Deoxy-D-arabinoheptulosonate 7-phosphate; 2,3-DHB, 2,3-dihydroxybenzoate; DTT, dithiothreitol; E. coli, Escherichia coli; gDNA, genomic DNA; -OH-p-NO.sub.2-homoPhe, -hydroxy-para-nitro-homoPhenylalanine; LB, Luria broth; NRPS, non-ribosomal peptide synthetase; NRP, non-ribosomal peptide; RC-Obi, ring-closed obafluorin; ACP, acyl carrier protein; PAA, phenylacetaldehyde; PAPPA, para-aminophenylpyruvic acid; PCP, peptidyl carrier protein; PHPPA, para-hydroxyphenylpyruvic acid; PNPPA, para-nitrophenylpyruvic acid; PPA, phenylpyruvic acid; PPant, phosphopantetheinyl; PPTase, phosphopantetheinyl transferase; P. fluorescens, Pseudomonas fluorescens; PK, polyketide; PKS, polyketide synthase; PLP, pyridoxal 5-phosphate; RO-Obi, ring-opened obafluorin; T, thiolation; TE, thioesterase; TFA, trifluoroacetic acid; and TPP, thiamine pyrophosphate.

Overview of Obi Biosynthesis

[0180] FIG. 1A is a schematic illustration of the retrobiosynthesis of ring-closed obafluorin (RC-Obi) derived using predicted protein homology and biochemical characterization as described in additional detail below. The RC-Obi -lactone ring and related fragments in precursor molecules are shown in red for ease of tracing the fragments in precursor molecules. 2,3-DHB and PAPPA both originate from chorismate as the carbon source. PAPPA is converted to -OH-p-NO.sub.2-homoPhe by action of Fe(II) oxidase ObiL, decarboxylase ObiG, and aldolase ObiH. Amide coupling and -lactone cyclization occur on the NRPS ObiF/ObiD to complete RC-Obi biosynthesis.

[0181] FIG. 3C is an illustration of RC-Obi biosynthesis as derived from in vitro characterization of ObiG, ObiH, ObiL, ObiF, and ObiD as described herein, computational prediction of the function of ObiA, ObiB, ObiC, ObiE, ObiI, ObiJ, and ObiK, as well as published isotope labeled precursor studies. FIG. 3C provides a summary of the enzymatically catalyzed biochemical pathways involved in RC-Obi biosynthesis and the catalytic cycle of NRPS assembly line ObiF. ObiB directs carbon flux from the primary metabolic pool to chorismate via the endogenous shikimate pathway. ObiA,C,E convert chorismate to 2,3-DHB. ObiI,J,K convert chorismate to PAPPA. ObiL is an aryl amine oxidase that converts PAPPA to PNPPA. ObiG is a decarboxylase that converts PNPPA to PNPAA. ObiH is a threonine aldolase that catalyzes a retro-aldol reaction with L-Thr and a crossed aldol with PNPAA generating acetaldehyde and -OH-p-NO.sub.2-homoPhe. ObiF and ObiD are the NRPS assembly line components that convert -OH-p-NO.sub.2-homoPhe and 2,3-DHB to RC-Obi at the cost of two ATP molecules. The NRPS catalytic cycle starts (I) with activation of 2,3-DHB as the acyl adenylate by A.sub.Ar-domain followed by loading to the T.sub.Ar domain as the phosphopantetheinyl thioester. Similarly, -OH-p-NO.sub.2-homoPhe is activated and loaded as a phosphopantetheinyl thioester by the embedded A and T domains of ObiF (II). Amide bond formation giving the 2,3-DHB--OH-p-NO.sub.2-homoPhe-T-thioester is catalyzed by the C domain (III). Transthioesterification to active site Cys.sub.1141 of the TE domain (IV) leads to cyclization releasing RC-Obi -lactone (V). Enzymes are color coded to match the genes shown in FIG. 1C.

[0182] As illustrated in FIG. 3C, carbon flux to RC-Obi biosynthesis starts from the primary metabolites erythrose-4-phosphate and PEP, which are converted to chorismate by the upregulated DAHP synthase ObiB and the endogenous shikimate pathway. Chorismate is converted to 2,3-DHB by ObiA, ObiC, and ObiE, and chorismate is also converted to PAPPA by ObiI, ObiJ, and ObiK.

[0183] Aryl amine oxidase (ObiL) converts PAPPA to PNPPA and ThDP-dependent decarboxylase ObiG converts PNPPA to PNPAA. Threonine aldolase (ObiH) establishes equilibrium between PNPAA, L-Thr, acetaldehyde, and -OH-p-NO.sub.2-homoPhe that is driven towards products by the ATP-consuming NRPS ObiF (see reaction II of FIG. 3C) that activates -OH-p-NO.sub.2-homoPhe as the acyl adenylate with the embedded A domain and covalently loads the amino acid as a phosphopantetheinyl thioester on the embedded T-domain. 2,3-DHB is similarly activated as the acyl adenylate by the C-terminal A.sub.Ar-domain and loaded on the stand-alone T.sub.Ar-domain as a phosphopantetheinyl thioester (see reaction I of FIG. 3C). The C domain is predicted to catalyze amide bond formation between the -amino group of the -OH-p-NO.sub.2-homoPhe-T-thioester and the carbonyl of the 2,3-DHB-T.sub.Ar-thioester, releasing free TAr (ObiD) and forming the 2,3-DHB--OH-p-NO.sub.2-homoPhe-T-thioester (see reaction III of FIG. 3C). Transthioesterification to the active site Cys1141 of the TE-domain (see reaction IV of FIG. 3C) sets up the cyclization of the -hydroxy thioester to the corresponding -lactone releasing RC-Obi from the NRPS and turning over the ObiF assembly for another round of catalysis (see reaction V of FIG. 3C).

Chorismate IntakeFormation of 2,3-DHB and PAPPA

[0184] FIG. 8A is an illustration showing the biosynthesis of 2,3-DHB by the enzymes ObiA, ObiB, ObiC, and ObiE encoded in the obafluorin (Obi) biosynthetic gene cluster. Phosphoenolpyruvate (PEP) and erythrose-4-phosphate are converted to 3-deoxy-D-arabinoheptulosonate-7-phosphate (DAHP) by DAHP synthase ObiB. The native shikimate pathway in P. fluorescens is left to convert DAHP to chorismate, which is converted to 2,3-DHB by tandem action of isochorismate (ICS) synthase ObiA, isochorismatase ObiE, and dehydrogenase ObiC.

[0185] FIG. 8B is an illustration showing the biosynthesis of PAPPA by the enzymes ObiI, ObiJ, and ObiK encoded in the obafluorin (Obi) biosynthetic gene cluster. The three enzymes, ObiI, ObiJ, and ObiK convert chorismate to p-NH.sub.2-phenylpyruvate (PAPPA). Chorismate is first converted to 4-amino-deoxychorismate (4-ADC) by ADC synthase ObiJ/ObiK. The bifunctional 4-ADC mutase/dehydratase ObiI catalyzes the isomerization of 4-ADC to 4-amino-deoxyprephenate (4-ADP) and the aromatizing decarboxylation of 4-ADP to give PAPPA.

[0186] As illustrated in FIGS. 8A and 8B, chorismate is the primary carbon source of the Obi biosynthetic pathway. 2,3-DHB and PAPPA both originate from chorismate as the carbon source (shown in FIG. 1A). As shown in FIG. 8A, the gene obiB encodes an extra copy of the first biosynthetic enzyme from the shikimate pathway, DAHP synthase, which converts phosphoenol pyruvate (PEP) and erythrose-4-phosphate to chorismate. Presumably, upregulation of DAHP synthase increases carbon flux towards chorismate during RC-Obi production to provide a metabolic pool large enough to maintain required production levels of essential aromatic amino acids. Chorismate is converted to 2,3-DHB by action of isochorismate synthase (ObiA), isochorismatase (ObiE), and dehydrogenase (ObiC), which is analogous to the EntCBA set of enzymes involved in biosynthesis of the siderophore enterobactin. As illustrated in FIG. 8B, chorismate is also converted to PAPPA by the 4-amino-4-deoxy chorismate (4-ADC) synthase (ObiJ and ObiK) and 4-ADC mutase/dehydratase (ObiI) analogous to the CmlBCD and PapABC enzymes that lead to PAPPA in the chloramphenicol and pristinamycin biosynthetic pathways, respectively.

Convert PAPPA to -OH-p-NO.SUB.2.-homoPhe (ObiL, ObiG, ObiH)

[0187] Three enzymes, Fe(II) oxidase ObiL, decarboxylase ObiG, and aldolase ObiH, convert PAPPA to 1-OH-p-NO.sub.2-homoPhe (FIGS. 1A and 3C). As shown in FIG. 3A, aryl amine oxidase ObiL converts PAPPA to PNPPA. Decarboxylase ObiG converts PNPPA to p-NO.sub.2-phenylacetaldehyde (PNPAA) which is captured by threonine aldolase ObiH to establish an equilibrium between the -OH-amino acids L-Thr and -OH-p-NO.sub.2-homoPhe which share the same (2S,3R) stereochemistry at C2 and C3.

[0188] FIG. 2F is a diagram illustrating the process of enzymatic conversion of PAPPA to -OH-p-NO.sub.2-homoPhe using recombinant oxidase ObiL, decarboxylase ObiG, and aldolase ObiH. The di-iron nonheme oxygenase ObiL converts the aryl amine PAPPA to the aryl nitro PNPPA in the presence of Fe(II) and O.sub.2. The decarboxylase ObiG converts phenyl pyruvic acid PNPPA to phenyl acetaldehyde PNPAA using a TPP cofactor. The PLP-dependent aldolase ObiH establishes equilibrium between the starting materials PNPPA and L-Thr and the products acetaldehyde and -OH-p-NO.sub.2-homoPhe. The ObiH equilibrium is driven towards products by downstream coupling to the ATP-consuming NRPS ObiF.

[0189] ObiL is a non-heme diiron oxygenase that catalyzes the six-electron oxidation of the aryl amine PAPPA to the aryl nitro p-NO.sub.2-phenylpyruvic acid (PNPPA), as illustrated in FIG. 2F. Related examples of arylamine oxidases are found in the biosynthetic pathways of aureothin (AurF; GenBank EJZ60582.1) and chloramphenicol (CmlI; PDB 5HYH_A).

[0190] FIG. 58 illustrates a structure homology model of ObiL modeled as a monomer to p-aminobenzoate N-oxygenase AurF. ObiL shows 24% and 18% sequence homology to AurF and CmlI, respectively (see Table 1 below). AurF acts early in the biosynthetic pathway of aureothin to oxidize p-aminobenzoic acid (PABA) to p-nitrobenzoic acid (PNBA), and CmlI catalyzes the oxidation of the penultimate aniline intermediate to the aryl nitro as the final step of chloramphenicol biosynthesis. Subsequent treatment of an ObiL/PAPPA reaction mixture with recombinant ObiG and ObiH in the presence of thiamine diphosphate (ThDP), pyridoxal phosphate (PLP), and L-Thr gives direct detection of -OH-p-NO2-homoPhe as detected by LC-MS (FIG. 2G).

TABLE-US-00001 TABLE 1 Percent amino acid sequence identity of ObiL, AurF, and CmlI ObiL.sup.a AurF.sup.b CmlI_A.sup.c ObiL 24% 18% AurF 24% 22% CamII_A 18% 22% .sup.aGenBank KX134693. .sup.bGenBank EJZ60582.1. .sup.cPBD 5HYH_A.

[0191] ObiG is a ThDP-dependent phenylpyruvate decarboxylase that catalyzes the conversion of PNPPA to PNPAA (FIG. 2F). FIG. 57 illustrates a structure homology model of ObiG modeled as a homotetramer to a homodimer of phenylpyruvate decarboxylase. ObiG preferentially decarboxylates p-nitro-phenyl pyruvic acid (PNPPA) to give the corresponding p-nitro-phenylacetaldehyde (FIG. 10A). A double enzyme reaction with ObiG and ObiH in the presence of ThDP, PLP, and L-Thr revealed that PNPPA is directly converted to -OH-p-NO.sub.2-homoPhe as detected by LC-MS (FIG. 2H) and .sup.1H-NMR analysis of the reaction mixture (FIG. 2I). p-Amino-phenylpyruvic acid (PAPPA) was not accepted as a substrate by ObiG/ObiH suggesting that ObiL must oxidize PAPPA prior to ObiG,H catalysis (FIG. 2H and FIG. 2I). These results firmly establish that PAPPA acts as the substrate for oxygenase ObiL and decarboxylase ObiG acts on PNPPA to provide PNPAA aldehyde substrate for aldolase ObiH (FIG. 10B).

[0192] FIG. 62 is a chemical reaction diagram showing a mechanism of ObiG modeled after phenylpyruvate decarboxylase. ObiG is a ThDP decarboxylase that converts PNPPA to PNPAA. The proposed mechanism of the reaction is initiated by attack of the TPP-ylide on -carbonyl of PNPPA, forming a tetrahedral intermediate. Decarboxylation, protonation, and elimination of catalytic TPP give PNPAA. FIG. 63 shows a chemical structural diagram of thiamine pyrophosphate (TPP).

[0193] The stereochemistry of the ObiH aldol product matches that of the preferred precursor L-Thr and the final biosynthetic product RC-Obi. Double enzyme reactions with decarboxylase ObiG and aldolase ObiH monitored by LCMS established that L-Thr is the preferred amino acid substrate and PNPPA is the preferred phenyl pyruvate substrate. p-Amino-phenylpyruvic acid (PAPPA) was not accepted as a substrate by ObiG/ObiH suggesting that ObiL must oxidize PAPPA prior to ObiGH catalysis. The timing and action of ObiL as an aryl amine oxidase was confirmed using a triple enzyme reaction of ObiGHL with L-Thr and PAPPA substrates which produced -OH-p-NO.sub.2-homoPhe.

[0194] The reactive aldehyde resulting from the enzymatic conversion of PNPPA by ObiG is immediately captured by threonine aldolase ObiH. FIG. 60 illustrates a structure homology model of ObiH modeled as a homodimer to serine hydroxymethyltransferase from Burkholderia cenocepacia. ObiH catalyzes a retro aldol reaction on L-Thr and a forward crossed aldol reaction with p-nitro phenylacetaldehyde to yield (2S,3R)--OH-p-NO.sub.2-homoPhe. ObiH is a threonine aldolase that catalyzes a retro-aldol reaction on L-Thr giving acetaldehyde and a PLP-stabilized glycine enolate that undergoes a crossed aldol reaction with PNPAA to yield (2S,3R)--OH-p-NO.sub.2-homoPhe setting the final stereochemistry found in the Obi -lactone scaffold (FIG. 2F). Threonine aldolases are PLP-dependent enzymes with homology to serine hydroxymethyl transferase and alanine racemase. Aldolases are involved in the biosynthesis of natural products containing -hydroxy--amino acids including: the peptidyl nucleoside antibiotics A090289 A, caprazamycin A, and muramycin A135; the 4-methyl-oxazoline antibiotics JBIR-34 and BE-3203036; and the -methyl-L-Ser antibiotics amicetin and bamicterin.

[0195] FIGS. 13C and 13D illustrate a mechanism for ObiG conversion of L-Thr and PNPAA to -OH-p-NO.sub.2-homoPhe. As mentioned, ObiG is a PLP-dependent L-Thr aldolase that converts L-Thr and PNPAA to -OH-p-NO.sub.2-homoPhe and acetaldehyde. FIG. 13D illustrates a chemical reaction diagram showing that the ObiG Lys-aldimine can equilibrate to the Thr aldimine. A retro-adol reaction gives acetaldehyde and a stabilized glycine enolate (quinonoid). An aldol reaction with PNPAA gives the -OH-p-NO.sub.2-homoPhe-aladimine with stereochemistry matching that of L-Thr. The homoPhe-aldimine equilibrates with the Lys-aldimine releasing -OH-p-NO.sub.2-homoPhe.

[0196] Double enzyme reactions with decarboxylase ObiG and aldolase ObiH monitored by LCMS established that L-Thr is the preferred amino acid substrate (FIG. 2J). D-Thr, L-alloThr, D-alloThr, L-Ser, and D-Ser gave trace or no detectable aldol product from the ObiG,H double enzyme reaction with PNPAA. Given that the stereochemistry of the ObiH aldol product, (2S,3R)--OH-p-NO.sub.2-homoPhe, matches that of L-Thr, it is probable that L-Thr leads to stereospecific enolate formation and subsequently stereospecific aldol reaction with PNPAA. The ObiH PLP cofactor forms an exceptionally stable glycine enolate quinonoid intermediate upon exposure to L-Thr that is observable by optical absorption spectroscopy (=495 nm) throughout the entire protein expression and purification process including dialysis. Addition of phenyl acetaldehyde (PAA) rapidly quenches the ObiH quinonoid and forms the aldol product. ObiH alone is not capable of driving the equilibrium of the aldol reaction completely to product. Kinetic analysis of the ObiH reaction by .sup.1H-NMR and optical absorbance suggested strong product feedback inhibition, which is common for PLP-dependent enzymes (FIG. 2I). The equilibrium is driven in the direction of the -OH-p-NO.sub.2-homoPhe aldol product by downstream coupling to the ATP-consuming ObiD/ObiF NRPS machinery, which incorporates the ObiH product, -OH-p-NO.sub.2-homoPhe, into the final Obi NRP scaffold (NRPS). The ObiH equilibrium is driven towards RC-Obi by the ATP-consuming NRPS ObiF.

Convert/-OH-p-NO.SUB.2.-homoPhe to Obi -Lactone (ObiD, ObiF)

[0197] Referring to FIG. 3A, the Obi NRPS (ObiF, ObiD) contains five domains encoded by ObiF (C-A.sub.1-PCP-TE-A.sub.2) and ObiD (aryl PCP). The ObiF NRPS module is loaded with -OH-p-NO.sub.2-homoPhe as a PCP-thioester with ATP activation by the A.sub.1-domain. The A.sub.2-domain of ObiF activates 2,3-DHB as the acyl adenylate before conversion of aryl PCP ObiD to the 2,3-DHB thioester. The ObiF C-domain catalyzes amide bond formation between the -amino group of the -OH-p-NO.sub.2-homoPhe-PCP-thioester and the carbonyl of the 2,3-DHB-PCP-thioester. Transthioesterification by C1141 of the ObiF TE-domain is followed by release of the cyclized ring-closed RC-Obi -lactone from the NRPS assembly line.

[0198] Amide coupling and -lactone cyclization occur on the NRPS ObiF/ObiD to complete RC-Obi biosynthesis, as illustrated in FIG. 1A. The P. fluorescens ObiF NRPS is a single module, 209 kDa protein with C-A.sub.1-T-TE-A.sub.Ar catalytic domains (FIG. 39, FIG. 3D, FIG. 56, and FIG. 61).

[0199] FIG. 56 is a structure homology model of the ObiF NRPS with the domains highlighted by color. The ObiF protein sequence is shown in FIG. 55 with protein domains highlighted in colors matching the ObiF homolog model. ObiL, ObiG, ObiH, ObiD, and ObiF are shown in green overlay with model structures from the PDB shown in orange. All homology models were generated using SWISS-MODEL (swissmodel.expasy.org) and images of secondary structure were generated using PyMOL v1.7 for Mac OS X. There is a small, 70 amino acid MbtH-like domain between the TE and A.sub.Ar domains (FIG. 3D and FIG. 56).

[0200] ObiD is a separate aryl acyl carrier protein (T.sub.Ar), as illustrated in FIG. 40. FIG. 59 illustrates a structure homology model of ObiD modeled to the aryl carrier protein domain of EntB. The ObiF and ObiD domain organization resembles the well-studied enterobactin NRPS module EntF (GenBank AAB40785.1), which contains C-A-T-TE domains and separate aryl adenylation (A.sub.Ar) (EntE, GenBank AAB40794.1) and aryl carrier (T.sub.Ar) (EntB, GenBank AAB40795.1) domains. The ObiF homologue from C. shinanonensis SAY3 (GenBank WP_020608490.1) has the same domain organization as the P. fluorescens NRPS along with an ObiD homologue. (GenBank WP_018749564.1) The homologous proteins in B. diffusa RF8-non_BP2 share an organization matching EntF (GenBank WP_059467198.1) with separate A.sub.Ar (GenBank WP_059467197.1) and T.sub.Ar (GenBank WP_059467195.1).

[0201] Recombinant NRPS ObiF and acyl carrier protein ObiD convert -OH-p-NO.sub.2-homoPhe and 2,3-DHB into the -lactone Obi (FIG. 2C). Prior to in vitro enzyme reactions recombinant ObiD and ObiF were primed with 4-phosphopantetheine transferase (Sfp) to install the phosphopantetheine post-translational modification on the T-domains. Treatment of -OH-p-NO.sub.2-homoPhe and 2,3-DHB with holo-ObiF and holo-ObiD in the presence of ATP/Mg.sup.2+ gave clean conversion to RC-Obi -lactone and the corresponding ring-opened hydrolysis product RO-Obi, presumably originating from the non-enzymatic hydrolysis of RC-Obi (see FIG. 2D, FIG. 2E, FIG. 6A, and FIG. 6B).

[0202] FIG. 7B is an illustration showing the primary amino acid sequence alignments of the NRPS TE domains from the three Obi clusters illustrated in FIG. 7A. TE sequences from P. fluorescens ATCC 39502 (ObiF_thioesterase; GenBank KX134687), B. diffusa RF8-non_BP2 (GenBank WP_059467198.1), and C. shinanonensis SAY3 (GenBank WP_020608490.1) were aligned in MegAlignPro using ClustalW. Amino acid residues are color coded according to side chain chemistry (yellow=aromatic; red=acidic; blue=basic; orange=nonpolar; green=polar). Stars designate the proposed residues of the catalytic triad, which is conserved in all three sequences. The TE domain from ObiF NRPS in the strains Pseudomonas sp. 37 R 15 (GenBank WP_065949343.1) and 34 E 7 (GenBank WP_065936859.1) were identical to the sequence from P. fluorescens and are omitted for clarity.

[0203] It was discovered that the ObiF NRPS was the first -lactone producing assembly line, PKS or NRPS, to include a TE domain in the termination module. Primary sequence analysis of the ObiF TE domain revealed that the expected catalytic serine of the conserved GXSXG motif is replaced by a cysteine at residue 1141 (see FIG. 7B). This mutation has been reported previously for type II TEs, but rarely reported for type I TEs. A GXCXG sequence is present in the pyochelin NRPS TE domain from P. aeruginosa (GenBank AAC83657.1) and the recently crystallized NRPS AB3403 from A. baumannii (GenBank WP_001060991.1; PDB 4ZXI).

[0204] FIG. 14A shows a primary sequence alignment of the ObiF (GenBank KX134687), AB3403 (GenBank WP_001060991.1), and EntF (GenBank AAB40785.1) TE-domains generated using ClustalW in MegAlign software. Catalytic triad residues are colored green and conserved residues colored black. All three TEs contain the conserved GXS(C)XG motif and the catalytic Ser(Cys)-His-Asp triad. AB3403 and EntF share conserved locations of the catalytic triad while ObiF moves the His-Asp residues to different loops of the protein.

[0205] A GXCXG motif in a type I TE-domain was also reported previously in an NRPS from Acinetobacter baumannii (see FIG. 14A) which produces an unknown metabolite implicated in motility, biofilm and pellicle formation which are associated with pathogen virulence. The structure of the A. baumannii NRPS (AB3403) was recently solved by X-ray crystallography and cryo-EM revealing molecular level details of the TE active site and global domain orientation.

[0206] A homology model of the ObiF TE domain is illustrated in FIG. 14B, and X-ray crystal structures of the AB3403 and EntF TE domains are illustrated in FIGS. 14C and 14D respectively. Alpha helices are colored cyan, beta-sheets are colored magenta, the lid domains are colored red, and the catalytics Asp-His-Cys(Ser) triads are shown as space filling spheres. ObiF, AB3403, and EntF have homologous secondary structures similar to the majority of type I TE-domains from PKS and NRPS termination modules. The lid domains of ObiF and AB3403 differ from the lid of EntF, but the active sites all orient the Ser(Cys)-His-Asp catalytic triad in a similar manner. The catalytic triad of ObiF is unique from AB3403 and EntF because it is predicted to move the His and Asp residues to unique loops while AB3403 and EntF conserve the locations of these residues.

[0207] FIG. 14E illustrates an overlay of the ObiF-TE (FIG. 14B) homology model with the X-Ray structures of AB3403-TE (FIG. 14C) and EntF-TE (FIG. 14D). The catalytic triad of ObiF (red) is unique from AB3403 (light blue) and EntF (yellow). Homology modeling and comparative sequence analysis predicts that the His and Asp residues reside on unique loops of the secondary structure while AB3403 and EntF conserve the locations of these residues. Images of protein secondary structure were generated using PyMOL v1.7 for Mac OS X.

[0208] The ObiF, AB3403, and EntF TE-domains have low sequence similarity (FIG. 14A), but all contain a Ser(Cys)-Asp-His catalytic triad and the GXS(C)XG motif characteristic of the hydrolase superfamily. The lid domain of the ObiF TE-domain more closely matches the lid domain of AB3403 TE-domain and both domains possess the active site Cys residue. The catalytic triads of the AB3403 and EntF TEs are located in conserved loops of the secondary structure, while the conserved Asp residue of the ObiF TE is apparently moved from -sheet 6 to -sheet 7, but is still predicted to interact with the conserved active site His based on homology modeling.

[0209] A C1141S mutation converted ObiF from a -lactone synthetase to a hydrolase producing RO-Obi exclusively in the -hydroxy acid form (see FIG. 2D and FIG. 2E). A C1141A mutation brought the catalytic activity of ObiF to a near halt with only trace amounts of RO-Obi detected by LC-MS (see FIG. 2D and FIG. 2E). Presumably the penultimate 2,3-DHB--OH-p-NO.sub.2-homoPhe thioester is stalled on the ObiF T domain since acyl transfer to the TE domain is blocked. The trace RO-Obi detected by LC-MS is predicted to form via slow hydrolysis of the T domain thioester (FIG. 2G). Prolonged exposure (24 hrs.) of the ObiF C1141A mutant gives a steady production of RO-Obi supporting that the NRPS module is functional, but requires slow non-enzymatic hydrolysis of the 2,3-DHB--OH-p-NO.sub.2-homoPhe-T domain thioester for turnover.

[0210] Recombinant ObiF containing a GHCAG motif (FIG. 7B) and ObiD homologues from C. shinanonensis SAY3 similarly catalyzed the in vitro conversion of -OH-p-NO.sub.2-homoPhe and 2,3-DHB to RC-Obi with similar efficiency as the P. fluorescens enzymes, suggesting that the NRPS module would be functional when expressed in C. shinanonensis. FIG. 64 is a chemical reaction diagram showing the production of RC-Obi and RO-Obi using recombinant ObiF and ObiD from C. shinanonensis genome. The illustrated scheme shows the conversion of starting materials 2,3-DHB and -OH-p-NO2-homoPhe to product RC-Obi, which then non-enzymatically hydrolyzes to RO-Obi.

[0211] FIGS. 76, 77, 78, and 79 are schematic diagrams showing domain arrangements for ObiF and ObiD from several different sources: P. fluorescens ATCC 39502 (GenBank KX134687 and KX134685) (FIG. 76), B. diffusa RF8-non_BP2 (GenBank WP_059467198.1, WP_059467197.1, and WP_059467195.1) (FIG. 77), C. shinanonensis SAY3 (GenBank WP_020608490.1 and WP_018749564.1) (FIG. 78), and EntF (C-A-T-TE), EntE (A.sub.Ar), and EntB (T.sub.Ar) (PDB 5ja1 and 2fq1) (FIG. 79).

[0212] The four different NRPSs illustrated in FIG. 76, FIG. 77, FIG. 78, and FIG. 79 show strong homology but flexibility in domain orientation. The P. fluorescens and C. shinanonensis NRPSs have the T.sub.Ar domain responsible for 2,3-DHB transport untethered from the rest of the enzyme. For the NRPS (EntF) of B. diffusa and the E. coli enterobactin, both the A.sub.Ar and T.sub.Ar domains responsible for 2,3-DHB adenylation and thioester formation act transiently with respect to the NRPS module.

[0213] The ObiF A domains are highly selective for -OH-p-NO.sub.2-homoPhe and 2,3-DHB. Analysis of ObiF with NRPSPredictor2 software predicted that the embedded A-domain would adenylate L-Thr and that the terminal A.sub.Ar domain would adenylate 2,3-DHB, as summarized in Table 2 below. Table 2 provides ObiF A domain selectivity predictions using NRPSPredictor2, Stachelhaus code, Minowa, and SeqL algorithms. The specificity-conferring sequence of the embedded ObiF A domain (D/A/W/G/C/G/L/I/N/K) shows similarity to the signature sequences for A domains that activate L-Thr (D/F/W/N/I/G/M/V/H/K) and L-Phe (D/A/W/T/I/A/A/V/C/K), with some key differences that help rationalize selectivity for the sterically larger -OH-p-NO.sub.2-homoPhe substrate. In comparison to L-Phe A domains, Thr at position 4 is changed to a Gly, thereby extending the active site pocket to accommodate the chain extended homoPhe. In comparison to L-Thr A domains, Phe at position 2 is changed to Ala and Asn at position 4 is changed to Gly, which leaves room to accommodate the benzyl group. Both L-Phe and L-Thr A domains have Ile at position 5, which is changed to Cys in ObiF.

[0214] FIG. 67 is a schematic diagram showing a model for -OH-p-NO.sub.2-homoPhe selection by ObiF A domain specificity-conferring code. The ten letter specificity-conferring code for the ObiF-embedded A domain was determined and compared with a previously-published A domain sequence responsible for activating Phe. Several important differences were observed. Thr at position 278 is changed to a glycine, which would extend the pocket allowing added length of the homoPhe group. Additionally, Ile at position 299 is changed to a Cys, which is a potential hydrogen-bonding partner for the NO2 group and might interact with the electron-deficient aromatic ring. When compared to a previously-published A domain that activates Thr, Phe at position 236 is changed to an Ala residue which leaves room to accommodate the benzyl group of -OH-p-NO2-homoPhe that could occupy the space normally filled with the phenyl group of Phe236. The same I299C change is also a difference between the ObiF A domain and Thr adenylating A domain. -OH-p-NO2-homoPhe is a novel amino acid and the specificity-conferring code of the ObiF A domain could enhance future prediction of A domain selectivity for large amino acids.

TABLE-US-00002 TABLE 2 ObiF A domain substrate prediction Cluster.sup.a NRPSPredictor2 Stachelhaus Minowa SeqL Burkholderia threonine glutamine threonine N5-Hydroxyornithine Chitiniphilus threonine alanine threonine N5-Hydroxyornithine Pseudomonas threonine glutamine threonine N5-Hydroxyornithine .sup.aThe full sequences for the P. fluorescens, B. diffusa, and C. shinanonensis obafluorin biosynthetic gene clusters were entered into antiSMASH (antismash.secondarymetabolites.org) for analysis. Adenylation domain selectivity was predicted using NRPSPredictor2.sup.1,2, Stachelhaus code.sup.3, Minowa.sup.4, and SEQL-NRPS.sup.5. All methods predicted 2,3-DHB as substrate for A.sub.Ar.

[0215] FIG. 67 is a schematic diagram showing a model for -OH-p-NO2-homoPhe selection by ObiF A domain specificity-conferring code. The ten letter specificity-conferring code for the ObiF-embedded A domain was determined and compared with a previously-published A domain sequence responsible for activating Phe. Several important differences were observed. Thr at position 278 is changed to a glycine, which would extend the pocket allowing added length of the homoPhe group. Additionally, Ile at position 299 is changed to a Cys, which is a potential hydrogen-bonding partner for the NO2 group and might interact with the electron-deficient aromatic ring. When compared to a previously-published A domain that activates Thr, Phe at position 236 is changed to an Ala residue which leaves room to accommodate the benzyl group of -OH-p-NO2-homoPhe that could occupy the space normally filled with the phenyl group of Phe236. The same I299C change is also a difference between the ObiF A domain and Thr adenylating A domain. -OH-p-NO.sub.2-homoPhe is a novel amino acid and the specificity-conferring code of the ObiF A domain could enhance future prediction of A domain selectivity for large amino acids.

[0216] Without being limited to any particular theory, the Cys in ObiF may interact favorably with the electron deficient nitro-phenyl group (FIG. 67). The ATP-[32P]PPi exchange assay, which tests for reversible acyl adenylate intermediate formation, was used in Example 11 to show that ObiF was highly selective for activating -OH-p-NO.sub.2-homoPhe and 2,3-DHB as acyl adenylates (FIG. 2K). Proteinogenic amino acids, including the -hydroxy (L-Thr and L-Ser) and aromatic (L-Phe) amino acids, gave signals comparable to the control further supporting the high selectivity of the ObiF A domains for activating the non-proteinogenic amino acid -OH-p-NO2-homoPhe and 2,3-DHB (FIG. 2K).

Role of Cys1141 of ObiF in -Lactone Biosynthesis

[0217] It was discovered that the ObiF TE-domain has a direct role in the formation of the Obi -lactone ring as the final biosynthetic step releasing the mature cyclized product from the NRPS assembly line (FIG. 3B). The ObiF 2,3-DHB--OH-p-NO.sub.2-homoPhe-T-thioester is shuttled from the T domain and loaded to the TE domain via transthioesterification where it resides as the C1141 thioester and undergoes C3-OH to C1 cyclization to release Obi -lactone. Mutations of Ser to Cys have been previously reported to make deacylation of the TE active site rate limiting.

[0218] FIG. 3B is a schematic illustration showing a mechanistic model for -lactone ring during antibiotic cleavage from the ObiF NRPS assembly line. The catalytic triad (Cys.sub.1141-His.sub.1297-Asp.sub.1267) and oxyanion hole (Gly.sub.1139-Gly.sub.1143) of the ObiF TE domain are shown in red. His.sub.1297 is predicted to assist in the deprotonation of Cys.sub.1141 during attack of the thiolate on the Obi T-domain thioester to form the stabilized tetrahedral intermediate (I). Breakdown of the tetrahedral intermediate results in the Obi TE domain thioester of Cys.sub.1141 and the free T domain thiol, completing the transthioesterification. His.sub.1297 is predicted to assist in deprotonating the -hydroxyl group during nucleophilic addition to the C1-thioester carbonyl forming the stabilized 4-membered tetrahedral intermediate (III). Breakdown of the tetrahedral intermediate forms the RC-Obi -lactone and regenerates the Cys.sub.1141 thiol (IV). Release of RC-Obi completes turnover of ObiF and opens the TE domain for a new Obi T domain thioester for another round of transthioesterification and -lactone ring formation (V).

[0219] Without being limited to any particular theory, in the case of -lactone formation, the weaker CS bond of the thioester compared to the CO bond of an oxoester is likely required to make strained ring formation thermodynamically favorable. Further, slowing the rate of deacylation increases the dwell time of the C1141-thioester, which may play a role in making cyclization competitive with hydrolysis. Substrate preorganization has been reported previously to be an important factor in NRPS and PKS TE-mediated macrocylizations, and influence the ring size tolerance of the cyclization.

[0220] Because the thermodynamic requirements for -lactone formation are not met by the oxoester intermediate created by the ObiF-C1141S mutant, only the hydrolysis product RO-Obi accumulates (FIG. 2E). The ObiF-C1141A mutant also fails to generate detectable concentrations of RC-Obi -lactone, which confirms the role of TE catalysis in -lactone ring formation. As demonstrated in Example 14, the rate of hydrolysis of N-acetylcysteamine (SNAC) thioester (Obi-SNAC) was comparable to that of the ObiF-C1141A mutant (FIG. 2E and FIG. 38C), which further supports the role of the ObiF TE domain as a catalyst for -lactone ring formation. TE domains have been used as autonomous catalysts on preparative scale for the cyclization of peptide substrates.

Modifications of Obi Biosynthesis Method

[0221] The beta-lactone synthetase identified in the Obi gene cluster is a type I / hydrolase TE domain that is part of an NRPS module (ObiF). TE Domains are a highly diverse family of / hydrolases that employ a variety of antibiotic release strategies including hydrolysis and macrocyclization. Without being limited to any particular theory, general features identified by the characterization of the Obi NRPS TE domain may be genetic and biochemical signatures associated with -lactone biosynthesis. The presence of an active site Cys residue in the GXCXG motif of a type I TE is a feature associated with -lactone ring formation that ensures a thermodynamically favorable scenario for strained ring formation proceeding through a more reactive thioester as compared to the traditional oxoester intermediate encountered during TE-mediated off-loading of NRPS products in other biosynthetic processes.

[0222] Amongst the type I TE domains, GXCXG motifs with an active site Cys instead of Ser are rare. Analysis of the thioesterase protein family (PF00975, European Bioinformatics Institute) revealed that 264 out of 3863 members (6.8%) contained a GXCXG, while the remaining 93.2% contained a GXSXG motif. Analysis of the top 20,000 hits from standard protein BLAST search of the full ObiF sequence against non-redundant protein sequences in the NCBI database revealed that 13,944 sequences possessed a GXSXG motif, 1,240 sequences contained a GXCXG motif, and 194 sequences contained a GHCXG motif. The ObiF TE domains from P. fluorescens, C. shinanonesis, and B. diffusa as reported all contain a GHCAG motif and show >50% total sequence homology (FIG. 7B). The ObiF TE domains are sequence unique compared to a diverse sampling of PKS and NRPS type I and type II TE domains including the TE-domains of the pyochelin and AB3403 NRPS modules that contain a GXCXG motif.

[0223] Homology modeling of the ObiF TE domain with the EntF (19% sequence similarity) and AB3403 (20% sequence similarity) TE-domains (see FIG. 14A) revealed similarities in the secondary structure with clear differences in the location of the Ser/Cys-His-Asp catalytic triads (see FIG. 14B, FIG. 14C, and FIG. 14D). The catalytic triads of the AB3403 and EntF TEs are located in conserved sites of the -- repeat secondary structure consistent with canonical type I / hydrolases. The conserved Asp residue of the ObiF TE is apparently moved from -strand 6 to -strand 7, but is still predicted to interact with the conserved active site His in the catalytic triad.

[0224] Inclusion of the 2,3-DHB-activating AA, domain as part of the ObiF NRPS module (see FIG. 41) appears to be optional, as illustrated in FIGS. 76, 77, 78, and 79. In the P. fluorescens and C. shinanonesis ObiF NRPSs the A.sub.Ar domain is included in the primary sequence of the assembly as the last catalytic domain. In the B. diffusa NRPS, the A.sub.Ar domain is predicted to be a stand-alone enzyme that activates 2,3-DHB as the acyl adenylate for transfer to the T.sub.Ar carrier protein in analogy to the enterobactin NRPS machinery (EntFEB). An MbtH domain is encoded in the ObiF primary sequence between the TE and A.sub.Ar domains (see FIG. 3D). The MbtH-like protein YbdZ is encoded in the enterobactin biosynthetic gene cluster and has been shown to enhance the adenylation activity of EntF44. The ObiF MbtH-like domain might play a similar role as YbdZ. Further, as illustrated in FIG. 3D, biosynthesis of the -lactone antibiotic obafluorin proceeds through -OH-p-NO.sub.2-homoPhe and 2,3-DHB intermediates. Functional studies reveal that NRPS ObiF uses a type I thioesterase domain to catalyze cyclization of a -hydroxy thioester to the corresponding -lactone during antibiotic cleavage from the illustrated assembly line.

[0225] Recent published structural and biophysical studies of NRPS modules with C-A-T-TE domains have provided insight into the motions and dynamics of individual domains during coordinated catalysis by the enzyme assembly lines. The TE domain is predicted to be highly dynamic and distal from the T domain until invoked for final release of the antibiotic. In the case of ObiF, this would leave A.sub.Ar free to catalyze the formation of the 2,3-DHB acyl adenylate and keep the T.sub.Ar carrier protein loaded as a 2,3-DHB phosphopantetheinyl thioester. In the case of enterobactin biosynthesis, the A.sub.Ar and T.sub.Ar domains, EntE and EntB, respectively, are separate from the main NRPS module, EntF, which activates and loads Ser as a T domain phosphopantetheinyl thioester. The full length EntF is required for trimerization of Ser, amide bond formation with 2,3-DHB, and cyclization to the macrolactone. Thus, only A.sub.Ar and T.sub.Ar domains have been shown to be active in trans supporting the existence of ObiF NRPS modules with and without the A.sub.Ar domain as part of the main NRPS module (see FIG. 41).

[0226] Without being limited to any particular theory, other catalytic domains with active site Cys residues might be capable of catalyzing the cyclization of -hydroxy thioesters to -lactones. For example, it was previously reported that an uncharacterized ketosynthase (KS) domain resides at the C-terminus of the ebelactone PKS termination module. KS-Domains are reported to undergo transthioesterification reactions with T-domain thioesters to form an intermediate KS Cys thioester that is part of a conserved Cys-His-His triad. The KS Cys-His-His triad typically catalyzes thio-Claisen condensation with a malonyl T domain thioester, but might also be capable of -lactone ring formation. The termination module of the hybrid PKS-NRPS assembly line for oxazolomycin features a C-terminal C domain of unknown function. Condensation domains typically catalyze amide bond formation between two T domain thioesters, but there are previously documented cases of C domains catalyzing cyclization during product release such as in cyclosporin A and enniatin biosynthesis. The terminal C-domain of the oxazolomycin assembly line might catalyze the intramolecular condensation of a T domain thioester to the spirocyclic -lactone. The salinosporamide biosynthetic gene cluster encodes for several uncharacterized enzymes including a stand-alone KS domain, SalC, and a type II thioesterase, SalF4. SalF contains a GXSXG catalytic motif and has been proposed to be involved in proofreading, which might indicate a role as a classic hydrolase. The KS domain SalC could be involved in formation of the cis-fused bicyclic -lactone or the salinosporamides might experience the same fate as the closely related lactacystin, which is cleaved from the assembly line as an N-acetylcystein thioester and non-enzymatically equilibrates with the -lactone in solution.

[0227] The presence of genes encoding for a pyruvate decarboxylase and threonine aldolase simultaneously in a biosynthetic gene cluster may also serve as a genetic signature for -hydroxy--amino acid production. Fe(II)/-KG-dependent oxygenases and non-heme di-iron oxygenases are known to produce -hydroxy--amino acids via direct CH bond activation chemistry. The direct hydroxylation of amino acid side chains take place while loaded as phosphopantetheinyl thioesters on NRPS T domains. This makes A domain substrate prediction insufficient for the potential incorporation of -hydroxy--amino acids into NRP scaffolds.

[0228] The Obi -lactone scaffold represents a novel structural class of -lactone antibiotics from nature's chemical inventory. The Obi biosynthetic machinery characterized in this study offers a versatile platform for the chemoenzymatic synthesis of -lactones from -hydroxy -amino acid precursors. Here, the novel amino acid -OH-p-NO.sub.2-homoPhe was produced by the tandem action of arylamine oxidase ObiL, phenylpyruvate decarboxylase ObiG, and threonine aldolase ObiH, which might represent a general strategy for producing -hydroxy--amino acid precursors to peptide -lactones. The Obi NRPS biosynthetic machinery, ObiF and ObiD, contains a sequence novel TE domain with a rare catalytic Cys residue that plays a direct role in -lactone ring formation.

[0229] In an aspect, -hydroxy--amino acids may be directly incorporated into peptide scaffolds on an NRPS assembly line leading to peptides capped at the C-terminus with a -lactone warhead. The genetic and biochemical characterization of the Obi biosynthetic pathway in P. fluorescens described herein serves as a basis for expanding the known chemistry of NRPS and PKS product release mechanisms to include strained ring formation. In various aspects, the chemoenzymatic approach to the biosynthesis of C-terminal -lactone peptides may be modified as described above to enable precursor-directed process modifications and NRPS engineering to develop biosynthetic methods for producing a variety of targeted peptide -lactone inhibitors of proteases for the treatment of diseases associated with microbial and viral infections, cancer, and/or obesity.

Methods of Producing of -Lactone Peptides

[0230] In various aspects, at least one of the isolated and purified enzymes encoded by the Obi gene cluster may be incorporated into a method for producing a peptide beta-lactone from one or more precursor compounds. The method makes use of the biosynthetic pathways and enzymes disclosed herein associated with the production of RC-Obi (see FIG. 3C). In an aspect, the method for producing a peptide beta-lactone is implemented in vitro using existing devices and/or systems. Non-limiting examples of suitable devices and/or systems include single batch reactors including stirred batch reactors, semi-batch reactors, a series of two or more connected batch reactors, a continuous flow reactor, a trickle-bed reactor, and any other suitable device and/or system known in the art.

[0231] In various aspects, the isolated and purified enzymes incorporated into the method of producing peptide beta-lactones may be any one or more enzymes encoded by the Obi gene cluster of Pseudomonas fluorescens as well as variants of the one or more enzymes including, but not limited to, homologous enzymes from other Pseudomonad species including the environmental chitin-degrading bacterium Chitiniphilus shinanonensis and the plant growth-promoting rhizobacterium Burkholderia diffusa. In another aspect, the enzymes used in various aspects of the method may be modified to enhance enzyme activity for a particular substrate and/or to maintain activity for a wider variety of substrates.

[0232] The number of enzymes incorporated into the method in various aspects may vary depending on one or more of at least several factors including, but not limited to, the precursor compounds used to produce the peptide beta-lactones using the method and/or any modifications to the enzymes used in the method. In one aspect, the method of producing a peptide beta-lactone may include a number of enzymes encoded by the Obi gene cluster ranging from one enzyme to about 11 enzymes or more.

[0233] In various aspects, the enzymes incorporated into the method of producing peptide beta-lactones may be isolated and purified enzymes obtained by isolation from one or more cell cultures that contain cells that express one or more of the enzymes used in the method. In one aspect, the cell cultures may contain cells that express the one or more enzymes as describe herein above including, but not limited to Pseudomonas fluorescens cells, Chitiniphilus shinanonensis cells, and Burkholderia diffusa cells. In another aspect, the cell cultures may include transgenic cells including, but not limited to, transgenic E. coli and yeast cells in which at least a portion of the Obi gene cluster expressing one or more of the enzymes associated with RC-Obi biosynthesis forms have been introduced. In an aspect, at least a portion of the Obi gene cluster introduced into the transgenic cell may be modified using known methods in order to enhance the efficiency of enzyme expression.

[0234] In one aspect, the isolated enzymes may be one or more enzymes encoded by at least a portion of the Obi gene cluster. Suitable enzymes may include the enzymes associated with biosynthesis as listed in Table 3 below:

TABLE-US-00003 TABLE3 SequencesofRC-ObiBiosynthesisEnzymes Gene Protein Proteinsequence obiD Aryl MTQGKLIYDKADFYAEIAAILRIPTEELAELE carrier SPQEAGVDSVRLLTLSEKWRKRGIDVSFMELA protein ERPGFTAWWELLSARMPVTECEQP (ArCP) (EntB) obiF NRPSw/ MSASFTTALTSAQQSIWMGHQFDPQSPAYNVA C-A-T- SYIEMSGDIDPQRLQHALQRAVDDIEALRARF TE-A HEDETQGGALTQTILAQVAVELNVFAVDAEQA domains RSWMESDLARPTDLTSGPIFSSALLQVAPNVN (EntF+ YWYFKTHHIVMDGVALSMLFKRVADLYGQAPD EntE) ALCSPSPFGSVRQVLENEQAWRASPFAQDREF WQQHCQDMAEVASLNSDVAQPSYQAIQHRRVL DESIMASLRERAEAMDSQWVNVLLAAFGAFVG RSTGYRQVTVGVPMMNRFATGAINVPCTLANV LPLRLDIKPGQSVEQLVASVQAQLDRMRPHQR YRAEDIRRDCNLLGDNRRLTGPQINIDFFSAK LSFDGVPGEVNVLSAGPADDLSLLIQTPADDK TLNIIAMANPALYSRAALERHVQRFIDFVERF AAASDTPLGQLDAYDATDPGYAQGNACFSPVN QAHTLAQTLVERFERAVHATPDAIALTFNGEH LTYQALNQRANRLAHLIQDQTGQTSPQPVALL LARSVQTFVCILGVLKAGAHYVPLDPDAPAER ITTILEDTCPTLVICDQSSQALVSGSDVKVMV IDTPSCMDAVQQQSIDNLQSGPRANDLAYIIY TSGSTGKPKGVCITHHNVVRLFENTHHWFDYR SSDVWTACHGYIFDASVWEMWGAFAHGGRLVL VPVDTTRDPEKLLELVVQEQVTVFGQIPSAFY RFMEAQADQPALAARLNLRYQCFGGEALDLSR LKPWFEHYGHSRTRLLNLYGITETTINATYQF VTLEQVQTNQGSLIGTVYDDLDIKVLDDALRP VPVGGYGEMYVRGAGLARGYLNRQDLDATRFV ADPFGAPGERMYRSGDVAALQEGGVLEYIGRA DQQVKVRGYRIELGEIETQLRGHPLLSDAIAL VVTDASGDPKLVAHVVPKATCRCEDIDTAQVR DYLRERLPSYMVPGAIGVQERLPVTLSGKVDR KALPTIALSGARQVEAPRDELDERVLAAWSEQ LEIDTLGIDDNFFDIGGDSIKAIRICRDLGLP VTELFDHPTPRANADYLRDHQDNDAQGAVNWL HAFDKSAKKERLNLVCVPFAGGNAFAYRNLVN QLSSVFNCVSVNLPGHDIMRPDEGMQALEVVA DAATQEILATLSGPIIVYGHCAGNATAIEIAR RLEQAGADLKALVIGGMLLDQDPVDVQARVAD QSGENIIDFLQQIGGFKEVLDDASMASIARMT KHDATQTARFFAEEALNRQTLQAPIHVIVGDM DPLTPDYEERYKDWQMYSSDVTLSVIEGGGHY FVTDLAEPLAQVLLANYKHLNPVVPVRAPRAL RAFHNPFDDVEGRFSLLANDARQLSLWPEFAP TPAGWTALFGPASHSECLARTQAYDHEALISP PAPTEGLDAPYWPEAFESRYRASGWWTGETLG AILTRHALLAPQRVAVTDGDRNLSYSQLDSNA DRIADGFATLGVKAGDRVVVQLPNSMEFIETI FGLFRLGAIPVFALPSDRLNEITHIFEISGAI AYVIKDQALGFDYRRIATELTQQIASIKQVIV VGDAEGFVPFANLYGRTAAWPQRSSREPALIT LSGGSTALPKLILRRHDDYLYSFKASARICQL DSDSVYLCVLPAGHNFTLSSPGFLGVLYAGGR VVMTSDPSGSGAFALIERERVTLTSVVPSLAQ AWLHSSRDHDLSSLQLLQVGGARLSDDVAERL ATSFDCQLQQVYGMSEGLVCYTAVGDTEEHVL HTQGRPISSGDEILIVDENDEPVANGVAGQLL VRGPYTIRGYLNAPEHNARAFTPDGFYRTGDV VVFRDDGYLVVTGRIKDQVNRGGEKIAAEEIE GYLLAHPGVLEAGIIGLPDEYLGEVSCAVVVL APGAQLTASALKSFVRQQGIAAFKVPDQVHLV PSLPKTTLGKIDKKLLRVQLGQ obiF- NRPSw/ MSASFTTALTSAQQSIWMGHQFDPQSPAYNVA C1141A C-A-T- SYIEMSGDIDPQRLQHALQRAVDDIEALRARF TE-A HEDETQGGALTQTILAQVAVELNVFAVDAEQA domains RSWMESDLARPTDLTSGPIFSSALLQVAPNVN (EntF+ YWYFKTHHIVMDGVALSMLFKRVADLYGQAPD EntE) LCSPSPFGSVRQVLENEQAWRASPAFAQDREF WQQHCQDMAEVASLNSDVAQPSYQAIQHRRVL DESIMASLRERAEAMDSQWVNVLLAAFGAFVG RSTGYRQVTVGVPMMNRFATGAINVPCTLANV LPLRLDIKPGQSVEQLVASVQAQLDRMRPHQR YRAEDIRRDCNLLGDNRRLTGPQINIDFFSAK LSFDGVPGEVNVLSAGPADDLSLLIQTPADDK TLNIIAMANPALYSRAALERHVQRFIDFVERF AAASDTPLGQLDAYDATDPGYAQGNACFSPVN QAHTLAQTLVERFERAVHATPDAIALTFNGEH LTYQALNQRANRLAHLIQDQTGQTSPQPVALL LARSVQTFVCILGVLKAGAHYVPLDPDAPAER ITTILEDTCPTLVICDQSSQALVSGSDVKVMV IDTPSCMDAVQQQSIDNLQSGPRANDLAYIIY TSGSTGKPKGVCITHHNVVRLFENTHHWFDYR SSDVWTACHGYIFDASVWEMWGAFAHGGRLVL VPVDTTRDPEKLLELVVQEQVTVFGQIPSAFY RFMEAQADQPALAARLNLRYQCFGGEALDLSR LKPWFEHYGHSRTRLLNLYGITETTINATYQF VTLEQVQTNQGSLIGTVYDDLDIKVLDDALRP VPVGGYGEMYVRGAGLARGYLNRQDLDATRFV ADPFGAPGERMYRSGDVAALQEGGVLEYIGRA DQQVKVRGYRIELGEIETQLRGHPLLSDAIAL VVTDASGDPKLVAHVVPKATCRCEDIDTAQVR DYLRERLPSYMVPGAIGVQERLPVTLSGKVDR KALPTIALSGARQVEAPRDELDERVLAAWSEQ LEIDTLGIDDNFFDIGGDSIKAIRICRDLGLP VTELFDHPTPRANADYLRDHQDNDAQGAVNWL HAFDKSAKKERLNLVCVPFAGGNAFAYRNLVN QLSSVFNCVSVNLPGHDIMRPDEGMQALEVVA DAATQEILATLSGPIIVYGHAAGNATAIEIAR RLEQAGADLKALVIGGMLLDQDPVDVQARVAD QSGENIIDFLQQIGGFKEVLDDASMASIARMT KHDATQTARFFAEEALNRQTLQAPIHVIVGDM DPLTPDYEERYKDWQMYSSDVTLSVIEGGGHY FVTDLAEPLAQVLLANYKHLNPVVPVRAPRAL RAFHNPFDDVEGRFSLLANDARQLSLWPEFAP TPAGWTALFGPASHSECLARTQAYDHEALISP PAPTEGLDAPYWPEAFESRYRASGWWTGETLG AILTRHALLAPQRVAVTDGDRNLSYSQLDSNA DRIADGFATLGVKAGDRVVVQLPNSMEFIETI FGLFRLGAIPVFALPSDRLNEITHIFEISGAI AYVIKDQALGFDYRRIATELTQQIASIKQVIV VGDAEGFVPFANLYGRTAAWPQRSSREPALIT LSGGSTALPKLILRRHDDYLYSFKASARICQL DSDSVYLCVLPAGHNFTLSSPGFLGVLYAGGR VVMTSDPSGSGAFALIERERVTLTSVVPSLAQ AWLHSSRDHDLSSLQLLQVGGARLSDDVAERL ATSFDCQLQQVYGMSEGLVCYTAVGDTEEHVL HTQGRPISSGDEILIVDENDEPVANGVAGQLL VRGPYTIRGYLNAPEHNARAFTPDGFYRTGDV VVFRDDGYLVVTGRIKDQVNRGGEKIAAEEIE GYLLAHPGVLEAGIIGLPDEYLGEVSCAVVVL APGAQLTASALKSFVRQQGIAAFKVPDQVHLV PSLPKTTLGKIDKKLLRVQLGQ obiF- NRPSw/ MSASFTTALTSAQQSIWMGHQFDPQSPAYNVA C1141S C-A-T- SYIEMSGDIDPQRLQHALQRAVDDIEALRARF TE-A HEDETQGGALTQTILAQVAVELNVFAVDAEQA domains RSWMESDLARPTDLTSGPIFSSALLQVAPNVN (EntF+ YWYFKTHHIVMDGVALSMLFKRVADLYGQAPD EntE) LCSPSPFGSVRQVLENEQAWRASPAFAQDREF WQQHCQDMAEVASLNSDVAQPSYQAIQHRRVL DESIMASLRERAEAMDSQWVNVLLAAFGAFVG RSTGYRQVTVGVPMMNRFATGAINVPCTLANV LPLRLDIKPGQSVEQLVASVQAQLDRMRPHQR YRAEDIRRDCNLLGDNRRLTGPQINIDFFSAK LSFDGVPGEVNVLSAGPADDLSLLIQTPADDK TLNIIAMANPALYSRAALERHVQRFIDFVERF AAASDTPLGQLDAYDATDPGYAQGNACFSPVN QAHTLAQTLVERFERAVHATPDAIALTFNGEH LTYQALNQRANRLAHLIQDQTGQTSPQPVALL LARSVQTFVCILGVLKAGAHYVPLDPDAPAER ITTILEDTCPTLVICDQSSQALVSGSDVKVMV IDTPSCMDAVQQQSIDNLQSGPRANDLAYIIY TSGSTGKPKGVCITHHNVVRLFENTHHWFDYR SSDVWTACHGYIFDASVWEMWGAFAHGGRLVL VPVDTTRDPEKLLELVVQEQVTVFGQIPSAFY RFMEAQADQPALAARLNLRYQCFGGEALDLSR LKPWFEHYGHSRTRLLNLYGITETTINATYQF VTLEQVQTNQGSLIGTVYDDLDIKVLDDALRP VPVGGYGEMYVRGAGLARGYLNRQDLDATRFV ADPFGAPGERMYRSGDVAALQEGGVLEYIGRA DQQVKVRGYRIELGEIETQLRGHPLLSDAIAL VVTDASGDPKLVAHVVPKATCRCEDIDTAQVR DYLRERLPSYMVPGAIGVQERLPVTLSGKVDR KALPTIALSGARQVEAPRDELDERVLAAWSEQ LEIDTLGIDDNFFDIGGDSIKAIRICRDLGLP VTELFDHPTPRANADYLRDHQDNDAQGAVNWL HAFDKSAKKERLNLVCVPFAGGNAFAYRNLVN QLSSVFNCVSVNLPGHDIMRPDEGMQALEVVA DAATQEILATLSGPIIVYGHSAGNATAIEIAR RLEQAGADLKALVIGGMLLDQDPVDVQARVAD QSGENIIDFLQQIGGFKEVLDDASMASIARMT KHDATQTARFFAEEALNRQTLQAPIHVIVGDM DPLTPDYEERYKDWQMYSSDVTLSVIEGGGHY FVTDLAEPLAQVLLANYKHLNPVVPVRAPRAL RAFHNPFDDVEGRFSLLANDARQLSLWPEFAP TPAGWTALFGPASHSECLARTQAYDHEALISP PAPTEGLDAPYWPEAFESRYRASGWWTGETLG AILTRHALLAPQRVAVTDGDRNLSYSQLDSNA DRIADGFATLGVKAGDRVVVQLPNSMEFIETI FGLFRLGAIPVFALPSDRLNEITHIFEISGAI AYVIKDQALGFDYRRIATELTQQIASIKQVIV VGDAEGFVPFANLYGRTAAWPQRSSREPALIT LSGGSTALPKLILRRHDDYLYSFKASARICQL DSDSVYLCVLPAGHNFTLSSPGFLGVLYAGGR VVMTSDPSGSGAFALIERERVTLTSVVPSLAQ AWLHSSRDHDLSSLQLLQVGGARLSDDVAERL ATSFDCQLQQVYGMSEGLVCYTAVGDTEEHVL HTQGRPISSGDEILIVDENDEPVANGVAGQLL VRGPYTIRGYLNAPEHNARAFTPDGFYRTGDV VVFRDDGYLVVTGRIKDQVNRGGEKIAAEEIE GYLLAHPGVLEAGIIGLPDEYLGEVSCAVVVL APGAQLTASALKSFVRQQGIAAFKVPDQVHLV PSLPKTTLGKIDKKLLRVQLGQ obiH serine MSNVKQQTAQIVDWLSSTLGKDHQYREDSLSL hydroxy- TANENYPSALVRLTSGSTAGAFYHCSFPFEVP methyl- AGEWHFPEPGHMNAIADQVRDLGKTLIGAQAF trans- DWRPNGGSTAEQALMLAACKPGEGFVHFAHRD ferase/ GGHFALESLAQKMGIEIFHLPVNPTSLLIDVA threonine KLDEMVRRNPHIRIVILDQSFKLRWQPLAEIR aldoloase SVLPDSCTLTYDMSHDGGLIMGGVFDSPLSCG ADIVHGNTHKTIPGPQKGYIGFKSAQHPLLVD TSLWVCPHLQSNCHAEQLPPMWVAFKEMELFG RDYAAQIVSNAKTLARHLHELGLDVTGESFGF TQTHQVHFAVGDLQKALDLCVNSLHAGGIRST NIEIPGKPGVHGIRLGVQAMTRRGMKEKDFEV VARFIADLYFKKTEPAKVAQQIKEFLQAFPLA PLAYSFDNYLDEELLAAVYQGAQR obiG Thiamine- MTNLPSTHINLTSEEVSLGDLVGRVLVESGID dependent DLFCIPGDFTMQLSRELLTTPGLALRTMSHEY pyruvate GTTLAALGYAVGKGVPGAVCFTYGVGVLNATN decarbox- AIAQAYVERVPLLVFSGSPGTRERQAPLFLHH ylase TIVDHQTQYRIMKEITVHQVCVTDPHQVLEQL REAVALAVLHSRPVYIEIPRDLFQARVRYSPA RRVPLEPSTRYSQAARQAAELAYALVRKARDP VFVPGLDLKRRGLTDLAMRVCERLAMPWVATP MSRGGIPVSHPNYRGIYAGPASPSRVTRELLA KCDVLMLIGEPNSDVNMGIASHIAKGRLIHAD DGKISVGRQHFNASTAEFLIAFSDVIHNAKTP LAPLTETQKDFIVPTPASLYPSEESPLTPFDI INELNRHFVTQPDTQLVVDCGDVFFMSLGMFP ADVLTSPLYMSMGIAVPGAMGYQLGTGKRPIV LVGDGAFHMTGNELMRAAKFGLSPIVIVLNNQ RWASLSSDAADIALTEQMPMSFSAAGQFLQVQ AFTATTGRELRQHLEEALNMDRPVLIDAQVDP SKRSYLCERFFDAVKGQQHLPKA obiL p-amino- MPESQLLNKITDTWYAKATVRSTPRILVPDYS benzoate SEQLIYPVARCSICEHPLVLELGPQVRSYILT N- QAAYQFLYGVGLLETKFVIQCCLDMLHNNIKD oxygenase ISDAAKLQALTVIVDEGYHAHVALDYIIQMKK (AurF) KSAIEPLEVPQTNRKLDATARAYASLPESMRM DFQLLAVTLAENVLTDEVANLGRERELAQSFT TLMMDHVRDEGRHSRFFADLMKERWPQLPRAT QEHFGLMLPAYLDDFLGADLSRGFERKILAHC GLTEAQAEQVIHESDPHFSTDQARMKKSILQR IYRLLNQIGVLELDSVKDAFSDRNYVTT

[0235] In an aspect, the one or more enzymes may be isolated and purified from the one or more cell cultures using any known method including, but not limited to, chromatographic separation methods similar to the isolation and purification methods described in the Examples herein. In one aspect, for those enzymes produced by transgenic cells, the enzymes may be further treated after isolation and purification in order to activate the enzyme prior to use. By way of non-limiting example, recombinant ObiF and ObiD enzymes may be treated with phosphopantetheinyl transferase (Sfp) enzyme in order to add the required phosphopantetheinyl post-translational modification to the PCP domains that is required for activity prior to use.

[0236] FIG. 42 is a schematic diagram showing a method of producing a peptide beta-lactone from a beta-hydroxy-alpha-amino acid in one aspect. As illustrated in FIG. 42, the beta-hydroxy-alpha-amino acid and a benzoic acid derivative with an aryl carrier protein including, but not limited to, ObiD and a non-ribosomal protein synthetase including, but not limited to, ObiF, produces a closed beta-lactone ring.

[0237] In one aspect, the method illustrated in FIG. 42 may make use of a modified form of a non-ribosomal protein synthetase that is optimized to function without need for an aryl carrier protein. In one aspect, the non-ribosomal protein synthetase used in the method may be ObiF, a homolog of ObiF, recombinant ObiF, and any variation thereof comprising the amino acid sequence of SEQ ID NO:2 or fragment thereof. The ObiF performs transthioesterification of the beta-hydroxy-alpha-amino acid and benzoic acid derivative, as well as the formation of the peptide beta-lactone, as illustrated in FIG. 45.

[0238] In one aspect, the aryl carrier protein used in the method may be ObiD, a homolog of ObiD, recombinant ObiD, and any variation thereof comprising the amino acid sequence of SEQ ID NO:1 or fragment thereof. The ObiD positions the activated benzoic acid derivative at the C domain of ObiF for subsequent transthioesterification of the beta-hydroxy-alpha-amino acid and benzoic acid derivative, as well as the formation of the peptide beta-lactone, as illustrated in FIG. 3C.

[0239] In various aspects, the method may produce any peptide beta-lactone without limitation with suitable modification of the ObiF and/or ObiD enzymes. In one aspect, the peptide beta-lactone produced by the method may be obafluorin (RC-Obi), as illustrated in FIG. 3C. In another aspect, the method peptide beta-lactone produced by the method may be an obafluorin analog including, but not limited to any compound with one of the chemical structures as described below:

##STR00001## [0240] wherein n=1, 2, or 3, and

R=

[0241] ##STR00002##

[0242] In another aspect, the method may further include hydrolyzing the peptide beta-lactone produced by the method to produce a peptide beta-hydroxy acid, including, but not limited to, any compound with any one of the chemical structure as described herein below:

##STR00003## [0243] wherein n=0, 1, 2; and

[0244] R=

##STR00004##

[0245] In various aspects, any benzoic acid derivative may be contacted with the ObiF and ObiD enzymes or variations thereof without limitation. Non-limiting examples of suitable benzoic acid derivatives include 2,3-dihydroxoybenzoic acid, as described herein previously (see FIG. 3C). In one aspect, the benzoic acid derivative may be obtained commercially. In another aspect, the benzoic acid derivative may be synthesized in a separate process using any method known in the art without limitation. In an additional aspect, the benzoic acid derivative may be synthesized as part of a method of producing a peptide beta-lactone in another aspect described herein below.

[0246] In various aspects, any beta-hydroxy-alpha-amino acid may be contacted with the ObiF enzyme or variations thereof without limitation. Non-limiting examples of suitable beta-hydroxy-alpha-amino acid include beta-OH-p-NO.sub.2-homoPhe and beta-OH-homoPhe, as described herein previously (see FIG. 3C). In one aspect, the beta-hydroxy-alpha-amino acid may be obtained commercially. In another aspect, the beta-hydroxy-alpha-amino acid may be synthesized in a separate process using any method known in the art without limitation. In an additional aspect, the beta-hydroxy-alpha-amino acid may be synthesized as part of a method of producing a peptide beta-lactone in another aspect described herein below.

[0247] In another aspect, the method may also include forming the beta-hydroxy-alpha-amino acid by contacting an aliphatic or aryl aldehyde or derivative thereof, an amino acid, and a pyridoxyl phosphate (PLP) cofactor with a serine hydroxymethyltransferase/threonine aldoloase.

[0248] In an aspect, the serine hydroxymethyltransferase/threonine aldoloase used in the method may be ObiH, a homolog of ObiH, and any variation thereof comprising the amino acid sequence of SEQ ID NO:3 or fragment thereof. The ObiH catalyzes the synthesis of the beta-hydroxy-alpha-amino acid from the aliphatic or aryl aldehyde or derivative thereof and the amino acid in conjunction with the PLP cofactor as illustrated in FIG. 3C.

[0249] In various aspects, any amino acid may be contacted with the ObiH or variations thereof without limitation. Non-limiting examples of suitable amino acids include: threonine and any isomer thereof, serine and any isomer thereof, and glycine and any isomer thereof. In one aspect, the amino acid may be L-threonine (L-Thr) as described herein previously (see FIG. 3C). In an aspect, the amino acids may be obtained commercially.

[0250] In various aspects, any aliphatic or aryl aldehyde or derivative may be contacted with the ObiH or variations thereof without limitation. Non-limiting examples of suitable aliphatic or aryl aldehydes or derivatives include: aliphatic aldehydes, aromatic benzaldehydes, aromatic phenylacetaldehydes, and aromatic cinnamaldehydes. In one aspect, the aliphatic or aryl aldehydes may be p-NO.sub.2-phenylacetaldehyde (PNPAA) as described herein previously (see FIG. 3C). In one aspect, the aliphatic or aryl aldehydes or derivatives may be obtained commercially. In another aspect, the aliphatic or aryl aldehydes or derivatives may be synthesized in a separate process using any method known in the art without limitation. In an additional aspect, the aliphatic or aryl aldehydes or derivatives may be synthesized as part of a method of producing a peptide beta-lactone in another aspect described herein below.

[0251] In another aspect, the method may also include forming the aliphatic or aryl aldehyde or derivative thereof by contacting an aliphatic or aryl pyruvate or derivative thereof and thiamine pyrophosphate (TPP) with a thiamine dependent pyruvate decarboxylase.

[0252] In an aspect, the thiamine dependent pyruvate decarboxylase used in the method may be ObiG, a homolog of ObiG, and any variation thereof comprising the amino acid sequence of SEQ ID NO:4 or a fragment thereof. The ObiG catalyzes the conversion of the phenyl pyruvate or derivative thereof to the aliphatic or aryl aldehyde or derivative in conjunction with the TPP cofactor as illustrated in FIG. 3C.

[0253] In various aspects, any phenyl pyruvate or derivative may be contacted with the ObiG or variations thereof without limitation. Non-limiting examples of suitable phenyl pyruvates or derivatives include: p-nitrophenylpyruvate, p-hydroxyphenylpyruvate, and phenylpyruvate. In one aspect, the phenyl pyruvate or derivative may be p-nitrophenylpyruvate (PNPPA) as described herein previously (see FIG. 3C). In one aspect, the phenyl pyruvate or derivative may be obtained commercially. In another aspect, the phenyl pyruvate or derivative may be synthesized in a separate process using any method known in the art without limitation. In an additional aspect, the phenyl pyruvate or derivative may be synthesized as part of a method of producing a peptide beta-lactone in another aspect described herein below.

[0254] In another aspect, the method may also include forming the aliphatic or aryl pyruvate derivative consisting of p-nitrophenylpyruvate (PNPPA) by contacting p-aminophenylpyruvate (PAPPA), oxygen, and Fe(II) with a p-aminobenzoate N-oxygenase.

[0255] In an aspect, the p-aminobenzoate N-oxygenase used in the method may be ObiL, a homolog of ObiL, and any variation thereof comprising the amino acid sequence of SEQ ID NO:5 or fragment thereof. The ObiL catalyzes the conversion of PAPPA to PNPPA in conjunction with the Fe(II) cofactor as illustrated in FIG. 3C.

[0256] FIG. 43 is a schematic diagram summarizing one aspect of a method (shown in detail in FIG. 3C) that incorporates all of the aspects described herein above that include the ObiG, ObiH, ObiL, ObiD, and ObiF enzymes encoded by the Obi gene cluster. As illustrated in FIG. 43, 2,3-DHB (a benzoic acid derivative) and beta-OH-p-NO.sub.2-homoPhe (a beta-hydroxy-alpha-amino acid) precursors are modified and combined to produce obafluorin (a peptide beta-lactone). FIG. 44 is a schematic diagram summarizing another aspect of a method for producing an RC-Obi analog that incorporates all of the aspects described herein above that include the ObiH, ObiD, and ObiF enzymes encoded by the Obi gene cluster. As illustrated in FIG. 44, a benzoic acid derivative and a beta-hydroxy-alpha-amino acid precursor to produce the RC-Obi analog (a peptide beta-lactone). As illustrated in FIG. 44, the R groups attached to the beta-hydroxy-alpha-amino acid precursor may include the R-groups defined herein above for non-limiting examples of RC-Obi analogs.

[0257] In another aspect, the method may be further modified to produce an N-acyl-beta-hydroxy-alpha-amino acid by hydrolyzing the peptide beta-lactone produced using any of the previous methods described herein above. Any suitable known method of hydrolysis may be used to hydrolyze the peptide beta-lactone without limitation. By way of non-limiting example, the peptide beta-lactone may be contacted with a hydrolyzing agent including, but not limited to, MES buffer.

EXAMPLES

Example 1: Sequencing of Pseudomonas fluorescens Genome

[0258] The genome of the known RC-Obi producer Pseudomonas fluorescens ATCC 39502 was sequenced to search for a putative Obi biosynthetic gene cluster. P. fluorescens ATCC 39502 was purchased from ATCC and glycerol stocks were made from cells grown in Bennet's media and stored at 80 C.

[0259] The P. fluorescens ATCC 39502 gDNA was isolated using a Qiagen DNeasy Blood & Tissue kit following the provided instructions. The gDNA was sequenced by Ambry Genetics (Aliso Viejo, Calif.) using Illumnia MiSeq. Contigs containing ORFs were assembled, annotated, and deposited in GenBank (Accession #s KX134682-KX134695) with assistance from Cofactor Genomics (St. Louis, Mo.).

[0260] A gene cluster of approximately 20 kb with 14 candidate coding sequences (CDSs) was identified, including one encoding an AurF di-iron non-heme arylamine oxygenase homolog (ObiL) predicted to install the aryl nitro functional group via oxidation of the precursor aniline, as illustrated in FIG. 1B and FIG. 2F and listed in Table 4 below. Table 4 includes a summary of the predicted functions of ORFs in the RC-Obi biosynthetic gene cluster in P. fluorescens ATCC 39502 and GenBank accession numbers. Table 5 includes a summary of the GenBank accession numbers of the homologous genes in Chitinphilus shinanonensis (SAY3), Burkholderia diffusa (RF8-non_BP2), and Pseudomonas sp. (37R15 and 34_E_7) cross-referenced to the corresponding genes in the Obi gene cluster of P. fluorescens.

TABLE-US-00004 TABLE 4 Putative functional assignments of genes in the P. fluorescens ATCC 39502 Obi biosynthetic cluster. GenBank Gene # AAs Predicted Function from BLAST Search.sup.1 Accession # obiA 473 Isochorismate synthase (EntC) KX134682 obiB 358 DAHP synthase KX134683 obiC 257 2,3-DHB-2,3-dehydrogenase (EntA) KX134684 obiD 88 Aryl carrier protein (T.sub.Ar) (EntB) KX134685 obiE 215 Isochrismatase (EntB) KX134686 obiF 1911 NRPS w/ C-A-T-TE-A.sub.Ar catalytic domains (EntF + EntE) KX134687 obiG 568 TPP dependent phenylpyruvate decarboxylase KX134688 obiH 441 Serine hydroxymethyl transferase/threonine aldolase KX134689 obiI 421 Bifunctional chorismate mutase/dehydratase (TyrA) KX134690 obiJ 487 p-aminobenzoate synthase (PabA) KX134691 obiK 200 4-amino-4-deoxychorismate synthase (PabA) KX134692 obiL 317 p-aminobenzoate N-oxygenase (AurF) KX134693 obiM 170 Autoinducer synthesis protein (Luxl) KX134694 obiN 237 Quorum-sensing control repressor (LuxR) KX134695 .sup.1Functions were predicted from NCBI protein BLAST searches against the non-redundant protein database. Homologous protein names are shown in parentheses.

TABLE-US-00005 TABLE 5 Homologous Obi biosynthetic gene clusters in the NCBI database. GenBank Accession Numbers P. fluorescens ATC C. shinanonensis B. diffusa Pseudomonas Pseudomonas Gene.sup.1 39502 SAY3 RF8-non_BP2 sp. 37_R_15 sp. 34_E_7 obiA KX134682 WP_051083264.1 WP_059467192.1 WP_065949338.1 WP_065936864.1 obiB KX134683 WP_018749566.1 WP_060322869.1 WP_065949339.1 WP_065936863.1 obiC KX134684 WP_018749565.1 WP_059467194.1 WP_065949340.1 WP_065936862.1 obiD KX134685 WP_018749564.1 WP_059467195.1 WP_065949341.1 WP_065936861.1 obiE KX134686 WP_018749563.1 WP_059467196.1 WP_065949342.1 WP_065936860.1 obiF KX134687 WP_020608490.1 WP_059467198.1.sup.2 WP_065949343.1 WP_065936859.1 WP_059467197.1.sup.3 obiG KX134688 WP_018749562.1 WP_060322856.1 WP_065949344.1 WP_065936858.1 obiH KX134689 WP_018749561.1 WP_059467200.1 WP_065949345.1 WP_065936857.1 obiI KX134690 WP_018749560.1 WP_059467202.1 WP_065949346.1 WP_065936856.1 obiJ KX134691 WP_051083263.1 WP_059467203.1 CRM14833.1 CRN02515.1.sup.d obiK KX134692 WP_051083262.1 WP_059467204.1 CRM14850.1 No number obiL KX134693 WP_026263186.1 WP_059467205.1 WP_065949347.1 WP_065936855.1 obiM KX134694 No No Homologue WP_065949348.1 WP_065936854.1 Homologue obiN KX134695 WP_018749568.1 No Homologue WP_065949349.1 WP_065936853.1 .sup.aPredicted gene functions are provided in Supplementary Table 1. .sup.bDomains = C-A-T-TE. .sup.cDomain = A.sub.Ar. .sup.dThere is a frame with an internal stop codon. The gene shows homology to WP_015032126.1, a predicted amino-deoxychorismate synthase, component I.

[0261] The sequenced Obi gene cluster was found to encode for putative enzymes required for the biosynthesis of 2,3-DHB (ObiA, ObiB, ObiC, and ObiE) and the non-proteinogenic amino acid -OH-p-NO.sub.2-homoPhe (ObiG, ObiI, ObiJ, ObiK, and ObiL), as summarized in FIG. 1B. CDSs encoding for an aryl acyl-carrier protein (ObiD) and an NRPS module (ObiF) with condensation (C), adenylation (A), thiolation (T), and thioesterase (TE) domains (see FIG. 1C) make up the remaining biosynthetic genes. The sequenced Obi gene cluster was not found to contain any obvious antibiotic resistance genes. Referring to FIG. 1B, the Lys-tRNA at the start of the Obi gene cluster is indicated by a hairpin structure. Genes representing ORFs of unknown/unrelated function are colored green, those of biosynthetic function are colored red, and those of regulatory function are colored blue. Three blocks of biosynthetic ORFs are arranged for transcription in the same direction: (I) 2,3-DHB biosynthesis, (II) nonribosomal peptide synthetase (NRPS) with C-A.sub.1-PCP-TE-A.sub.2 domains, and (III) -OH-p-NO.sub.2-homoPhe biosynthesis.

[0262] FIG. 1C shows an annotated biosynthetic gene cluster of Obi identified from whole genome sequencing of P. fluorescens ATCC 39502. Arrows representing CDSs for enzymes involved in the biosynthesis of 2,3-DHB and -OH-p-NO.sub.2-homoPhe are colored red and green, respectively. The NRPS CDSs are colored blue and abbreviations of catalytic domains are shown as blue spheres: A, adenylation; C, condensation; T, thiolation; and TE, thioesterase. CDSs proposed to have a role in regulation are colored orange.

[0263] Referring again to Table 4, genes obiM and obiN were determined to encode for proteins with strong homology to acylhomoserine lactone (AHL) synthase LuxI and AHL-binding transcriptional regulator LuxR, respectively. The LuxILuxR pair is known to be a common quorum sensing system found in many Pseudomonads. A BLAST search of the NCBI database using the NCBI BLAST analysis of the Obi biosynthetic gene cluster from P. fluorescens ATCC 39502 revealed homologous gene clusters in the environmental chitin-degrading bacteria Chitiniphilus shinanonensis SAY3 and the rhizobacterium Burkholderia diffusa RF8-non_BP2. Two additional clusters were found in Pseudomonas sp. 37 R 15 and Pseudomonas sp. 34_E_7 that were virtually identical in sequence identity (>95% for all protein sequences) and direction of gene transcription compared to the gene cluster found in P. fluorescens ATCC 39502. GenBank accession numbers are shown in Table 4 above. Gene function predictions, also shown in Table 4, revealed homologous Obi clusters in other Pseudomonads including Pseudomonas sp. 37_R_15 and 34_E_7, the environmental chitin-degrading bacterium Chitiniphilus shinanonensis SAY3 (see FIG. 7A and FIG. 7B), and the plant growth-promoting rhizobacterium Burkholderia diffusa RF8-non_BP2 (see FIG. 7A and FIG. 7B), which is also an opportunistic human pathogen.

[0264] FIG. 64 is a chemical reaction diagram showing the production of RC-Obi and RO-Obi using recombinant ObiF and ObiD from C. shinanonensis genome. The illustrated scheme shows the conversion of starting materials 2,3-DHB and -OH-p-NO2-homoPhe to product RC-Obi, which then non-enzymatically hydrolyzes to RO-Obi.

[0265] FIG. 65 is a graph showing LC-MS traces from samples of a reaction mixture obtained at various times of the reaction illustrated in FIG. 64, characterizing a time-dependent buildup of the RC-Obi peak (rt=0.5 min; m/z for [M+H]+=359).

[0266] FIG. 66 is a graph showing LC-MS traces from samples of a reaction mixture obtained at various times of the reaction illustrated in FIG. 64, characterizing a time-dependent buildup of the RO-Obi peak (rt=9.0 min; m/z for [M+H]+=377).

[0267] FIG. 17 is a schematic illustration showing a comparison of the P. fluorescens ATCC 39502 genome with the genomes of other Pseudomonads. Analysis of the obafluorin biosynthetic gene cluster with the anti SMASH algorithm (http://antismash.secondarymetabolites.org/) supports the defined genomic region dedicated to obafluorin biosynthesis in P. fluorescens ATCC 39502. Homology is shown by colored genes where white gene arrows indicate no homology. The top row shows the proposed obafluorin gene cluster in white with annotated genes flanked on the left by the Holliday Junction Resolution System and on the right by the Glycine Cleavage System. Analysis of the genomes of other Pseudomonads showed that this site was commonly used for the insertion of a biosynthetic gene cluster obtained from horizontal gene transfer. Other white regions indicated biosynthetic gene clusters for other secondary metabolites, not obafluorin.

[0268] The results of these experiments identified a gene cluster of approximately 20 kb with 14 candidate coding sequences (CDSs) within the genome of the known RC-Obi producer Pseudomonas fluorescens ATCC 39502.

Example 2: Cloning of ObiG, ObiH, ObiL, ObiD, ObiF, ObiF-C1141S, ObiF-C1141A, CS-ObiD and CS-ObiF

[0269] To demonstrate the cloning of various enzymes associated with the biosynthesis of RC-Obi, the following experiments were conducted.

[0270] Gene sequences were amplified from either P. fluorescens ATCC 39502 gDNA or C. shinanonensis DSM 23277 gDNA (isolated using Qiagen DNeasy Blood & tissue kit following provided instructions) using forward and reverse primers designed for each gene (see Tables 6 and 7 below) and a Herculase II Fusion DNA Polymerase kit.

TABLE-US-00006 TABLE6 PCRPrimers SEQ ID NucleotideSequence Primer NO: (5 to3)* ObiD_F 8 GAACTGGGGAAGGCCATATGACCCAG ObiD_RC 9 TCGAAAAGCTTCATGGCTGCTCGCACTC ObiF_F 10 GTTAAACTCATATGTCAGCCTCATTCAC ObiF_RC 11 CCAGTTAAGCTTTGGGTTTATTGG ObiF_C1141S_F 12 GTCTACGGGCACAGCGCCGGTAAC ObiF_C1141A_F 13 GTCTACGGGCACGCAGCCGGTAAC ObiF_Mut_RC 14 GATAATCGGCCCGCTCAACG ObiG_F 15 GGTGTATCAGCTAGCCCAACGATG ObiG_RC 16 GGTAAATGAAAGCTTGGTCATGCCTTG ObiH_F 17 GCAGAGAAACCATATGAGCAATGTC ObiH_RC 18 GGGAAGCTTGACCATCGTTG ObiL_F 19 CATGTAATGCCCATATGCCTGAATC ObiL_RC 20 CGTATATCGAAGCTTAACGCTCAAG CS_obiD_F 21 GCGCTGGCCATATGAACGC CS_obiD_RC 22 GTCCATGCAAGCTTCCGTCAAAG CS_obiF_F 23 GCGCCCCATATGCCCCAC CS_obiF_RC 24 GTCAAAAGCTTTCATTCGGTCAGG Note: Restriction enzyme sites are underlined, and mutant codons are in bold

TABLE-US-00007 TABLE 7 PCR Primer Pairs Construct 5Primer 3Primer Template ObiD ObiD_F ObiD_RC P. fluorescens gDNA ObiF ObiF_F ObiF_RC P. fluorencens gDNA ObiF C1141S ObiF_C1141S_F ObiF_Mut_RC WT-ObiF in pET28 ObiF C1141A ObiF_C1141A_F ObiF_Mut_RC WT-ObiF in pET28 ObiG ObiG_F ObiG_RC P. fluorescens gDNA ObiH ObiH_F ObiH_RC P. fluorescens gDNA ObiL ObiL_F ObiL_RC P. fluorescens gDNA CS_obiD CS_obiD_F CS_obiD_RC C. shinanonensis gDNA CS_obiF CS_obiF_F CS_obiF_RC C. shinanonensis gDNA

[0271] The resulting PCR fragments were purified by gel electrophoresis. PCR products and pET28a vectors were separately digested with either FD-NdeI and FD-HindIII or NheI and FDHindIII. Cut DNA was purified using a QIAquick Gel Extraction Kit without running an agarose gel. Ligation reactions were carried out overnight at 16 C. using T4 DNA Ligase. Ligation mixtures were purified and transformed into electrocompetent E. coli TOP10 cells. Clones were selected for on LB agar containing 50 g/mL kanamycin. Sequencing of selected colonies revealed clones containing the desired constructs. Plasmids were purified and used to transform electrocompetent E. coli BL21 (DE3) cells.

[0272] The organism strains and plasmids described above are summarized in Table 8 below:

TABLE-US-00008 TABLE 8 Strains and Plasmids Used for Enzyme Cloning Origin/ Strain Plasmid Inducible Gene/Marker Reference Pseudomonas None Obafluorin producer ATCC Fluorescens ATCC 39502 Chitiniphilus None Obafluorin biosynthetic DSMZ shinanonensis gene cluster present in SAY3 (DSM 23277) gDNA sequence E. coli TOP10 None Cloning strain Agilent E. coli BL21 (DE3) None Protein expression strain Agilent E. coli BL21 (DE3) pET29 Sfp C. T. Walsh E. coli BL21 (DE3) pET28a ObiD This work E. coli BL21 (DE3) pET28a ObiF This work E. coli BL21 (DE3) pET28a ObiF C1141S This work E. coli BL21 (DE3) pET28a ObiF C1141A This work E. coli BL21 (DE3) pET28a ObiG This work E. coli BL21 (DE3) pET28a ObiH This work E. coli BL21 (DE3) pET28a ObiL This work E. coli BL21 (DE3) pET28a CS_ObiD This work E. coli BL21 (DE3) pET28a CS_ObiF This work

[0273] The experiments described above resulted in the successful cloning of various enzymes associated with the biosynthesis of RC-Obi.

Example 3. Expression and Purification of ObiG, ObiH, ObiL, ObiD, ObiF, ObiF-C1141S, ObiF-C1141A, CS-ObiD and CS-ObiF

[0274] To demonstrate the expression and purification of various enzymes associated with the biosynthesis of RC-Obi, the following experiments were conducted.

[0275] For protein expression, a 5 mL culture of E. coli BL21 harboring the appropriate plasmid (see Table 8 above) was grown overnight in LB containing 50 g/mL kanamycin with agitation at 37 C. A 200 L aliquot of this culture was used to inoculate 500 mL of terrific broth (12 g/L tryptone, 24 g/L yeast extract, 5 g/L glycerol, 17 mM KH.sub.2PO.sub.4, 72 mM K.sub.2HPO.sub.4) containing 50 g/mL kanamycin. The culture was grown at 37 C. with agitation until OD.sub.600 reached approximately 0.4. The culture was cooled in an ice bath for 20 min, then 500 L of a sterile 0.5 M IPTG solution was added. The culture was then incubated with agitation for 18 hrs. (at 15 C. for ObiG/ObiF/CS-ObiF, and at 20 C. for ObiD/CS-ObiD/ObiH/ObiL).

[0276] All subsequent protein purification steps were performed at 4 C. Cells were harvested by centrifugation of the cultures at 5,000 rpm for 20 minutes. Supernatant was discarded, and cell pellets were each suspended in 40 mL cold lysis buffer (50 mM K2HPO4 pH 8.0, 500 mM NaCl, 5 mM -mercaptoethanol, 20 mM imidazole, 10% glycerol). Cell suspensions were transferred to 50 mL falcon tubes and flash frozen in liquid nitrogen. Frozen cells were thawed and gently rocked for 30 minutes before being mechanically lysed using an Avestin EmulsiFlex-C5 cell disruptor. Cell lysate was centrifuged at 45,000 rpm for 35 min and supernatant was incubated with pre-washed Ni-NTA resin for 30 min. Resin was washed twice with 40 mL lysis buffer then eluted five times with 10 mL elution buffer (50 mM K2HPO4 pH 8.0, 500 mM NaCl, 5 mM -mercaptoethanol, 300 mM imidazole, 10% glycerol). Fractions containing the majority of protein, as judged by SDS-PAGE with Coomassie blue visualization (see FIGS. 18A, 18B, 18C, and 18D), were combined in 10,000 MWCO SnakeSkin dialysis tubing from Thermo Scientific and soaked overnight in 1.8 L phosphate buffer (50 mM K.sub.2HPO.sub.4 pH 8.0, 150 mM NaCl, and 1 mM DTT). Dialyzed protein solution was concentrated using an appropriately sized spin filter (EMD Millipore Amicon Ultra 15 mL Centrifugal Filters). Concentrated protein solutions were flash frozen in liquid nitrogen and stored at 80 C.

[0277] FIG. 18A is an image showing purified proteins associated with the biosynthesis of RC-Obi, shown separated on SDS-PAGE gels (any kD, Bio-Rad) and stained with Coomassie blue. Proteins include (from left to right lane): 1) empty; 2) ladder; 3) ObiD (10.0 kDa); 4) ObiF (209.3 kDa); 5) ObiG (62.1 kDa); 6) ObiH (48.6 kDa); 7) ObiL (36.0 kDa); 8) ladder; 9) empty; and 10) empty. All proteins have an N-terminal His-tag.

[0278] FIG. 18B is an image showing purified proteins associated with the biosynthesis of RC-Obi, shown separated on SDS-PAGE gels (any kD, Bio-Rad) and stained with Coomassie blue. Proteins include (from left to right lane): 1) ladder; 2) ObiF-WT; 3) ObiF-C1141S; 4) ObiF-C1141A. All proteins have an N-terminal His-tag.

[0279] FIG. 18C is an image showing purified proteins associated with the biosynthesis of RC-Obi, shown separated on SDS-PAGE gels (any kD, Bio-Rad) and stained with Coomassie blue. Proteins include (from left to right lane): 1) ladder, 2) 830 ng CS_ObiD, 3) 1.6 g CS_ObiD, 4) 3.2 g CS_ObiD 5) 6.5 g CS_ObiD. All proteins have an N-terminal His-tag.

[0280] FIG. 18D is an image showing purified proteins from a Ni-NTA purification column of CS_ObiF, shown separated on SDS-PAGE gels (any kD, Bio-Rad) and stained with Coomassie blue. Proteins include (from left to right lane): 1) Flowthrough, 2) Wash 1, 3) Wash 2, 4) Elution 1, 5) Elution 2, 6) Elution 3, 7) Elution 4, 8) Elution 5, 9) ladder. All proteins have an N-terminal His-tag.

[0281] The experiments described above resulted in the successful expression and purification of various proteins serving as enzymes in the biosynthesis of RC-Obi.

Example 4. Mutagenesis of WT-ObiF to ObiF-C1141S and ObiF-C1141A

[0282] To produce mutated analogs of wild-type ObiF, the following experiments were conducted.

[0283] Mutagenesis primers (see Table 6 and Table 7 above) were phosphorylated using T4 Polynucleotide Kinase according to product instructions. Primers were taken directly from phosphorylation mixture for use in PCR amplification. PCR was carried out using a Herculase II Fusion DNA Polymerase kit. After amplification, 1 L FastDigest DpnI was added to PCR reaction mixture to digest template plasmid with wild type gene. Reaction was incubated at 37 C. for 60 min, then plasmids were purified using gel electrophoresis methods similar to those described in Example 3 above. Purified plasmids were ligated overnight at 16 C. using T4 DNA ligase, then transformed into electrocompetent E. coli TOP10 cells. Plasmids were sequenced using methods similar to those described in Example 1 to confirm the desired mutations.

[0284] The experiments described above resulted in the production of plasmids used to produce two mutated analogs of wild-type ObiF, ObiF-C1141S and ObiF-C1141A.

Example 5: Effect of Pyruvic Acid Substrates on ObiG Activity

[0285] To determine the sensitivity of ObiG activity with respect to different pyruvic acid substrates, the following experiments were conducted.

[0286] FIG. 10A is a schematic illustration showing the enzymatic biosynthesis of various phenylacetaldehydes via an enzyme (ObiG) reaction and the subsequent treatment of the phenylacetaldehydes with Purpald to enable a colorimetric assay used to assess the products of the enzymatic reaction.

[0287] Purpald indicator was used to estimate the activity of ObiG enzyme for four different pyruvic acid substrates according to the reaction scheme illustrated in FIG. 10A. A pre-incubation solution was made with 10 M ThDP, 10 M MgCl.sub.2, 25 mM MES buffer pH 7.5, and 10 M ObiG from a freshly thawed frozen stock. The enzyme pre-incubation solution incubated at room temperature for 5 min. In a separate 1.5 mL Eppendorf tube, the pyruvic acid substrate (PAPPA, PNPPA, PHPPA, or PPA) was diluted to 1 mM in 25 mM MES pH 7.5 buffer. The substrate mix was transferred in one aliquot into the pre-incubation solution. The final concentrations of reagents were 10 M ObiG, 5 M ThDP, 5 M MgCl.sub.2, 1 mM pyruvic acid substrate, and 25 mM Mes buffer pH 7.5. Aliquots of the enzyme solution were added to an equal volume of a 20 mg/mL solution of Purpald in 1 M aqueous NaOH at various time points. The resulting solution was mixed and then left open to air to develop the purple color. All reactions and time points were single trials.

[0288] FIG. 10B is a photograph of reaction tubes containing reaction products resulting from the ObiG reaction illustrated in FIG. 10A that were treated with Purpald. Each column of reaction tubes within the image corresponds to the substitution at the para-position of the phenylpyruvic acid (see FIG. 10A) and each row within the image corresponds to the reaction time at which each reaction aliquot was quenched with the Purpald solution. The dark orange color for the PNPPA (R=NO.sub.2) substrate is due in part to the starting material, which forms an orange anion at basic pH (the pH of the Purpald solution is 15). The legend on the bottom of the image shows the substitution at the para-position of the phenylpyruvic acid and the time points on the right of the image show when reaction aliquots were quenched with the Purpald solution. The dark orange color for the PNPPA (R=NO.sub.2) substrate is due in part to the starting material, which forms an orange anion at basic pH (the pH of the Purpald solution is 14).

[0289] The results of this experiment demonstrated varying levels of ObiG activity depending on the substitution at the para-position of the phenylpyruvic acid.

Example 6: Detection of ObiH Quinonoid by Optical Absorption Spectroscopy

[0290] To characterize the formation of a stable quinonoid by ObiH, the following experiments were conducted.

[0291] FIG. 13A is an illustration showing a reaction scheme for the formation of an ObiH quinonoid starting with an internal Lys-aldimine which undergoes imine exchange with L-Thr to form an external aldimine. Referring again to FIG. 13A, a retro-aldol reaction may form acetaldehyde which may leave the active site and the stable quinonoid (495 nm) poised to react with p-NO.sub.2-phenylacetaldehyde in the forward aldol reaction to produce -OH-p-NO.sub.2-homoPhe.

[0292] In a 1.5 mL Eppendorf tube, a master mix of 50 M ObiH from a freshly thawed frozen stock, 50 M PLP, and 25 mM MES buffer was prepared and analyzed by optical absorption spectroscopy scanning from 200-600 nm. Three solutions at a final volume of 500 L were analyzed as single trials: 1) L-Thr was added to the master mix a 1 mM final concentration; 2) PAA was added to the master mix at 1 mM final concentration; and 3) L-Thr and PAA were added to the master mix at 1 mM final concentration each. All samples were then analyzed by optical absorption spectroscopy scanning from 200-600 nm in order to observe the quinonoid peak which absorbs at 495 nm.

[0293] FIG. 13B is a graph showing the absorption spectra obtained from all samples. The ObiH quinonoid was observable by optical absorption spectroscopy with a characteristic absorbance at 495 nm when the ObiH was treated with PLP and L-Thr (blue trace). ObiH treated with PLP alone (black trace), ObiH treated with PLP and phenylacetylaldehyde (PAA) (green trace), and ObiH treated with PLP, PAA, and L-Thr (red trace) exhibited no absorbance peak at 495 nm, indicating that no quinonoid was formed.

[0294] FIGS. 19A, 19B, 19C, 19D, 19E, 19F, 19G, 19H, and 19I illustrate the stability of the ObiH quinonoid throughout an enzyme purification process. The enduring presence of the quinonoid, indicated by a magenta color, is clearly visible throughout the purification process.

[0295] The results of these experiments demonstrated that when ObiH was contacted with PLP and L-Thr, a quinonoid was formed.

Example 7: Effect of Pyruvic Acid Substrates on Combined ObiG/ObiH Double Enzyme Reactions

[0296] To characterize the bioconversion of PNPPA to -OH-p-NO.sub.2-homoPhe by the enzymes ObiG and ObiH, the following experiments were conducted.

[0297] Three solutions were prepared using individual Eppendorf tubes. First, an ObiG solution containing 10 M ThDP, 10 M MgCl.sub.2, and 10 M ObiG was adjusted to 333 L final volume using 25 mM MES buffer pH 7.5 and allowed to pre-incubate for 5 min. Second, a pyruvic acid solution containing 1 mM final concentration of PNPPA, PAPPA, PHPPA, and PPA, was adjusted to 333 L with 25 mM MES buffer pH 7.5. Third, an ObiH solution containing 10 M PLP, 1 mM amino acid (L-Thr), and 10 M ObiH was adjusted to 333 L final volume. After the pre-incubation time was complete, the three solutions were combined in a single Eppendorf tube and allowed rest for 3 hrs. at room temperature before quenching with MeCN to crash the enzyme. The mixtures were centrifuged and the supernatants were analyzed by LC-MS using a gradient of 0% B held for 5 minutes then 0% B to 95% B over 10 min using single ion monitoring for the expected ions in positive ion mode (retention times and observed product ions (see FIG. 2A): -OH-homoPhe, 1.7 min, [M+H].sup.+ m/z=196; -OH-p-OH-homoPhe, 0.8 min, [M+H].sup.+ m/z=212; -OH-p-NO.sub.2-homoPhe, 2.9 min, [M+H].sup.+ m/z=241; -OH-p-NH.sub.2-homoPhe, not observed. Product masses were confirmed by high-resolution LC-MS analysis.

[0298] FIG. 2A is a graph summarizing the extracted ion chromatograms (EICs) vs retention time for the predicted products of a double enzyme reaction with ObiG and ObiH. EICs were generated by LC-MS using single ion monitoring (SIM) for the predicted [M+H].sup.+ ion m/z values: 211, 212, 196, and 241 for PAPPA (R=NH.sub.2), PHPPA (R=OH), PPA (R=H), and PNPPA (R=NO.sub.2), respectively. Control experiments demonstrated that both ObiG and ObiH are needed to convert p-NO.sub.2-phenylpyruvate (PNPPA) and L-Thr to -OH-p-NO.sub.2-homoPhe. d

[0299] FIG. 2H is an extracted ion chromatogram (EIC) showing EIC product concentrations resulting from the double enzyme reaction with ObiG and ObiH. PNPPA was a substrate and PAPPA was not a substrate in the double enzyme reaction. EICs were generated by LC-MS using single ion monitoring (SIM) for the predicted product [M+H].sup.+ ion m/z values: m/z=211 for PAPPA and m/z=241 for PNPPA. Control experiments demonstrate the strict requirement for both enzymes, decarboxylase ObiG and aldolase ObiH, to convert p-NO.sub.2-phenylpyruvate and L-Thr to -OH-p-NO.sub.2-homoPhe.

[0300] For NMR analysis the same samples were prepared using fully deuterated MES buffer. After equilibration for 3 hrs., the reactions were quenched with TFA to a pH2. The samples were then flash frozen in liquid nitrogen, lyophilized to dryness, resuspended in 750 L of D.sub.2O, and centrifuged to pellet any insoluble particulate. The soluble supernatants were then transferred to NMR tubes and analyzed. All reactions were performed in triplicate.

[0301] FIG. 2I is a bar graph showing the relative amount of L-Thr consumed during the ObiG/ObiH double enzyme reactions with L-Thr and either PAPPA or PNPPA. The double enzyme reactions were conducted in fully deuterated MES buffer and analyzed by .sup.1H-NMR after 3 hrs. of equilibration. The product -OH-homoPhe gives a diagnostic ddd-splitting pattern for H.sub.a with a chemical shift of 4.4 ppm in the .sup.1H-NMR spectrum (see inset graph of FIG. 2I), which is detectable only when PNPPA is the substrate of the reaction. The methyl group of L-Thr gives a characteristic doublet at 1.2 ppm in the .sup.1H-NMR spectrum. The intensity of this signal decreased noticeably when PNPPA was the substrate. Error bars represent standard deviations for three independent trials.

[0302] FIG. 11B contains extracted ion chromatograms (EIC) generated for the predicted product [M+H].sup.+ ion (m/z=241) of the four -OH-p-NO.sub.2-homoPhe produced by the ObiG/ObiH double enzyme reaction illustrated in FIG. 11A with four pyruvic acid substrates: PNPPA, PPA, PHPPA, and PAPPA. PNPPA was the preferred ObiG and ObiH substrate on the path to obafluorin. The ObiG/ObiH double enzyme reactions with L-Thr and a panel of phenyl pyruvic acids (PNPPA, PPA, PHPPA, and PAPPA) were analyzed by 1H-NMR after 3 hrs. of equilibration. The product -OH-homoPhe gave a diagnostic multiplet with a chemical shift of 4.4 ppm in the 1H-NMR spectrum (proton highlighted in red in FIG. 11A), which is observed only for PNPPA and PPA. The methyl group of L-Thr gave a characteristic doublet at 1.2 ppm in the 1H-NMR spectrum. The intensity of this signal decreased noticeably when PNPPA and PPA were the substrates.

Example 8: Effect of Amino Acid Substrates on Combined ObiG/ObiH Double Enzyme Reactions

[0303] To characterize the bioconversion of PNPPA to -OH-p-NO.sub.2-homoPhe by the enzymes ObiG and ObiH, the following experiments were conducted.

[0304] Three solutions were prepared using individual Eppendorf tubes. First, an ObiG solution containing 10 M TPP, 10 M MgCl.sub.2, and 10 M ObiG was adjusted to 333 L final volume using 25 mM MES buffer pH 7.5 and allowed to pre-incubate for 5 min. Second, a pyruvic acid solution containing 1 mM final concentration of PNPPA, was adjusted to 333 L with 25 mM MES buffer pH 7.5. Third, an ObiH solution containing 10 M PLP, 1 mM amino acid (L-Thr, D-Thr, L-Ser, D-Ser, Gly, L-alloThr, or D-alloThr), and 10 M ObiH was adjusted to 333 L final volume. After the pre-incubation time was complete, the three solutions were combined in a single Eppendorf tube and allowed rest for 3 hrs. at room temperature before quenching with MeCN to crash the enzyme. The mixtures were centrifuged and the supernatants were analyzed by LC-MS using a gradient of 0% B held for 5 minutes then 0% B to 95% B over 10 min using single ion monitoring for the expected ions in positive ion mode. Product masses were confirmed by high-resolution LC-MS analysis.

[0305] After 3 hrs. of reaction time, the EICs were obtained for the product [M+H].sup.+ ion (m/z=241) of the -OH-p-NO.sub.2-homoPhe as predicted by the reaction diagram illustrated in FIG. 12. FIG. 2J is an extracted ion chromatogram (EIC) showing the -OH-p-NO.sub.2-homoPhe product concentrations resulting from the double enzyme reaction with ObiG and ObiH using PNPPA and a panel of amino acid substrates. The reaction including L-Thr resulted in the highest -OH-p-NO.sub.2-homoPhe product concentration.

[0306] A double enzyme reaction with ObiG and ObiH in the presence of TPP, PLP, and L-Thr revealed that PNPPA is directly converted to -OH-p-NO.sub.2-homoPhe as detected by LC-MS (FIG. 2H) and .sup.1H-NMR analysis of the reaction mixture (FIG. 2I). p-Amino-phenylpyruvic acid (PAPPA) was not accepted as a substrate by ObiG/ObiH suggesting that ObiL must oxidize PAPPA prior to ObiG,H catalysis (FIG. 2H and FIG. 2I). These results firmly establish that PAPPA is the true substrate for oxygenase ObiL and decarboxylase ObiG acts on PNPPA to provide PNPAA aldehyde substrate for aldolase ObiH (FIG. 10B).

Example 9: NMR Analysis of -OH-p-NO.SUB.2.-homoPhe from the ObiG/ObiH Reaction

[0307] To characterize the structure of the -OH-p-NO.sub.2-homoPhe product resulting from the ObiG/ObiH double enzyme reaction described above (see FIG. 2A), the following experiments were conducted.

[0308] The ObiG/ObiH double enzyme reaction described above was scaled up with respect to the substrates to produce enough material for NMR analysis. The concentrations of reaction components were 10 M ObiG, 10 M ThDP, 10 M MgCl.sub.2, 10 M ObiH, 10 M PLP, 5 mM L-Thr, 5 mM PNPPA, and 25 mM pH 7.5 MES buffer, with a final reaction volume of 1 mL. After 3 hrs., the reaction was quenched with TFA to a pH2, centrifuged at 13,000 rpm for 2 min, flash frozen in liquid nitrogen, and lyophilized to dryness. The resulting solid was dissolved in 1:10 MeCN:H2O, filtered, and purified by preparatory HPLC using a solvent gradient of 0% B held for 5 min then 0% B to 100% B over 10 min (-OH-p-NO.sub.2-homoPhe retention time=14.3 min). The desired TFA salt of -OH-p-NO.sub.2-homoPhe product was isolated as a white powder.

[0309] Table 9 is a summary of the NMR data obtained from a sample of the -OH-p-NO.sub.2-homoPhe product described above. NMR spectra obtained from the -OH-p-NO.sub.2-homoPhe product are provided as FIG. 32 (.sup.1H NMR spectrum), FIG. 33 (.sup.13C NMR spectrum), FIG. 34 (.sup.1H-.sup.13C HSQC spectrum), FIG. 35 (.sup.1H-.sup.13C COSY), FIG. 36 (.sup.1H-.sup.13C HMBC), and FIG. 37 (1H-.sup.13C NOESY spectrum). A summary of the NMR data obtained for this experiment are summarized in Table 9 below.

TABLE-US-00009 TABLE 9 NMR characterization data of -hydroxy-p-NO.sub.2-homoPhe TFA salt in D.sub.2O. NOESY gCOSY HMBC .sup.1H-.sup.1H .sup.13C (ppm) .sup.1H (ppm), .sup.1H-.sup.1H .sup.1H-.sup.13C through Atom unreferenced multiplets in Hz 3 bond 2-3 bond space, 4 1 160.56 2, 3 2 47.54 3.98 (d, J = 4.8 Hz, 1H 3 1, 3, 4 3, 4a, 4b 3 59.15 4.49-4.43 (m, 1H) 2, 4a, 4b 1, 4, 5 2, 4a, 4b, 6 4 28.86 a) 3.20 (dd, J.sub.4b = 14.0 Hz, 3, 4a, 4b 2, 3, 5, 6 2, 3, 6 J.sub.3 = 3.6 Hz, 1H) b) 2.99 (dd, J.sub.4b = 14.0 Hz, J.sub.3 = 10.2 Hz, 1H) 5 134.95 3, 4, 7 6 119.73 7.55 (d, J = 9.0 Hz, 2H) 7 4, 8 3, 4a, 4b, 7 7 113.17 8.24 (d, J = 8.4 Hz, 2H) 6 5, 6 6 8 136.03 6

[0310] The results of these experiments characterized the structure of the -OH-p-NO.sub.2-homoPhe product resulting from the ObiG/ObiH double enzyme reaction described above.

Example 10: Combined ObiG, ObiH, and ObiL Triple Enzyme Reaction

[0311] FIGS. 2F and 9A illustrate a conversion of PAPPA to -OH-p-NO.sub.2-homoPhe through the ObiG, ObiH, and ObiL Triple Enzyme Reaction. To characterize the role of ObiL enzyme in the enzymatic conversion of PAPPA to -OH-p-NO.sub.2-homoPhe using the reaction illustrated schematically in FIG. 2F, the following experiments were conducted.

[0312] A solution of 100 M ObiL from a freshly thawed frozen stock, 3 mM phenazine methosulfate, 1 mM PAPPA, 100 M iron(II) sulfate, and 25 mM NADH was prepared in 25 mM MES buffer at pH 5.5 at a final volume of 500 L. NADH was added last to initiate the reaction and the mixture was incubated at room temperature for 1 hr. Upon addition of NADH, the color of the reaction changed from light yellow to sky blue to indicate the conversion of PAPPA to PNPPA by the reaction.

[0313] In a separate Eppendorf tube a 500 L solution was prepared containing 10 M ObiG, 10 M ThDP, 10 M MgCl.sub.2, 10 M ObiH, 10 M PLP, 1 mM L-Thr, and 25 mM MES buffer at pH 7. The ObiG/ObiH solution was added directly to the ObiL solution formed above and the mixture was allowed to react for 2 hrs. at room temperature. The reaction mixture was quenched with MeCN to crash the enzyme. The pH of the ObiL solution changed from 5.5 to 7.0 over the course of the reaction. The control assay (i.e. no ObiL) reached an end pH of 6.0 and was adjusted to a pH of 7 using 1 M NaOH prior to addition of the ObiG/ObiH solution.

[0314] FIG. 9B is a photograph of two rows of reaction tubes containing the products of the triple enzyme ObiL/ObiG/ObiH reaction with PAPPA at the 1 hr. time point. The tubes in the bottom row (sky blue) contain the products of the full colorimetric assay and the tubes in the bottom row (clear) are no-ObiL enzyme controls. The full assay mixture turned a sky blue color indicative of redox chemistry occurring.

[0315] The resulting mixtures were centrifuged and the supernatants were analyzed by LC-MS using a gradient of 0% B held for 5 min then 0% B to 95% B over 10 min. Ion counts for expected products were extracted from total ion chromatograms in positive ion mode. FIG. 2B is an extracted ion chromatogram (EIC) showing the -OH-p-NO.sub.2-homoPhe product concentration ([M+H].sup.+=241) resulting from the triple enzyme reaction with ObiG, ObiH, and ObiL. The EICs show formation of -OH-p-NO.sub.2-homoPh [M+H].sup.+ ion (m/z=241) starting from a PAPPA reactant when all three enzymes (ObiL/ObiG/ObiH) and necessary cofactors and cosubstrates are present, thereby revealing the timing of aniline oxidation by ObiL. FIG. 2G is an extracted ion chromatogram (EIC) showing the -OH-p-NO.sub.2-homoPhe product concentration ([M+H].sup.+=241), indicating a similar dependence of the reaction on the inclusion of ObiL to enable the reaction.

Example 11: Combined ObiF and ObiD Double Enzyme Reaction

[0316] To characterize the formation of -lactone analogs of RC-Obi using the obafluorin NRPS ObiF/ObiD reaction scheme (see FIG. 2C), the following experiments were conducted.

[0317] Phosphopantetheinylation of apo-ObiD and apo-ObiF (wild type, C1141S/C1141A mutants, and C. shinanonensis homologues) was carried out in separate 500 L solutions containing 180 M CoASH, 5 mM DTT, 10 mM MgCl.sub.2, 400 nM Sfp, 25 M apo-enzyme, and 75 mM tris-HCl at pH 7.552. The C1141S/C1141A mutant enzymes were produced using the methods described in Example 4 above. Reactions were left at room temperature for 2 hrs., and then used directly as the source of holo-ObiD and holo-ObiF. Reactions were performed in duplicate at 500 L total volume. Full reactions contained 5 mM ATP, 5 mM DTT, 1 mM 2,3-DHB, 1 mM -OH-p-NO.sub.2-homoPhe, 1 M holo-ObiF (ObiF, CS-ObiF, ObiF-C1141A, or ObiF-C1141S), 1 M holo-ObiD, and 75 mM tris-HCl at pH 7.5. Control reactions were also prepared by replacing various components with an equivalent volume of 75 mM tris-HCl buffer. Three control experiments were performed for the ObiF (see Table 10), ObiF-C1141S (see Table 11), ObiF-C1141A (see Table 12), CS-ObiF reactions: () ObiD; () 2,3-DHB/() -OH-p-NO.sub.2-homoPhe; and () ATP (see Table 13). Two additional controls were prepared as either () ObiF or () ObiF/() ObiD. Reactions were performed at room temperature.

TABLE-US-00010 TABLE 10 Control reactions for ObiF..sup.a Reagents -hydroxy-p- Products.sup.b Trial 2,3-DHB NO.sub.2-homoPhe ATP ObiF ObiD RC-Obi RO-Obi Full Assay + + + + + ++ + No substrates + + + No enzymes + + + No ObiF + + + + No ObiD + + + + No ATP + + + + .sup.aReactions were conducted as described in the Online Methods. .sup.bPresence (+) or absence () of products was judged by LC-MS analysis.

TABLE-US-00011 TABLE 11 Control reactions for ObiF-C1141S mutant..sup.a Reagents -hydroxy-p- Products.sup.b Trial 2,3-DHB NO.sub.2-homoPhe ATP ObiF ObiD RC-Obi RO-Obi Full Assay + + + + + ++ + No substrates + + + No enzymes + + + No CS ObiF + + + + No CS ObiD + + + + No ATP + + + + .sup.aReactions were conducted as described in the Online Methods. .sup.bPresence (+) or absence ( ) of products was judged by LC-MS analysis.

TABLE-US-00012 TABLE 12 Control reactions for ObiF-C1141A mutant..sup.a Reagents -hydroxy-p- ObiF- Products.sup.b Trial 2,3-DHB NO.sub.2-homoPhe ATP C1141S ObiD RC-Obi RO-Obi Full Assay + + + + + +++ No substrates + + + No enzymes + + + No ObiF + + + + No ObiD + + + + No ATP + + + + .sup.aReactions were conducted as described in the Online Methods. .sup.bPresence (+) or absence ( ) of products was judged by LC-MS analysis.

TABLE-US-00013 TABLE 13 Control reactions for CS ObiF and CS ObiD..sup.a Reagents -hydroxy-p- ObiF- Products.sup.b Trial 2,3-DHB NO.sub.2-homoPhe ATP C1141A ObiD RC-Obi RO-Obi Full Assay + + + + + + No substrates + + + No enzymes + + + No ObiF + + + + No ObiD + + + + No ATP + + + + .sup.aReactions were conducted as described in the Online Methods. .sup.bPresence (+) or absence ( ) of products was judged by LC-MS analysis.

[0318] At 10, 30, and 60 min time points a 50 L aliquot from each reaction was quenched with 50 L acidic MeCN (acidified with HCl) to give a final pH of approximately 3.5. Mixtures were centrifuged for 2 min at 13,000 rpm to remove precipitated enzyme and the supernatants were analyzed by LC-MS using a gradient of 5% solvent B to 95% solvent B over 20 min. Ion counts for the closed-ring obafluorin RC-Obi and open-ring obafluorin RO-Obi were extracted from total ion chromatograms in positive ion mode. Reaction mixtures were also analyzed by HPLC using a gradient of 5% B to 95% B over 20 min, 95% B to 100% B over 3 min, and 100% B to 5% B over 2 min at a flow rate of 1 mL/min with optical absorbance detection at 270 nm. Product ions and retention times were confirmed using purified standards of RC-Obi and RO-Obi isolated from P. fluorescens ATCC 39502 fermentations.

[0319] FIG. 2D is a summary of the EIC spectra showing the amount of RC-Obi ([M+H].sup.+ m/z=359) obtained for reactions that included wild-type ObiF (ObiF WT) as well as the C1141S/C1141A ObiF mutants. The retention time for the RC-Obi product was about 9.5 min. Referring again to FIG. 2D, only the wild-type ObiF enzyme enabled the production of the closed-ring obafluorin RC-Obi product. The low concentration of RC-Obi product resulting from the two-enzyme enzymatic conversion of -OH-p-NO.sub.2-homoPhe and 2,3-DHB using the holo-ObiF mutants C1141S and C1141A demonstrated that the active site cysteine residue in the TE domain of ObiF may influence the formation of the -lactone ring.

[0320] FIG. 2E is a summary of the EIC spectra showing the amount of open-ring obafluorin RO-Obi ([M+H].sup.+ m/z=377) obtained for reactions that included wild-type ObiF (ObiF WT) as well as the C1141S/C1141A ObiF mutants. The retention time for the RO-Obi product was about 9 min. Referring again to FIG. 2E, the C1141S mutation of ObiF resulted in exclusive production of RO-Obi carboxylate while the wild-type ObiF and the C1141A mutation of ObiF resulted in slow accumulation of RO-Obi.

[0321] The reaction mixture of the ObiF/ObiD-catalyzed conversion of 2,3-DHB and -OH-p-NO2-homoPhe as monitored by HPLC with detection by optical absorbance is shown in FIGS. 51, 52, and 53 for reaction mixtures containing holo-ObiF, holo-ObiF mutant C1141S, and holo-ObiF mutant C1141A, respectively. The ObiF,D reaction was carried out in an identical manner for each variation of the ObiF enzyme. All HPLC chromatograms are shown for absorbance at 270 nm with retention times and peak heights normalized to an Fmoc-Ala internal standard.

[0322] FIGS. 51, 52, and 53 are graphs showing a series of HPLC elution profiles as monitored by absorbance at 270 nm with retention times and peak heights normalized to an Fmoc-Ala internal standard summarizing the concentrations of various reactants and reaction products for the holo-ObiF-catalyzed conversion of 2,3-DHB and -OH-p-NO.sub.2-homoPhe to RC-Obi (FIG. 51), the holo-ObiF mutant C1141S-catalyzed conversion of 2,3-DHB and -OH-p-NO.sub.2-homoPhe to RC-Obi (FIG. 52), and the holo-ObiF mutant C1141A-catalyzed conversion of 2,3-DHB and -OH-p-NO.sub.2-homoPhe to RC-Obi (FIG. 53); the inset graph shows the UV-vis spectrum of the RC-Obi peak.

[0323] As illustrated in FIG. 51, holo-ObiF converts -OH-p-NO.sub.2-homoPhe and 2,3-DHB to RC-Obi over time. The UV-vis spectrum (250-380 nm) of the Obi peak, shown illustrated in the inset graph of FIG. 51, is characterized by an absorbance signal detected at spectral wavelengths of up to 350 nm due to the extended conjugation of the aryl-nitro group.

[0324] As illustrated in FIG. 52, the holo-ObiF mutant C1141S enzyme exclusively produces RO-Obi (open-ring obafluorin) from -OH-p-NO2-homoPhe and 2,3-DHB. The spectral peak shown at 19 min in FIG. 52 is associated with an unknown impurity from the reaction. The UV-vis spectrum (250-380 nm) of the unknown peak, shown in the inset graph of FIG. 52, is not associated with RC-Obi, due to the absence of an absorbance signal beyond about 300 nm and as concluded from subsequent LC-MS analysis (data not shown).

[0325] As illustrated in FIG. 53, the holo-ObiF mutant C1141A enzyme had no detectable product formation within the reaction mixture, although the unknown peak at 19 min was again observed.

[0326] FIG. 54 is a graph showing HPLC chromatograms of pure analytical standards for compounds associated with the ObiF,D reaction. FIG. 54 shows a series of HPLC elution profiles as monitored by absorbance at 270 nm with retention times and peak heights normalized to an Fmoc-Ala internal standard summarizing the concentrations of pure analytical standards corresponding to various reactants and intermediate products associated with the relevant to catalyzed conversion of 2,3-DHB and -OH-p-NO.sub.2-homoPhe to RC-Obi.

[0327] To assess the effect of different substrates on the ObiF/ObiD-catalyzed formation of RC-Obi, the reaction and analysis described above was repeated for the ObiF/ObiD reactions with -OH-p-NO.sub.2-homoPhe and 2,3-DHB, with -OH-homoPhe substituted for -OH-p-NO.sub.2-homoPhe, as illustrated schematically in FIG. 15A.

[0328] FIG. 15B and FIG. 15C include graphs showing the EIC spectra of the holo-ObiF/holo-ObiD reaction of -OH-homoPhe (from the ObiG/ObiH reaction with PPA) showing production of the -NO.sub.2Obi -lactone analog, [M+H].sup.+ (m/z=314), and the corresponding hydrolysis product, [M+H].sup.+ (m/z=332).

[0329] FIG. 15B is an EIC spectrum showing the amount of -NO.sub.2Obi -lactone analog ([M+H].sup.+ m/z=314) produced by the reaction illustrated in FIG. 15A. LC-MS analysis of the holo-ObiF/holo-ObiD reaction of -OH-homoPhe (from the ObiG/ObiH reaction with PPA) shows production of the -NO.sub.2Obi -lactone analog, ([M+H].sup.+ m/z=314). FIG. 15C is an EIC spectrum showing the amount of hydrolyzed ring-opened obafluorin analog product ([M+H].sup.+ m/z=332) produced by the reaction illustrated in FIG. 15A, showing production of the hydrolyzed -NO.sub.2Obi -lactone analog.

[0330] The results of these experiments demonstrated the production of Obi and Obi analogs using enzymatic synthesis with ObiD and ObiF.

Example 11: Activity of ObiF Measured Using [.SUP.32.P]PPi Exchange Assay

[0331] To characterize the activity of the ObiF enzyme exposed to various amino acid and carboxylate substrates, the following experiments were conducted.

[0332] Reaction mixtures (650 L) were formed that contained 2 M ObiF, 5 mM of an amino acid, 1 mM ATP, 1 mM MgCl.sub.2, 40 mM KCl, 1 mM DTT, 5 mM Na[.sup.32P]PPi (3.310.sup.5 cpm/mL), and 50 mM Tris-HCl (pH 8). The reaction mixtures were incubated at room temperature for 30 min, then three 200 L aliquots of each reaction mixture were removed and quenched with 500 L of a charcoal suspension (100 mM NaPPi, 350 mM HClO.sub.4, and 16 g/L powdered charcoal). The reaction mixture samples were shaken and then centrifuged at 13,000 rpm for three minutes. The resulting charcoal pellets were washed with 750 L of wash solution (100 mM NaPPi, 350 mM HClO.sub.4) and centrifuged again for three min. This washing step was repeated once more, followed by suspension of the charcoal pellets in 1.5 mL EcoLite(+) scintillation fluid from MP Biomedicals. Charcoal-bound radioactivity was measured on a Beckman Coulter LS 6500 scintillation counter.

[0333] FIG. 2K is a bar graph summarizing ATP-[.sup.32P]PP.sub.i exchange data for the incubation of recombinant ObiF (directly purified from E. coli cell lysates without treatment with Sfp) with [.sup.32P]PP.sub.i, unlabeled ATP, and carboxylate substrate followed by absorption onto activated charcoal. The bar graph shows counts per minute (cpm) for each of the carboxylate substrates. -OH-p-NO.sub.2-homoPhe and 2,3-DHB substrates produced signals greater than any of the control experiments. All proteinogenic amino acids shown in this graph were L-versions of the respective amino acids. Error bars represent standard deviations for three independent trials.

[0334] The results of these experiments demonstrated that the recombinant ObiF was most active upon contact with one of the carboxylate substrates -OH-p-NO.sub.2-homoPhe and 2,3-DHB.

Example 12: Isolation of RC-Obi and RO-Obi

[0335] To isolate the closed-ring isoform of obafluorin (RC-Obi) and the ring-opened obafluorin hydrolysis product (RO-Obi), the following experiments were conducted.

[0336] RC-Obi and RO-Obi were isolated from Pseudomonas fluorescens ATCC 39502 fermentations. Bennet's Agar slants (1 g/L yeast extract, 1 g/L beef extract, 2 g/L NZ amine, 10 g/L glucose, 15 g/L agar) were inoculated with streaks of P. fluorescens ATCC 39502 from a frozen glycerol stock. The slants were incubated at 25 C. for 48 hrs. 5 mL of sterile saline was added to the top of the slant and shaken gently. Inoculated saline (1 mL) was transferred to 100 mL of sterile media (5 g/L yeast extract, 5 g/L glucose, 0.1 g/L MgSO.sub.47H.sub.2O, 0.1 g/L FeSO.sub.4.7H.sub.2O, 200 mL local soil filtrate extract, and 800 mL tap water, autoclaved) to form a starter culture.

[0337] The starter culture was incubated with shaking at 225 rpm at 25 C. for 24 hrs. 5 mL samples of the starter culture were transferred to 3 L baffled flasks containing 500 mL of the same media, and the resulting cultures were incubated with shaking at 225 rpm at 25 C. for 17 hrs. The cultures were pooled and centrifuged at 5000 rpm at 4 C. for 25 min to pellet the cultured cells. The supernatant of the pooled cultures was acidified to pH 3 with 1M aqueous HCl. The pooled supernatant was saturated with EtOAc then extracted with three 100 mL volumes of EtOAc. Extractions were pooled and dried using rotary evaporation to yield a grey-brown solid. The solid was dissolved in 10 mL acetonitrile, filtered, and concentrated by rotary evaporation under reduced pressure to yield 221 mg of clear, brown oil.

[0338] The oil was dissolved in 10 mL of acetonitrile, filtered, and purified with Prep HPLC with a gradient of 5% solvent B to 95% solvent B over 20 min. The two largest peaks were isolated which upon NMR analysis proved to be RC-Obi (retention time=23.0 min) and RO-Obi (retention time=20.5 min), both isolated as brown oils.

[0339] Table 14 is a summary of the NMR data obtained from the RC-Obi fraction of the oil. NMR spectra obtained from the RC-Obi fraction of the oil are provided as FIG. 20 (.sup.1H NMR spectrum), FIG. 21 (.sup.13C NMR spectrum), FIG. 22 (.sup.1H-.sup.13C HSQC spectrum), FIG. 23 (.sup.1H-.sup.13C COSY), FIG. 24 (.sup.1H-.sup.13C HMBC), and FIG. 25 (.sup.1H-.sup.13C NOESY spectrum).

TABLE-US-00014 TABLE 14 Summary of NMR Data for Closed-Ring Obafluorin (RC-Obi) gCOSY HMBC NOESY .sup.1H-.sup.1H .sup.13C .sup.1H (ppm), .sup.1H-.sup.1H .sup.1H-.sup.13C Through Atom (ppm) multiplets in Hz 3 bond 2-3 bond space, 4 1 116.41 5 2 150.47 4, 6 3 147.81 4, 5 4 120.77 6.99 (d, J = 6.6 Hz, 1H) 5 2, 3 5 5 120.37 6.78 (t, J = 1.0 Hz, 1H) 4, 6 1, 3 4, 6 6 119.50 7.28 (d, J = 9.6 Hz, 1H) 5 7, 2, 4 5 7 171.77 9, 6 8 9 60.53 5.83 (d, J = 6.0 Hz, 1H) 11 7, 10, 11, 11 12 10 170.19 9, 11 11 79.17 5.08 (td, J = 5.7, 9.0 Hz, 1H) 9, 12 10, 13 9, 12a, 12b 12 36.81 3.40 (dd, J = 9.0, 15.0 Hz, 11 9, 11, 13, 11, 12a, 12b, 1H) 14 14 3.21 (dd, J = 5.1, 14.7 Hz, 1H) 13 145.5 12, 15 14 131.61 7.49 (d, J = 8.4 Hz, 2H) 15 12, 15, 16 12a, 12b, 15 15 124.91 8.12 (d, J = 9.0 Hz, 2H) 14 13, 16 14 16 148.70 14, 15

[0340] Table 15 is a summary of the NMR data obtained from the RO-Obi fraction of the oil. NMR spectra obtained from the RO-Obi fraction of the oil are provided as FIG. 26 (.sup.1H NMR spectrum), FIG. 27 (.sup.13C NMR spectrum), FIG. 28 (.sup.1H-.sup.13C HSQC spectrum), FIG. 29 (.sup.1H-.sup.13C COSY), FIG. 30 (.sup.1H-.sup.13C HMBC), and FIG. 31 (.sup.1H-.sup.13C NOESY spectrum).

TABLE-US-00015 TABLE 15 Summary of NMR Data for Opened-Ring Obafluorin (RO-Obi) NOESY gCOSY HMBC .sup.1H-.sup.1H .sup.13C .sup.1H (ppm), .sup.1H-.sup.1H .sup.1H-.sup.13C Through Atom (ppm) multiplets in Hz 3 bond 2-3 bond space, 4 1 147.40 5, 6 2 149.3 4, 6 3 144.05 4, 5 4 119.97 6.98 (d, J = 9.0 Hz, 1H) 5 2, 5 5 5 120.12 6.78 (t, J = 8.1 Hz, 1H) 4, 6 1, 4, 6 4, 6 6 120.18 7.37 (d, J = 9.6 Hz, 1H) 5 1, 5, 7 5 7 170.32 6 8 9 57.70 4.75 (d, J = 2.4 Hz, 1H) 11 7, 10, 11 11, 12 10 173.77 9 11 73.27 4.54 (ddd, J = 2.1, 5.6, 8.0 Hz, 9, 12 9, 12 1H) 12 41.81 a) 3.03 (t, J = 1.0 Hz, 1H) 11 9, 11, 13, 14 9, 11, 14 b) 2.96 (t, J = 1.0 Hz, 1H) 13 147.83 15 14 131.81 7.50 (d, J = 8.4 Hz, 2H) 15 12, 16 12, 15 15 124.54 8.15 (d, J = 8.4 Hz, 2H) 14 13 14 16 148.29 14

[0341] The results of these experiments resulted in the isolation and NMR characterization of purified RC-Obi and purified RO-Obi.

Example 14: Hydrolysis of RC-Obi and Obi-SNAC

[0342] To characterize the role of the TE domain of the ObiF enzyme in -lactone formation, an N-acetylcysteamine (SNAC) thioester (Obi-SNAC) was prepared, and the following experiments were conducted to compare the rates of hydrolysis of RC-Obi and Obi-SNAC.

[0343] A purified Obi-SNAC solution was produced by treatment of a purified RC-Obi solution with neat N-acetylcysteamine (SNAC), as illustrated in the schematic diagram in FIG. 38A. 1 mg of purified RC-Obi -lactone was dissolved in 5 mg N-acetylcysteamine (SNAC). The solution was left at room temperature overnight, and then diluted with 0.5 mL MeCN and purified by reverse phase preparatory HPLC (gradient of 5% B to 95% B over 20 min at flow rate of 10 mL/min). The product-containing fraction (retention time 21.2 min) was concentrated by rotary evaporation, dissolved in 0.5 mL DMSO, and transferred to a 1.5 mL Eppendorf tube.

[0344] The resulting purified Obi-SNAC solution was lyophilized overnight and dissolved in methanol-d4 for NMR analysis. Obi-SNAC forms a 2:1 mixture of rotamers in methanol-d4. The NMR data for the major rotamer are summarized in Table 16. The NMR spectra obtained from the Obi-SNAC solution are provided as FIG. 46 (.sup.1H NMR spectrum), FIG. 47 (.sup.13C NMR spectrum), FIG. 48 (.sup.1H-.sup.13C HSQC spectrum), FIG. 49 (.sup.1H-.sup.13C COSY), and FIG. 50 (1H-.sup.13C HMBC).

TABLE-US-00016 TABLE 16 Summary of NMR Data for N-acetylcysteamine (SNAC) thioester (Obi-SNAC) .sup.13C gCOSY .sup.1H-.sup.1H HMBC .sup.1H-.sup.13C Atom.sup.a (ppm) .sup.1H (ppm), multiplets in Hz (3 bond) (2-3 bond) 1 2 148.58 4, 6 3 147.30 4, 5 4 119.91 6.99 (d, 7.9 Hz, 1H) 5 6 5 120.19 6.8 (t, 7.9 Hz, 1H) 4, 6 3 6 120.80 7.41 (d, 7.9 Hz, 1H) 5 4, 7 7 170.32 8 9.08 (d, 8.7 Hz, 1H) 9 64.24 4.75 (d, 8.7 Hz, 1H) 8 8 10 201.68 11 72.71 4.59 (t, 6.7 Hz, 1H) 12 12 12 41.63 2.93-3.05 (m, 4H).sup.b 11 11 13 147.22 14 131.70 7.48 (d, 7.4 Hz, 2H) 15 15 15 124.41 8.13 (d, 8.13 Hz, 2H) 14 14 16 148.16 18 17 18 29.43 2.93-3.05 (m, 4H).sup.b 18 17 19 39.77 3.21-3.39 (m, 2H).sup.c 17 20 21 173.57 22 22.49 1.89 (s, 3H) .sup.aSinglet at 2.65 ppm in the .sup.1H-NMR and 40.5 ppm in the .sup.13C-NMR is residual DMSO. .sup.bmultiplet consists of overlapping peaks from protons on C-12 and C-18, confirmed by HSQC and HMBC spectra. .sup.cmultiplet consists of protons on C18 overlapping with peaks from methanol, as confirmed by HSQC, HMBC, and COSY.

[0345] Solutions of purified RC-Obi (1 mM) and Obi-SNAC (1 mM) were prepared in MES buffer at pH7 to form two reaction mixtures. Aliquots (100 L) of each reaction mixture were taken at various time points to be analyzed by HPLC (gradient of 5% B to 95% B over 20 min, 95% B to 100% B over 3 min, and 100% B to 5% B over 2 min at a flow rate of 1 mL/min) with detection by optical absorbance spectroscopy at 270 nm. HPLC peak identities were confirmed by LC-MS and retention times were normalized using an Fmoc-Ala internal standard. Experiments were performed in duplicate.

[0346] FIG. 38B is a graph summarizing the HPLC elution profiles for the RC-Obi hydrolysis reaction mixture at 0 h, 0.5 h, 2 h, and 6 h after initiation of the reaction, as well as reference HPLC elution profiles produced by standard solutions of RO-Obi, RC-Obi, and Fmoc-Ala. Rapid hydrolysis of RC-Obi in MES buffer at pH 7 was observed with a half-life of less than 30 min as well as the immediate formation of two products with retention times of 15.2 min and 17.2 min, respectively with optical absorbance spectra consistent with the presence of an aryl nitro group. Comparison of the elution profiles of the RC-Obi hydrolysis reaction mixture to an analytical standard solution of RO-Obi purified from P. fluorescens culture supernatant confirmed that the peak observed at 17.2 min was RO-Obi. The peak observed at 15.2 min was attributed to an uncharacterized intermediate that converted directly to Obi-COOH. A previous observation of RC-Obi hydrolysis using .sup.1H-NMR in D.sub.2O/CD.sub.3CN (1:4) detected the formation of an oxazoline intermediate that hydrolyzes to give O-(2,3-dihydroxybenzoyl)--OH-p-NO.sub.2-homoPhe. The unknown intermediate was observed to have converted entirely to Obi-COOH by 6 h after initiation of the hydrolysis reaction.

[0347] FIG. 38C is a graph summarizing the HPLC elution profiles for the RO-Obi hydrolysis reaction mixture at 0 h, 0.5 h, 1 h, 1.5 h, 2 h, 2.5 h, 3 h, 3.5 h, 4 h, 4.5 h, 5 h., and 5.5 h after initiation of the reaction, as well as reference HPLC elution profiles produced by standard solutions of RO-Obi, Obi-SNAC, and Fmoc-Ala. As illustrated in FIG. 38C, Obi-SNAC hydrolyzed directly to RO-Obi in the MES buffer at pH 7 with a half-life of about 3.2 hrs. The rate of hydrolysis of Obi-SNAC was comparable to that of the ObiF-C1141A mutant (see FIG. 2D, FIG. 2E), which supports the role of the ObiF TE domain as a catalyst for -lactone ring formation.

[0348] FIGS. 68, 69, 70, 71, 72, 73, 74, and 75 show LC-MS chromatograms analysis of Obi, Obi-COOH, and Obi-SNAC. FIG. 68 is a graph showing a LC-MS chromatogram (absorbance at 263 nm (y-axis) versus retention time (x-axis)) of an ethyl acetate extraction of the culture supernatant from Obi-producing P. fluorescens ATCC 39502. Both RC-Obi and RO-Obi are detected in P. fluorescens culture supernatant.

[0349] FIG. 69 is a graph showing a LC-MS chromatogram (extracted ion counts (y-axis) versus retention time (x-axis)) of an ethyl acetate extraction of the culture supernatant from Obi-producing P. fluorescens ATCC 39502. Both RC-Obi and RO-Obi are detected in P. fluorescens culture supernatant.

[0350] FIG. 70 is a graph showing a LC-MS chromatogram (absorbance at 263 nm (y-axis) versus retention time (x-axis)) of RC-Obi purified via RP-C18 prep-HPLC from P. fluorescens culture supernatant.

[0351] FIG. 71 is a graph showing a LC-MS chromatogram (extracted ion counts (y-axis) versus retention time (x-axis)) of RC-Obi purified via RP-C18 prep-HPLC from P. fluorescens culture supernatant.

[0352] FIG. 72 is a graph showing a LC-MS chromatogram (absorbance at 263 nm (y-axis) versus retention time (x-axis)) of RO-Obi purified via RP-C18 prep-HPLC from P. fluorescens culture supernatant.

[0353] FIG. 73 is a graph showing a LC-MS chromatogram (extracted ion counts (y-axis) versus retention time (x-axis)) of RO-Obi purified via RP-C18 prep-HPLC from P. fluorescens culture supernatant.

[0354] FIG. 74 is a graph showing a LC-MS chromatogram (absorbance at 263 nm (y-axis) versus retention time (x-axis)) of Obi-SNAC purified via RP-C18 prep-HPLC from P. fluorescens culture supernatant.

[0355] FIG. 75 is a graph showing a LC-MS chromatogram (extracted ion counts (y-axis) versus retention time (x-axis)) of Obi-SNAC purified via RP-C18 prep-HPLC from P. fluorescens culture supernatant.

[0356] The results of these experiments indicate that enzyme catalysis by the TE domain of the ObiF enzyme precedes the transformation of an Obi thioester to the corresponding cyclic -lactone RC-Obi.

Example 15: Antibiotic Susceptibility Testing

[0357] To assess the antibiotic efficacy of RC-Obi and RO-Obi, the following experiments were conducted.

[0358] Bacterial strains (E. coli 29522 and E. coli X580) were grown from frozen glycerol stocks in LB media overnight at 37 C. with shaking. These starter cultures were used to inoculate fresh LB broth or M9 minimal media broth at an OD.sub.600 of 0.3. Each well of a 96-well plate was filled with 100 L of sterile media (LB or M9). A sterile solution of RC-Obi or RO-Obi in LB or M9 media was added to the first well of each row and was serially diluted two-fold down the entire row creating a compound concentration gradient of 0.3-0.0025 mM.

[0359] Each well of the plate was then filled with 100 L of the OD.sub.600 0.3 bacterial cell suspensions to give a final volume of 200 L per well. The plates were incubated at 37 C. and the OD.sub.600 of each well was measured every 30 minutes over 24 hours. The plate was shaken briefly prior to each measurement to ensure an even cell suspension. All growth curves were generated in triplicate.

[0360] FIG. 4A is a graph showing E. coli ATCC 25922 growth curves generated by monitoring OD.sub.600 in M9 minimal media in the presence of 150 M RC-Obi, 150 M RO-Obi or buffer control. The -lactone moiety of RC-Obi inhibited the growth of E. coli and induced a cell clumping phenotype.

[0361] FIG. 16A is a graph showing E. coli ATCC 25922 growth curves generated by monitoring OD.sub.600 in the presence of various concentrations of RC-Obi, or buffer control. The -lactone moiety of RC-Obi inhibited the growth of E. coli in a dose-dependent manner.

[0362] E. coli ATCC 25922 was passaged in LB broth through 6 overnight cycles in the presence of 0.25 mM RC-Obi -lactone with fresh doses of antibiotic added every 18 hours for 6 days straight. The 6 passaged E. coli was then treated with varying concentrations of RC-Obi -lactone in LB broth and was still susceptible to the antibiotic (see FIG. 16B). Non-pathogenic E. coli X580 (a -lactam hypersensitive strain from Eli Lilly & Co.) were similarly tested and showed enhanced sensitivity and slower growth recovery towards RC-Obi -lactone compared to E. coli ATCC 29522 (see FIG. 16C).

[0363] The E. coli cells were also subjected to fluorescence microscopy after treatment with RC-Obi or RO-Obi. E. coli ATCC 29522 cells were grown in LB media for 8 hours at 37 C. then plated on agar media and incubated overnight at 37 C. A single colony was transferred into test tube with fresh LB media and allowed to grow to 0.3 OD.sub.600 at 37 C. Cells were diluted by a factor of 10, allowed to grow to OD.sub.600 0.3 again. Aliquots of the cell suspension (2 mL each) were treated with RC-Obi (0.1 mM), RO-Obi (0.5 mM), ampicillin (50 g/mL), or buffer control and incubated for 2 hours at 37 C. Culture aliquots of 250 L were then used for staining and fluorescence microscopy. Cell membranes and DNA were labeled with the fixable dyes FM 4-64.sub.fx and DAPI, respectively, according to the manufacturer's instructions. Cells were fixed with 2.6% paraformaldehyde+0.008% glutaraldehyde as previously described. Fixed cells were imaged on 1% agarose pads with an Olympus BX51 microscope equipped with a CCD OrcaERG camera (Hamamatsu Photonics, Bridgewater, N.J.), an Olympus Plan N 100/1.25 Oil Ph3 objective, and an X-Cite 120 LED light source (Lumen Dynamics). Nikon elements were used for image capture using the DAPI and rhodamine filter sets from Chroma. Images were processed using NISElements Basic Research Microscope Imaging Software (Nikon Corp.).

[0364] FIG. 4B is a fluorescence microscope images of E. coli ATCC 25922 fixed and stained with DAPI and FM 4-64.sub.fx after treatment with buffer control (rhodamine filter). FIG. 4C is a fluorescence microscope images of E. coli ATCC 25922 fixed and stained with DAPI and FM 4-64.sub.fx after treatment with buffer control (DAPI filter). FIG. 4D is a fluorescence microscope image of E. coli ATCC 25922 fixed and stained with DAPI and FM 4-64.sub.fx after treatment with ampicillin (rhodamine filter). FIG. 4E is a fluorescence microscope image of E. coli ATCC 25922 fixed and stained with DAPI and FM 4-64.sub.fx after treatment with ampicillin (DAPI filter). FIG. 4F is a fluorescence microscope image of E. coli ATCC 25922 fixed and stained with DAPI and FM 4-64.sub.fx after treatment with closed-ring obafluorin RC-Obi (rhodamine filter). FIG. 4G is a fluorescence microscope images of E. coli ATCC 25922 fixed and stained with DAPI and FM 4-64.sub.fx after treatment with RC-Obi (DAPI filter). FIG. 4H is a fluorescence microscope images of E. coli ATCC 25922 fixed and stained with DAPI and FM 4-64.sub.fx after treatment with RO-Obi (rhodamine filter). FIG. 4I is a fluorescence microscope images of E. coli ATCC 25922 fixed and stained with DAPI and FM 4-64.sub.fx after treatment with RO-Obi (DAPI filter). Treatment of E. coli with RO-Obi carboxylate induced moderate cell clumping and had minimal effect on E. coli growth compared to buffer control. Treatment with RC-Obi induced severe cell clumping and halted E. coli growth, which recovered to normal levels after 10 hours.

[0365] The results of this experiment demonstrated the antibiotic efficacy of RC-Obi against E. coli.

Example 16: ObiHDF Optimization and Substrate Screen Testing

[0366] To assess the compatibility of various substrates and optimization of experimental conditions for the enzymatic synthesis of -lactone rings described herein, the following experiments were conducted.

[0367] Various substrate compositions (see FIG. 80B) were used in the reaction scheme illustrated in FIG. 80A, and the concentrations of intermediate and products were used to screen each candidate substrate for compatibility with the reaction illustrated in FIG. 80A.

[0368] Substrate screen compositions used in the enzymatic synthesis of -lactone ring products were first tested to determine an optimization of intermediate ObiH production of beta-hydroxy-alpha-amino acid according to the reaction scheme illustrated in FIG. 81A. A list of substrate screen compositions is provided in FIG. 80B, wherein the substrate screen compositions are denoted by the stage of the reaction (i.e. 1, 2, 3, or 4, as shown in FIGS. 80A and 83A) and a letter unique to each substrate (e.g. 2k refers to the k.sup.th substrate manifested in the 2nd stage of the enzymatic reaction).

[0369] To a 1.5 mL Eppendorf tube 25 mM sodium phosphate buffer, 2.5 mM L-threonine, 1 mM aldehyde, 10 M PLP, and 10 M ObiH were added, with the enzyme being added last to initiate the reaction. Total reaction volume was 1 mL in water. The reaction was allowed to progress at room temperature. After 1 hour, the reaction was quenched with the addition of 1 M HCl to bring to pH 2. L-phenylalanine was added as an internal standard at a final concentration of 100 M. The reactions were run in triplicate and analyzed by LC-MS. For all screens, the LC-MS method used a revers phase C18 column where solvent A was water buffered with 0.1% formic acid and solvent B was acetonitrile buffered with 0.1% formic acid. A gradient of 0% B to 5% B was formed over 5 min followed by a gradient of 5% B to 95% B over 10 minutes. The maximum ion counts for the ObiH products were used to calculate product concentration relative to an internal phenylalanine standard. Experiments were performed in triplicate as independent trails. The measured concentrations of products of the process illustrated in FIG. 81A for the various substrate screen compositions is provided in FIG. 80B are summarized in the bar graph shown in FIG. 81B.

[0370] As shown in FIG. 81B, substrate composition 2b was detected at the highest concentration of all substrate compositions tested, indicating the 1b-4b substrate screen (see FIG. 80A) produced the highest concentration of ObiH products. The 1b-4b substrate screen was utilized in further optimizing the product yield of the ObiH intermediate product (see FIG. 82A) using the following procedure.

[0371] To a 1.5 mL Eppendorf tube 25 mM sodium phosphate buffer, variable L-threonine (1-50 mM), variable phenylacetaldehyde (PAA; 2-10 mM), 10 M PLP, and 10 M ObiH were added, with the enzyme being added last to initiate the reaction. Total reaction volume was 1 mL in water containing 0%-50% DMSO or water containing 0%-50% MeOH. The reaction was allowed to progress at room temperature or 4 C. After 1 hour, the reaction was quenched with the addition of 1 M HCl to bring to pH 2. L-phenylalanine was added as an internal standard at a final concentration of 100 M and the reactions were analyzed by LC-MS. The LC-MS method used a reverse phase C18 column where solvent A was water buffered with 0.1% formic acid and solvent B was acetonitrile buffered with 0.1% formic acid. A gradient of 0% B to 5% B was formed over 5 min followed by a gradient of 5% B to 95% B over 10 minutes. The maximum ion counts for the ObiH products were used to calculate product concentration relative to an internal phenylalanine standard. Experiments with variable L-threonine and PAA were performed in triplicate as independent trails. Experiments with variable DMSO and MeOH solvents were performed as single trials. The results of the optimization processes are illustrated in FIGS. 82B and 82C.

[0372] Substrate screens for the ObiH,F,D reaction (FIGS. 81A, 83A) were also analyzed using the following procedure.

[0373] ObiF and ObiD were pantetheinylated by a solution containing 180 M CoASH, 5 mM DTT, 400 nM Sfp, 10 mM MgCl.sub.2, 25 M apo enzyme, and 25 mM sodium phosphate buffer. The pantetheinylation reaction was allowed to proceed at room temperature for 2 hours. After this reaction time, the solution was added to a 1.5 mL Eppendorf tube and contained 25 mM sodium phosphate buffer, 15 mM L-threonine, 10 M PLP, 1 mM aldehyde, 1 mM 2,3-DHB, 5 mM DTT, 5 mM ATP, 10 M ObiH, 2.5 M holo-ObiF, and 2.5 M holo-ObiD (holo-ObiF and -ObiD were used directly from the pantetheinylation reaction. The total reaction volume was 1 mL. The aldehydes were dissolved in a stock solution of 5% DMSO in water, making the final reaction 1% DMSO and 99% water by volume. The reaction was allowed to proceed at room temperature for 24 hours, at the end of which the reaction was quenched with 1 M HCl to a pH of 2 and analyzed by LC-MS. The LC-MS method used a reverse phase C18 column where solvent A was water buffered with 0.1% formic acid and solvent B was acetonitrile buffered with 0.1% formic acid. A gradient of 0% B to 5% B was formed over 5 min followed by a gradient of 5% B to 95% B over 10 minutes. The presence of ObiHDF products was confirmed by extracting the molecular ions from the total ion count from LC-MS analysis. Experiments were performed in triplicate as independent trails.

[0374] The compounds marked in blue in FIG. 83B are substrate compositions which provided products and all intermediates in significant quantities throughout the reaction shown in FIG. 83A (i.e. products and intermediates resulting from the substrate were present throughout stages 1, 2, 3, and 4).

Example 16: Synthesis of an Alkyne-Tagged Chemical Probe

[0375] To assess the application of the methods disclosed herein to the synthesis of alkyne-tagged chemical probes, the following experiments were conducted.

[0376] FIG. 84 is a diagram of the reaction scheme used to produce alkyne-tagged ObiHDF products in these experiments.

[0377] To a 1.5 mL Eppendorf tube 25 mM sodium phosphate buffer, 15 mM L-threonine, 1 mM aldehyde (5), 10 M PLP, and 5 M ObiH were added, with the enzyme being added last to initiate the reaction. Total reaction volume was 1 mL in 93% water/7% DMSO and the final pH was 7.5. The reaction was allowed to progress at room temperature for 3 hours. The reaction was quenched with the addition of 1 M HCl and analyzed by LC-MS. The LC-MS method used a reverse phase C18 column where solvent A was water buffered with 0.1% formic acid and solvent B was acetonitrile buffered with 0.1% formic acid. A gradient of 0% B to 5% B was formed over 5 min followed by a gradient of 5% B to 95% B over 10 minutes. The ObiH product 6 was detected in the LC-MS, as illustrated in the optical absorbance spectrum of FIG. 91. The presence of ObiH product 6 was confirmed by extracting the molecular ions from the total ion count from LC-MS analysis illustrated in FIG. 92 to obtain an extracted ion count at m/z=220 (FIG. 93).

[0378] The ObiH product (6) was purified by prep-HPLC giving 5.4 mg that was characterized by multi-dimensional NMR, the results of which are shown graphed in FIGS. 85, 86, 87, 88, 89, and 90. The results of the multi-dimensional NMR characterization of the ObiH product (6) are also shown summarized in Table 17 below.

TABLE-US-00017 TABLE 17 Summary of NMR Data for ObiH Product 6 [00005] gCOSY HSQC HMBC .sup.13C .sup.1H-.sup.1H .sup.1H-.sup.13C .sup.1H-.sup.13C Atom (ppm) .sup.1H (ppm), multiplets in Hz 3 bond 1 bond 2-3 bond 1 171.32 2 59.32 3.74 (d, J = 3.8 Hz, 1H) 3 2 4 3 71.49 4.32 (dt, J = 8.6, 4.2 Hz, 1H) 2, 4 3 2 4 41.71 2.99-2.82 (m, 2H). 3 4 7.42 5 122.12 7.42, 10 6 130.77 7.42 (d, J = 8.1 Hz, 2H) 7 6 6, 7, 10 7 133.25 7.28 (d, J = 8.1 Hz, 2H) 6 7 6, 7, 4 8 139.25 7.28, 10 9 84.29 10 78.63 3.44 (s, 1H)

[0379] ObiF and ObiD were pantetheinylated by a solution containing 180 M CoASH, 5 mM DTT, 400 nM Sfp, 10 mM MgCl.sub.2, 25 M apo enzyme, and 25 mM sodium phosphate buffer. The pantetheinylation reaction was allowed to proceed at room temperature for 2 hours. After this reaction time, a second reaction mixture containing 5 M holo-ObiF, 5 M holo-ObiD, 5 mM ATP, 5 mM DTT, 500 M 2,3-DHB, 500 M -OH-p-alkynyl-homoPhe (6), and 25 mM PBS at pH 7.5. The reaction was left at room temperature for 24 hours, then quenched with HCl to a pH of 2 and analyzed by LC-MS. The LC-MS method used a reverse phase C18 column where solvent A was water buffered with 0.1% formic acid and solvent B was acetonitrile buffered with 0.1% formic acid. A gradient of 0% B to 5% B was formed over 5 min followed by a gradient of 5% B to 95% B over 10 minutes.

[0380] The beta-lactone product 7 produced a relatively weak signal in the LC-MS, as illustrated in the optical absorbance spectrum of FIG. 97. The presence of ObiHDF products 7 and 8 was confirmed by extracting the molecular ions from the total ion count spectrum from LC-MS analysis illustrated in FIG. 95 to obtain extracted ion counts at m/z=356 (FIG. 96) and at m/z=338 (FIG. 97). The beta-lactone product 7 did not ionize very well, hence the weak signal in the LC-MS, as illustrated in the optical absorbance spectrum of FIG. 97. There are multiple peaks in the m/z=338 extracted ion chromatogram (FIG. 97) because compound 8 fragmented to give the same mass as compound 7 and there was a third degradation product that was an oxazoline with the same mass as compound 7.

[0381] This written description uses examples to disclose the disclosure, including the best mode, and also to enable any person skilled in the art to practice the disclosure, including making and using any devices or systems and performing any incorporated methods. The patentable scope of the disclosure is defined by the claims, and may include other examples that occur to those skilled in the art. Such other examples are intended to be within the scope of the claims if they have structural elements that do not differ from the literal language of the claims, or if they include equivalent structural elements with insubstantial differences from the literal languages of the claims.