Enzymatic Production of Glycosylated Synthons

Abstract

The present invention relates to a method for producing a glycosylated synthon or a monomer. Said method includes at least one step of placing at least one glycan-saccharase in the presence of at least one hydroxylated synthon and at least one saccharose. The invention also relates to a method for producing a glyco(co)polymer, including polymerizing at least two monomers separately obtained from the enzymatic glycosylation method according to the invention, and to a method for producing a glyco(co)polymer, preferably a block glyco(co)polymer, including coupling at least two monomers separately obtained from the enzymatic glycosylation method according to the invention.

Claims

1. A process for manufacturing a glycosylated synthon, or monomer, comprising at least one step of placing at least one glycan-saccharase in contact with at least one hydroxylated synthon and at least one sucrose, in which: (A) said hydroxylated synthon is chosen from the group constituted of: (i) (meth)acrylate/(meth)acrylamide synthons of formula (I): ##STR00027## in which: R.sub.1 represents a hydrogen atom or a C.sub.1-C.sub.3 alkyl; R.sub.2 represents a C.sub.1-C.sub.20 alkylene group; or a group (C.sub.2H.sub.4O).sub.n, with n being an integer between 1 and 10; and X.sub.1 represents (O), (NH), (S) or (NR.sub.2(OH)), with R.sub.2 representing a C.sub.1-C.sub.20 alkylene group; or a group (C.sub.2H.sub.4O).sub.m, with m being an integer between 1 and 10; (ii) styrene-based synthons of formula (II): ##STR00028## in which R.sub.3 represents a covalent bond; a C.sub.1-C.sub.20 alkylene group; or a group (C.sub.2H.sub.4O).sub.n, with n being an integer between 1 and 10; (iii) N-carboxyanhydride (NCA) synthons of formula (III): ##STR00029## in which R.sub.4 represents a covalent bond; a C.sub.1-C.sub.20) alkylene group; or a group (C.sub.2H.sub.4O).sub.n, with n being an integer between 1 and 10; (iv) lactone/lactam/thiolactone synthons of formula (IV): ##STR00030## in which: R.sub.5 represents a covalent bond; a C.sub.1-C.sub.20 alkylene group; or a group (C.sub.2H.sub.4O).sub.m, with m being an integer between 1 and 10; n represents an integer between 1 and 20; X.sub.2 represents (O), (NH) or (S); and R.sub.6 represents a hydrogen or a C.sub.1-C.sub.20 alkyl group; (v) synthons of formula (V): ##STR00031## in which R.sub.7 represents a C.sub.1-C.sub.20 alkylene group; and (vi) synthons of formula (VI): ##STR00032## in which R.sub.8 represents a C.sub.1-C.sub.20 alkylene group; and (B) said glycan-saccharase is chosen from the group constituted of glycoside-hydrolases belonging to glycoside-hydrolase families 13, 68 and 70.

2. The process as claimed in claim 1, in which the glycan saccharase is chosen from the group comprising: a sequence having at least 80% identity with SEQ ID NO: 1 a sequence having at least 80% identity with SEQ ID NO: 1 mutated once at any one of the positions R.sub.226, I228, F229, A289, F290, I330, V331, D394 and R446; a sequence having at least 80% identity with SEQ ID NO: 11; a sequence having at least 80% identity with SEQ ID NO: 12; a sequence having at least 80% identity with SEQ ID NO: 13; a sequence having at least 80% identity with SEQ ID NO: 14; a sequence having at least 80% identity with SEQ ID NO: 15; a sequence having at least 80% identity with SEQ ID NO: 16; a sequence having at least 80% identity with SEQ ID NO: 17; and a sequence having at least 80% identity with SEQ ID NO: 18.

3. The process as claimed in claim 2, in which the sequence having at least 80% identity with SEQ ID NO: 1 mutated once at any one of the positions R.sub.226, I228, F229, A289, F290, I330, V331, D394 and R446 is chosen from: a sequence having at least 80% identity with SEQ ID NO: 2, said sequence having an amino acid X.sub.1 representing an amino acid chosen from the group constituted of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W and Y; a sequence having at least 80% identity with SEQ ID NO: 3, said sequence having an amino acid X.sub.2 representing an amino acid chosen from the group constituted of A, C, D, E, F, G, H, L, M, N, P, Q, R, S, T, V, W and Y; a sequence having at least 80% identity with SEQ ID NO: 4, said sequence having an amino acid X.sub.3 representing an amino acid chosen from the group constituted of A, C, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, V, W and Y; a sequence having at least 80% identity with the sequence SEQ ID NO: 5, said sequence having an amino acid X.sub.4 representing an amino acid chosen from the group constituted of C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W and Y; a sequence having at least 80% identity with the sequence SEQ ID NO: 6, said sequence having an amino acid X.sub.5 representing an amino acid chosen from the group constituted of A, C, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, V, W and Y; a sequence having at least 80% identity with the sequence SEQ ID NO: 7, said sequence having an amino acid X.sub.6 representing an amino acid chosen from the group constituted of A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W and Y; a sequence having at least 80% identity with SEQ ID NO: 8, said sequence having an amino acid X.sub.7 representing an amino acid chosen from the group constituted of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W and Y; a sequence having at least 80% identity with SEQ ID NO: 9, said sequence having an amino acid X.sub.8 representing an amino acid chosen from the group constituted of A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W and Y; and a sequence having at least 80% identity with SEQ ID NO: 10, said sequence having an amino acid X.sub.9 representing an amino acid chosen from the group constituted of A, C, D, E, F, G, H, I, K, L, M, N, Q, S, T, V, W and Y.

4. The process as claimed in claim 2, in which the sequence having at least 80% identity with SEQ ID NO: 1 mutated once at any one of the positions R226, I228, F229, A289, F290, I330, V331, D394 and R446 is chosen from: a sequence having at least 80% identity with SEQ ID NO: 2, said sequence having an amino acid X.sub.1 representing an amino acid chosen from the group constituted of C, H, K, M, N, Q, S, T and V; a sequence having at least 80% identity with SEQ ID NO: 3, said sequence having an amino acid X.sub.2 representing an amino acid chosen from the group constituted of H, L, T, V, W and Y; a sequence having at least 80% identity with SEQ ID NO: 4, said sequence having an amino acid X.sub.3 representing an amino acid chosen from the group constituted of C, D, E, G, H, I, K, M, N, P, Q, V, W and Y; a sequence having at least 80% identity with the sequence SEQ ID NO: 5 (ASNP-A289X), said sequence having an amino acid X.sub.4 representing an amino acid chosen from the group constituted of C, D, E, F, M, N, P, Q, S, T, V and W; a sequence having at least 80% identity with the sequence SEQ ID NO: 6, said sequence having an amino acid X.sub.5 representing an amino acid chosen from the group constituted of A, C, D, E, G, H, I, K, L, M, P, Q, S, T, V and W; a sequence having at least 80% identity with the sequence SEQ ID NO: 7, said sequence having an amino acid X.sub.6 representing an amino acid chosen from the group constituted of A, C, D, E, F, G, H, K, L, M, N, Q, S, V and Y; a sequence having at least 80% identity with SEQ ID NO: 8, said sequence having an amino acid X.sub.7 representing an amino acid chosen from the group constituted of A, C, D, E, F, G, H, I, K, L, N, Q, R, S, T, W and Y; a sequence having at least 80% identity with SEQ ID NO: 9, said sequence having an amino acid X.sub.8 representing an amino acid chosen from the group constituted of A, E, F, G, H, I, K and L; a sequence having at least 80% identity with SEQ ID NO: 10, said sequence having an amino acid X.sub.9 representing an amino acid chosen from the group constituted of A, C, G, K, L, M, N, and S;

5. The process as claimed in claim 1, in which the hydroxylated synthon is chosen from the group consisting of 2-(hydroxy)ethyl methacrylate (HEMA), N-(hydroxy)methylacrylamide (NHAM), N-(hydroxy)ethylacrylamide (HEAA), 4-vinylphenol (VP), 4-vinylbenzyl alcohol (VBA), 4-(hydroxy)methyloxazolidine-2,5-dione (HMNCA), a-(hydroxy)methylcaprolactone (AHMCL), ()-mevalonolactone (MVL), 2-mercaptoethanol (BME), 2-propen-1-ol (allyl alcohol) and N,N-bis(2-hydroxyethyl)acrylamide (NNHEA).

6. The process as claimed in claim 1, in which the hydroxylated synthon is chosen from the group consisting of 2-(hydroxy)ethyl methacrylate (HEMA), N-(hydroxy)methylacrylamide (NHAM), N-(hydroxy)ethylacrylamide (HEAA), 4-vinylbenzyl alcohol (VBA), 2 propen-1-ol (allyl alcohol), 2-mercaptoethanol (BME) and N,N-bis(2-hydroxyethyl)acrylamide (NNHEA).

7. The process as claimed in claim 1, in which the hydroxylated synthon is glucosylated or fructosylated at the end of the process.

8. A process for manufacturing a glyco(co)polymer, comprising the polymerization of at least two monomers obtained, independently, on conclusion of the process as claimed in claim 1.

9. The process as claimed in claim 8, comprising, in the following order, the following steps: a) polymerization of two monomers obtained, independently of each other, at the end of the process as claimed in claim 1, making it possible to obtain a chain of two monomers; b) polymerization of the monomer chain obtained at the end of the preceding step with a monomer obtained at the end of the process as claimed in claim 1; and then c) one or more successive, and independent, steps consisting in polymerizing the monomer chain obtained at the end of the preceding step with a monomer obtained at the end of the process as claimed in claim 1.

10. The process as claimed in claim 9, comprising, independently: at least one step a) between steps a) and b); at least one step b) between steps b) and c); and/or at least one step c) after any one of the steps c), in which the monomer chain obtained on conclusion of the preceding step is polymerized with at least one non-glycosylated synthon.

11. A process for manufacturing a glyco(co)polymer, comprising the coupling of at least two monomers obtained, independently, at the end of the process as claimed in claim 1.

12. A process for manufacturing a glycol(co)polymer, comprising the coupling of a least two monomers obtained, independently, from synthons of Formula (V) and/or (VI) as defined in claim 1.

Description

DETAILED DESCRIPTION OF THE INVENTION

[0124] The inventors have developed an enzymatic process for the glycosylation of hydroxylated synthons using specific glycan-saccharases identified by the Applicant, which are capable of performing such a glycosylation, in particular glucosylation or fructosylation.

[0125] To do this, these specific enzymes require only the presence of sucrose, which is a cheap and renewable agro-resource. In this respect, a process according to the invention is advantageously inexpensive.

[0126] These glycosylated synthons, or monomers, are advantageously used in a chemical process for preparing glyco(co)polymers of controlled structures and functionalities.

[0127] Thus, the inventors have developed a process for the chemo-enzymatic synthesis of glyco(co)polymers based on chemical polymerization or a coupling reaction of glycosylated monomers obtained enzymatically.

[0128] The processes according to the present invention advantageously make it possible to better control the degrees of glycosylation of the synthons and the structures and also their distribution.

[0129] They also make it possible to overcome the difficulties associated with sugar chemistry and to limit the use of toxic products.

[0130] They also prove to be advantageous in terms of reducing the costs and time for the production of glycosylated synthons.

[0131] Finally, these processes advantageously make it possible to gain access to a wider diversity of macromolecular architectures for various fields of application, such as biomaterials, implant materials, tissue engineering, biological diagnosis and active principle delivery.

[0132] Glycan-Saccharases of the Invention

[0133] The present invention relates firstly to a process for manufacturing a glycosylated synthon, or monomer, comprising at least one step of placing at least one glycan-saccharase of the invention in contact with at least one hydroxylated synthon according to the invention and at least one sucrose.

[0134] As indicated previously, the enzymes of the invention are advantageously capable of glycosylating synthons at their hydroxyl function.

[0135] In particular, the enzymes according to the invention are capable of glucosylating or fructosylating the synthons of the invention.

[0136] Thus, some of these enzymes consist more particularly of glycoside-hydrolases belonging to glycoside-hydrolase families 13 and 70 (GH13 and GH70).

[0137] In particular, according to a preferred embodiment, a glycan-saccharase according to the invention is chosen from the group consisting of glycoside-hydrolases belonging to glycoside-hydrolase families 13, 68 and 70 (GH13, GH68 and GH70).

[0138] The glycoside-hydrolases belonging to family 13 are amylosaccharases naturally produced by bacteria of the genera Deinococcus, Neisseria or Alteromonas.

[0139] The glycoside-hydrolases belonging to family 70 are, for their part, glucan-saccharases naturally produced by lactic acid bacteria of the genera Leuconostoc, Lactobacillus, Streptococcus or Weissela sp.

[0140] In addition, the fructosyltransferase of Bacillus subtilis is also used in a glycosylation process according to the invention and belongs to glycoside-hydrolase family 68.

[0141] The enzymes of the invention are all capable of transferring glucose or fructose originating from sucrose onto the hydroxylated synthons of the invention.

[0142] None of the wild-type or mutated enzymes described in the present patent application, which are known to those skilled in the art, had hitherto been used for the purpose of glucosylating hydroxylated synthons of the invention.

[0143] The nucleotide sequence of the wild-type form of the enzyme ASNp (AmyloSaccharase of Neisseria polysaccharea) (GH13 family) has the reference GenBank AJ011781.1 whereas its polypeptide sequence has the reference Uniprot Q9ZEU2 (SEQ ID NO: 1).

[0144] The nucleotide sequence of the wild-type form of the enzyme DSR-S (derived from the strain Leuconostoc mesenteroides B-512F) has the reference GenBank 109598.

[0145] The nucleotide sequence of the wild-type form of the enzyme DSR-E (derived from the strain Leuconostoc mesenteroides NRRL B-1299) has the reference GenBank AJ430204.1 and the reference Uniprot Q8G9Q2.

[0146] The enzyme GBD-CD2 (sequence SEQ ID NO: 13) is a truncated form of the abovementioned enzyme DSR-E, as described in Brison et al., J. Biol. Chem., 2012, 287, 7915-24.

[0147] Bibliographic references describing the wild-type and mutated enzymes according to the present invention are indicated in Table 1. In addition, the method for obtaining the mutated enzymes is described in European patent applications EP 2 100 966 and EP 2 100 965.

[0148] The peptide sequences of the various wild-type or mutated enzymes according to the invention are indicated in the present patent application.

[0149] Thus, an enzyme according to the invention may be synthesized via standard methods of synthetic chemistry, i.e. homogeneous chemical syntheses in solution or in solid phase. By way of illustration, a person skilled in the art may use the techniques of polypeptide synthesis in solution described by Houben Weil (1974, in Methoden der organischen Chemie, E, Wunsh ed., volume 15-1 and 15-II, Thieme, Stuttgart). An enzyme according to the invention may also be synthesized chemically in liquid or solid phase via successive couplings of the various amino acid residues (from the N-terminal end to the C-terminal end in liquid phase, or from the C-terminal end to the N-terminal end in solid phase). A person skilled in the art may especially use the solid-phase peptide synthesis technique described by Merrifield (Merrifield R. B., (1965a), Nature, vol. 207 (996): 522-523; Merrifield R. B., (1965b), Science, vol. 150 (693): 178-185).

[0150] According to another aspect, an enzyme according to the invention may be synthesized via genetic recombination, for example according to a production process comprising the following steps:

[0151] (a) preparing an expression vector into which has been inserted a nucleic acid coding for the peptide sequence of an enzyme of the invention, said vector also comprising the regulatory sequences required for expressing said nucleic acid in a chosen host cell;

[0152] (b) transfecting a host cell with the recombinant vector obtained in step (a);

[0153] (c) culturing the host cell transfected in step b) in a suitable culture medium;

[0154] (d) recovering the culture supernatant of the transfected cells or the cell lyzate of said cells, for example by sonication or by osmotic shock; and

[0155] (e) separating or purifying, from said culture medium, or from the cell lyzate pellet, the enzyme of the invention thus obtained.

[0156] To purify an enzyme according to the invention which has been produced by host cells that have been transfected or infected with a recombinant vector coding for said enzyme, a person skilled in the art may advantageously use purification techniques described by Molinier-Frenkel (2002, J. Viral. 76, 127-135), by Karayan et al. (1994, Virology 782-795) or by Novelli et al. (1991, Virology 185, 365-376).

[0157] Thus, the glycan-saccharases that may be used in a process of the invention are chosen from a group comprising:

[0158] a sequence having at least 80% identity with SEQ ID NO: 1 (ASNP WT);

[0159] a sequence having at least 80% identity with SEQ ID NO: 1 mutated once at any one of the positions R.sub.226, I228, F229, A289, F290, I330, V331, D394 and R446;

[0160] a sequence having at least 80% identity with SEQ ID NO: 11 (DSR-S vardel4N-S512C);

[0161] a sequence having at least 80% identity with SEQ ID NO: 12 (alpha-1,2 BrS);

[0162] a sequence having at least 80% identity with SEQ ID NO: 13 (N.sub.123-GBD-CD2);

[0163] a sequence having at least 80% identity with SEQ ID NO: 14 (ASDg);

[0164] a sequence having at least 80% identity with SEQ ID NO: 15 (DSR-S-OK);

[0165] a sequence having at least 80% identity with SEQ ID NO: 16 (alpha-1,3 BrS);

[0166] a sequence having at least 80% identity with SEQ ID NO: 17 (ASR-C-del-bis); and

[0167] a sequence having at least 80% identity with SEQ ID NO: 18 (fructosyltransferase of Bacillus subtilis).

[0168] According to a particular embodiment, the mutation of a sequence having at least 80% identity with SEQ ID NO: 1 in position R.sub.226, I228, F229, A289, F290, I330, V331, D394 or R446 is a mutation by substitution.

[0169] According to one embodiment, when a sequence having at least 80% identity with SEQ ID NO: 1 is mutated once in position R.sub.226, it is chosen from a sequence having at least 80% identity with SEQ ID NO: 2 (ASNP R.sub.226X.sub.1), said sequence having an amino acid X.sub.1 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W and Y.

[0170] According to this embodiment, X.sub.1 preferably represents an amino acid chosen from the group consisting of C, H, K, M, N, Q, S, T and V.

[0171] According to one embodiment, when a sequence having at least 80% identity with SEQ ID NO: 1 is mutated once in position 1228, it is chosen from a sequence having at least 80% identity with SEQ ID NO: 3 (ASNP I228X.sub.2), said sequence having an amino acid X-) representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, L, M, N, P, Q, R, S, T, V, W and Y.

[0172] According to this embodiment, X.sub.2 preferably represents an amino acid chosen from the group consisting of H, L, T, V, W and Y.

[0173] According to one embodiment, when a sequence having at least 80% identity with SEQ ID NO: 1 is mutated once in position F229, it is chosen from a sequence having at least 80% identity with SEQ ID NO: 4 (ASNP F229X.sub.3), said sequence having an amino acid X.sub.3 representing an amino acid chosen from the group consisting of A, C, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, V, W and Y.

[0174] According to this embodiment, X.sub.3 preferably represents an amino acid chosen from the group consisting of C, D, E, G, H, I, K, M, N, P, Q, V, W and Y, in particular of C, D, E, G, I, K, M, N, P, V, W and Y, and more preferentially of M and Y.

[0175] According to one embodiment, when a sequence having at least 80% identity with SEQ ID NO: 1 is mutated once in position A289, it is chosen from a sequence having at least 80% identity with sequence SEQ ID NO: 5 (ASNP A289X.sub.4), said sequence having an amino acid X.sub.4 representing an amino acid chosen from the group consisting of C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W and Y.

[0176] According to this embodiment, X.sub.4 preferably represents an amino acid chosen from the group consisting of C, D, E, F, M, N P, Q, S, T, V and W, and more particularly chosen from the group consisting of F, M, N, P, Q, S and T.

[0177] According to one embodiment, when a sequence having at least 80% identity with SEQ ID NO: 1 is mutated once in position F290, it is chosen from a sequence having at least 80% identity with sequence SEQ ID NO: 6 (ASNP F290X.sub.5), said sequence having an amino acid X.sub.5 representing an amino acid chosen from the group consisting of A, C, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, V, W and Y.

[0178] According to this embodiment, X.sub.5 preferably represents an amino acid chosen from the group consisting of A, C, D, E, G, H, I, K, L, M, P, Q, S, T, V and W, more preferentially of A, C, D, H, I, K, L, M, Q, S, T, V and W, in particular of A, C, I, L, V, S, T and W.

[0179] According to one embodiment, when a sequence having at least 80% identity with SEQ ID NO: 1 is mutated once in position I330, it is chosen from a sequence having at least 80% identity with sequence SEQ ID NO: 7 (ASNP I330X.sub.6), said sequence having an amino acid X.sub.6 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W and Y.

[0180] According to this embodiment, X.sub.6 preferably represents an amino acid chosen from the group consisting of A, C, D, E, F, G, H, K, L, M, N, Q, S, V and Y, in particular of A and C, more preferentially of A.

[0181] According to one embodiment, when a sequence having at least 80% identity with SEQ ID NO: 1 is mutated once in position V331, it is chosen from a sequence having at least 80% identity with SEQ ID NO: 8 (ASNP V331X.sub.7), said sequence having an amino acid X.sub.7 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W and Y.

[0182] According to this embodiment, X.sub.7 preferably represents an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, K, L, N, Q, R, S, T, W and Y, more preferentially of C, D, E, F, G, N, R, S, T, W and Y, in particular of E, T and W;

[0183] According to one embodiment, when a sequence having at least 80% identity with SEQ ID NO: 1 is mutated once in position D394, it is chosen from a sequence having at least 80% identity with SEQ ID NO: 9 (ASNP D394X.sub.8), said sequence having an amino acid X.sub.8 representing an amino acid chosen from the group consisting of A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W and Y.

[0184] According to this embodiment, X.sub.8 preferably represents an amino acid chosen from the group consisting of A, E, F, G, H, I, K and L, in particular of A and E.

[0185] According to one embodiment, when a sequence having at least 80% identity with SEQ ID NO: 1 is mutated once in position R446, it is chosen from a sequence having at least 80% identity with SEQ ID NO: 10 (ASNP R446X.sub.9), said sequence having an amino acid X.sub.9 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, Q, S, T, V, W and Y.

[0186] According to this embodiment, X.sub.9 preferably represents an amino acid chosen from the group consisting of A, C, G, K, L, M, N, and S, in particular of A, N and M.

[0187] According to one embodiment, a sequence having at least 80% identity with SEQ ID NO: 1 mutated once at any one of the positions R.sub.226, I228, F229, A289, F290, I330, V331, D394 and R446 is chosen from any one of the sequences SEQ ID NO: 2 to 10 defined above.

[0188] According to a particular embodiment, a sequence having at least 80% identity with SEQ ID NO: 1 mutated once at any one of the positions R.sub.226, I228, F229, A289, F290, I330, V331, D394 and R446 is chosen from:

[0189] a sequence having at least 80% identity with SEQ ID NO: 2 (ASNP R.sub.226X.sub.1), said sequence having an amino acid X.sub.1 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W and Y.

[0190] a sequence having at least 80% identity with SEQ ID NO: 3 (ASNP I228X.sub.2), said sequence having an amino acid X.sub.2 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, L, M, N, P, Q, R, S, T, V, W and Y;

[0191] a sequence having at least 80% identity with SEQ ID NO: 4 (ASNP F229X.sub.3), said sequence having an amino acid X.sub.3 representing an amino acid chosen from the group consisting of A, C, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, V, W and Y;

[0192] a sequence having at least 80% identity with the sequence SEQ ID NO: 5 (ASNP A289X.sub.4), said sequence having an amino acid X.sub.4 representing an amino acid chosen from the group consisting of C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W and Y;

[0193] a sequence having at least 80% identity with the sequence SEQ ID NO: 6 (ASNP F290X.sub.5), said sequence having an amino acid X.sub.5 representing an amino acid chosen from the group consisting of A, C, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, V, W and Y;

[0194] a sequence having at least 80% identity with the sequence SEQ ID NO: 7 (ASNP I330X.sub.6), said sequence having an amino acid X.sub.6 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W and Y;

[0195] a sequence having at least 80% identity with SEQ ID NO: 8 (ASNP V331X.sub.7), said sequence having an amino acid X.sub.7 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W and Y;

[0196] a sequence having at least 80% identity with SEQ ID NO: 9 (ASNP D394X.sub.8), said sequence having an amino acid X.sub.8 representing an amino acid chosen from the group consisting of A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W and Y; and

[0197] a sequence having at least 80% identity with SEQ ID NO: 10 (ASNP R446X.sub.9), said sequence having an amino acid X.sub.9 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, Q, S, T, V, W and Y.

[0198] According to a particular embodiment, a sequence having at least 80% identity with SEQ ID NO: 1 mutated once at any one of the positions R.sub.226, I228, F229, A289, F290, I330, V331, D394 and R446 is chosen from:

[0199] a sequence having at least 80% identity with SEQ ID NO: 2 (ASNP R.sub.226X.sub.1), said sequence having an amino acid X.sub.1 representing an amino acid chosen from the group consisting of C, H, K, M, N, Q, S, T and V;

[0200] a sequence having at least 80% identity with SEQ ID NO: 3 (ASNP I228X.sub.2), said sequence having an amino acid X.sub.2 representing an amino acid chosen from the group consisting of H, L, T, V, W and Y;

[0201] a sequence having at least 80% identity with SEQ ID NO: 4 (ASNP F229X.sub.3), said sequence having an amino acid X.sub.3 representing an amino acid chosen from the group consisting of C, D, E, G, H, I, K, M, N, P, Q, V, W and Y, in particular of C, D, E, G, I, K, M, N, P, V, W and Y, and more preferentially of M and Y;

[0202] a sequence having at least 80% identity with the sequence SEQ ID NO: 5 (ASNP A2891X.sub.4), said sequence having an amino acid X.sub.4 representing an amino acid chosen from the group consisting of C, D, E, F, M, N, P, Q, S, T, V and W, and more particularly chosen from the group consisting of F, M, N, P, Q, S and T;

[0203] a sequence having at least 80% identity with the sequence SEQ ID NO: 6 (ASNP F290X.sub.5), said sequence having an amino acid X.sub.5 representing an amino acid chosen from the group consisting of A, C, D, E, G, H, I, K, L, M, P, Q, S, T, V and W, more preferentially of A, C, D, H, I, K, L, M, Q, S, T, V and W, in particular of A, C, I, L, V, S, T and W;

[0204] a sequence having at least 80% identity with the sequence SEQ ID NO: 7 (ASNP I330X.sub.8), said sequence having an amino acid X.sub.6 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, K, L, M, N, Q, S, V and Y, in particular of A and C, more preferentially of A;

[0205] a sequence having at least 80% identity with SEQ ID NO: 8 (ASNP V331X.sub.7), said sequence having an amino acid X.sub.7 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, K, L, N, Q, R, S, T, W and Y, more preferentially of C, D, E, G, F, N, R, S, T, W and Y, in particular of E, T and W;

[0206] a sequence having at least 80% identity with SEQ ID NO: 9 (ASNP D394X.sub.8), said sequence having an amino acid X.sub.8 representing an amino acid chosen from the group consisting of A, E, F, G, H, I, K and L, in particular of A and E;

[0207] a sequence having at least 80% identity with SEQ ID NO: 10 (ASNP R446X.sub.9), said sequence having an amino acid X.sub.9 representing an amino acid chosen from the group consisting of A, C, G, K, L, M, N, and S, in particular of A, N and M.

[0208] As shown in the examples, all the enzymes bearing one of these peptide sequences have a statistically higher, or even very much higher, capacity than that of the wild-type enzyme for glucosylating the hydroxylated synthons of the invention.

[0209] In addition, it may be advantageous to use some of the wild-type and/or mutant enzymes according to the invention according to the nature of the hydroxylated synthon used in a process of the invention.

[0210] Thus, in the case where the hydroxylated synthon used in a process of the invention is HEMA, certain enzymes may advantageously obtain only mono-glucosylated HEMAs, for instance an enzyme containing a sequence having at least 80% identity with SEQ ID NO: 13 (N.sub.123-GBD-CD2).

[0211] Furthermore, in the case where the hydroxylated synthon used in a process of the invention is HEMA, certain enzymes advantageously make it possible to obtain only mono-glucosylated HEMAs and di-glucosylated HEMAs, for instance the enzymes chosen from the group:

[0212] a sequence having at least 80% identity with SEQ ID NO: 4 (ASNP F229X.sub.3), said sequence having an amino acid X.sub.3 representing W;

[0213] a sequence having at least 80% identity with the sequence SEQ ID NO: 7 (ASNP I330X.sub.6), said sequence having an amino acid X.sub.6 representing A;

[0214] a sequence having at least 80% identity with SEQ ID NO: 8 (ASNP V331X.sub.7), said sequence having an amino acid X.sub.7 representing E;

[0215] a sequence having at least 80% identity with SEQ ID NO: 9 (ASNP D394X.sub.8), said sequence having an amino acid X.sub.8 representing A;

[0216] a sequence having at least 80% identity with SEQ ID NO: 14 (ASDg);

[0217] a sequence having at least 80% identity with SEQ ID NO: 12 (alpha-1,2 BrS); and

[0218] a sequence having at least 80% identity with SEQ ID NO: 16 (alpha-1,3 BrS).

[0219] Finally, in the case where the hydroxylated synthon used in a process of the invention is HEMA, certain enzymes advantageously make it possible to obtain a mixture of mono-glucosylated, di-glucosylated and tri-glucosylated HEMA, for instance the enzymes chosen from the group:

[0220] a sequence having at least 80% identity with SEQ ID NO: 1 (ASNP WT),

[0221] a sequence having at least 80% identity with the sequence SEQ ID NO: 6 (ASNP F290X.sub.5), said sequence having an amino acid X.sub.5 representing an amino acid chosen from the group consisting of A, C, I, K, L, M and V;

[0222] a sequence having at least 80% identity with SEQ ID NO: 10 (ASNP R446X.sub.9), said sequence having an amino acid X.sub.9 representing G; and

[0223] a sequence having at least 80% identity with SEQ ID NO: 17 (ASR-C-del-bis).

[0224] In particular, the enzymes chosen from the group:

[0225] a sequence having at least 80% identity with the sequence SEQ ID NO: 6 (ASNP F290X.sub.5), said sequence having an amino acid X.sub.5 representing A; and

[0226] a sequence having at least 80% identity with SEQ ID NO: 17 (ASR-C-del-bis);

[0227] advantageously make it possible to obtain a very similar proportion of mono-glucosylated HEMAs and of tri-glucosylated HEMAs.

[0228] Similarly, in the case where the hydroxylated synthon used in a process of the invention is NHAM, certain enzymes advantageously make it possible to obtain only mono-glucosylated NHAMs, for instance the enzymes chosen from the group:

[0229] a sequence having at least 80% identity with SEQ ID NO: 14 (ASDg);

[0230] a sequence having at least 80% identity with SEQ ID NO: 11 (DSR-S vardel4N-S512C); and

[0231] a sequence having at least 80% identity with SEQ ID NO: 15 (DSR-S-OK).

[0232] Furthermore, in the case where the hydroxylated synthon used in a process of the invention is NHAM, certain enzymes advantageously make it possible to obtain only mono-glucosylated NHAMs and di-glucosylated NHAMs, for instance the enzymes chosen from the group:

[0233] a sequence having at least 80% identity with SEQ ID NO: 1 (ASNP WT),

[0234] a sequence having at least 80% identity with SEQ ID NO: 4 (ASNP F229X.sub.3), said sequence having an amino acid X.sub.3 representing N;

[0235] a sequence having at least 80% identity with the sequence SEQ ID NO: 5 (ASNP A289X.sub.4), said sequence having an amino acid X.sub.4 representing an amino acid chosen from the group consisting of N, P and Q;

[0236] a sequence having at least 80% identity with the sequence SEQ ID NO: 7 (ASNP I330X.sub.6), said sequence having an amino acid X.sub.6 representing N;

[0237] a sequence having at least 80% identity with SEQ ID NO: 8 (ASNP V331X.sub.7), said sequence having an amino acid X.sub.7 representing T;

[0238] a sequence having at least 80% identity with SEQ ID NO: 9 (ASNP D394X.sub.8), said sequence having an amino acid X.sub.8 representing E;

[0239] a sequence having at least 80% identity with SEQ ID NO: 17 (ASR-C-del-bis);

[0240] a sequence having at least 80% identity with SEQ ID NO: 13 (N.sub.123-GBD-CD2); and

[0241] a sequence having at least 80% identity with SEQ ID NO: 16 (alpha-1,3 BrS).

[0242] Finally, in the case where the hydroxylated synthon used in a process of the invention is NHAM, certain enzymes advantageously make it possible to obtain a mixture of mono-glucosylated, di-glucosylated and tri-glucosylated NHAMs, for instance the enzymes chosen from the group:

[0243] a sequence having at least 80% identity with SEQ ID NO: 4 (ASNP F229X.sub.3), said sequence having an amino acid X.sub.3 representing M;

[0244] a sequence having at least 80% identity with SEQ ID NO: 8 (ASNP V331X.sub.7), said sequence having an amino acid X.sub.7 representing an amino acid chosen from the group consisting of C, D and E; and

[0245] a sequence having at least 80% identity with SEQ ID NO: 12 (alpha-1,2 BrS).

[0246] In addition, in the case where the hydroxylated synthon used in a process of the invention is NNHEA, certain enzymes advantageously make it possible to obtain only mono-glucosylated NNHEAs, for instance the enzymes chosen from the group:

[0247] a sequence having at least 80% identity with SEQ ID NO: 17 (ASR-C-del-bis); and

[0248] a sequence having at least 80% identity with SEQ ID NO: 16 (alpha-1,3 BrS).

[0249] When the hydroxylated synthon used in a process of the invention is NNHEA, other enzymes also make it possible advantageously to obtain only mono-glucosylated NNHEAs, namely:

[0250] a sequence having at least 80% identity with SEQ ID NO: 1 (ASNP WT),

[0251] a sequence having at least 80% identity with the sequence SEQ ID NO: 5 (ASNP A289X.sub.4), said sequence having an amino acid X.sub.4 representing Q;

[0252] a sequence having at least 80% identity with the sequence SEQ ID NO: 6 (ASNP F290X.sub.5), said sequence having an amino acid X.sub.5 representing an amino acid chosen from the group consisting of representing C, L and V; and

[0253] a sequence having at least 80% identity with SEQ ID NO: 12 (alpha-1,2 BrS).

[0254] It should be understood from these formulations that the amino acids defined as being, respectively, X.sub.1, X.sub.2, X.sub.3, X.sub.4, X.sub.5, X.sub.6, X.sub.7, X.sub.8 and X.sub.9 are present and as defined above in the glucan-saccharases of the invention having at least 80% identity with the sequence SEQ ID NO: 1.

[0255] The present invention also includes the sequences whose amino acid sequence has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% amino acid identity with one of the sequences SEQ ID NO: 1 to 18 as defined previously and biological activity of the same nature.

[0256] The term biological activity of the same nature as regards the peptide sequences 1 to 18 means the same capacity for glycosylating the hydroxylated synthons of the invention.

[0257] The percentage of identity between two nucleic acid or amino acid sequences, for the purposes of the present invention, is determined by comparing the two optimally aligned sequences, through a comparison window.

[0258] The part of the nucleotide sequence in the comparison window may thus comprise additions or deletions (for example gaps) relative to the reference sequence (which does not comprise these additions or these deletions) so as to obtain an optimal alignment between the two sequences.

[0259] The percentage of identity is calculated by determining the number of positions in which an identical nucleic base (or an identical amino acid) is observed for the two compared sequences, and then by dividing the number of positions in which there is identity between the two nucleic bases (or between the two amino acids) by the total number of positions in the comparison window, followed by multiplying the result by 100 so as to obtain the percentage of nucleotide (or amino acid) identity between the two sequences.

[0260] Optimal alignment of the sequences for the comparison may be achieved by computer-assisted means using known algorithms.

[0261] In an entirely preferred manner, the percentage of sequence identity is determined using the software CLUSTAL W (version 1.82), the parameters being set as follows: (1) CPU MODE=ClustalW mp; (2) ALIGNMENT=full; (3) OUTPUT FORMAT=aln w/numbers; (4) OUTPUT ORDER=aligned; (5) COLOR ALIGNMENT=no; (6) KTUP (word size)=default; (7) WINDOW LENGTH= default; (8) SCORE TYPE=percent; (9) TOPDIAG=default; (10) PAIRGAP= default; (11) PHYLOGENETIC TREE/TREE TYPE=none; (12) MATRIX= default; (13) GAP OPEN=default; (14) END GAPS=default; (15) GAP EXTENSION=default; (16) GAP DISTANCES=default; (17) TREE TYPE= cladogram and (18) TREE GRAP DISTANCES=hide.

[0262] More particularly, the present invention also relates to sequences whose amino acid sequence has 100% amino acid identity with amino acids 225 to 450 of sequences SEQ ID NO: 2 to 10 and at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% amino acid identity with the rest of the sequences SEQ ID NO: 2 to 10 as defined previously, and biological activity of the same nature.

[0263] The enzymes according to the invention make it possible to produce glycosylated synthons, or monomers, which may be mono- or poly-glycosylated.

[0264] Thus, as illustrated in the examples of the present patent application, the specificities of the various enzymes of the invention advantageously make it possible to tailor-make monomers of given structure.

[0265] By way of example, and as illustrated in the examples, and in particular in Table 3, when HEMA is glucosylated using the enzyme GBD-CD2, all of the monomers obtained are mono-glucosylated. In contrast, the use of the enzyme ASR in the presence of HEMA makes it possible to obtain a homogeneous distribution of mono-, di- and tri-glucosylated HEMA.

[0266] Hydroxylated Synthons and Implementations

[0267] a) Hydroxylated Synthons Used in an Enzymatic Glycosylation Process of the Invention

[0268] The hydroxylated synthons specifically used in an enzymatic process for manufacturing monomers of the invention are chosen from the compounds of formulae (I) to (VI).

[0269] Thus, according to a first aspect, the hydroxylated synthons of the invention may be compounds of formula (I): [0270] (i) (Meth)Acrylate/(Meth)Acrylamide Synthons of Formula (I):

##STR00012##

[0271] in which:

[0272] R.sub.1 represents a hydrogen atom or a C.sub.1-C.sub.3 alkyl;

[0273] R.sub.2 represents a C.sub.1-C.sub.20 alkylene group; or a group (C.sub.2H.sub.4O).sub.n, with n being an integer between 1 and 10; and

[0274] X.sub.1 represents (O), (NH), (S) or (NR.sub.2(OH)), preferably (O), (NH), or (NR.sub.2(OH)), with R.sub.2 representing a C.sub.1-C.sub.20 alkylene group; or a group (C.sub.2H.sub.4O).sub.m, with m being an integer between 1 and 10.

[0275] According to one embodiment, R.sub.1 represents a hydrogen atom.

[0276] According to another embodiment, R.sub.1 represents a C.sub.1-C.sub.3 alkyl, preferably a methyl.

[0277] According to one embodiment, R.sub.2 represents a C.sub.1-C.sub.20, in particular C.sub.1-C.sub.10 and especially C.sub.1 to C.sub.5 alkylene group. More particularly, R.sub.2 may be chosen from the group consisting of a methylene, an ethylene, a propylene, a butylene and a pentylene, and preferably represents a methylene or an ethylene.

[0278] According to one embodiment, X.sub.1 represents (O), (NH) or (NR.sub.2(OH)), preferably (O) or (NH). According to one embodiment, R.sub.2 represents a C.sub.1-C.sub.20, in particular C.sub.1-C.sub.10 and especially C.sub.1 to C.sub.5 alkylene group. More particularly, R.sub.2 may be chosen from the group consisting of a methylene, an ethylene, a propylene, a butylene and a pentylene, and preferably represents a methylene or an ethylene.

[0279] According to a particular embodiment, a synthon of formula (I) of the invention is such that:

[0280] R.sub.1 represents a hydrogen atom or a C.sub.1-C.sub.3 alkyl, preferably a hydrogen or a methyl;

[0281] R.sub.2 represents a C.sub.1-C.sub.20 alkyl group, preferably a C.sub.1-C.sub.10 and in particular C.sub.1-C.sub.5 alkylene, more particularly a methylene or an ethylene; and

[0282] X.sub.1 represents (O), (NH) or (NR.sub.2(OH)), preferably (O) or (NH).

[0283] According to a preferred embodiment, a synthon of formula (I) of the invention is such that:

[0284] X.sub.1 represents (O);

[0285] R.sub.1represents a hydrogen atom or a C.sub.1-C.sub.3 alkyl, preferably a C.sub.1-C.sub.3 alkyl, in particular a methyl; and

[0286] R.sub.2 represents a C.sub.1-C.sub.20 alkyl group, preferably a C.sub.1-C.sub.10 and in particular C.sub.1-C.sub.5 alkylene, more particularly a methylene or an ethylene, preferentially an ethylene.

[0287] Such a synthon of formula (I) may in particular be a 2-(hydroxy)ethyl methacrylate (HEMA):

##STR00013##

[0288] According to another preferred embodiment, a synthon of formula (I) of the invention is such that:

[0289] X.sub.1 represents (NH);

[0290] R.sub.1represents a hydrogen atom or a C.sub.1-C.sub.3 alkyl, preferably a hydrogen or a methyl; and

[0291] R.sub.2 represents a C.sub.1-C.sub.20 alkyl group, preferably a C.sub.1-C.sub.10 (and in particular C.sub.1-C.sub.5 alkylene, more particularly a methylene or an ethylene.

[0292] Such a synthon of formula (I) may in particular be an N-(hydroxy)methylacrylamide (NHAM) or an N-(hydroxy)ethylacrylamide (HEAA):

##STR00014##

[0293] According to another preferred embodiment, a synthon of formula (I) of the invention is such that:

[0294] X.sub.1 represents (NR.sub.2(OH)), in which R.sub.2 represents a C.sub.1-C.sub.20, in particular C.sub.1-C.sub.10 and especially C.sub.1 to C.sub.5 alkylene group, more particularly a methylene, an ethylene, a propylene, a butylene or a pentylene, preferably a methylene or an ethylene, plus preferentially an ethylene;

[0295] R.sub.1represents a hydrogen atom; and

[0296] R.sub.2 represents a C.sub.1-C.sub.20 alkyl group, preferably a C.sub.1-C.sub.10 and in particular C.sub.1-C.sub.5 alkylene, more particularly a methylene or an ethylene, especially an ethylene.

[0297] Such a synthon of formula (I) may in particular be an N,N-bis(2-hydroxyethyl)acrylamide (NNHEA):

##STR00015##

[0298] According to a particular embodiment, a synthon of the invention of formula (I) is chosen from 2-(hydroxy)ethyl methacrylate (HEMA), N-(hydroxy)methylacrylamide (NHAM), N-(hydroxy)ethylacrylamide (HEAA) and N,N-bis(2-hydroxyethyl)acrylamide (NNHEA), preferably from HEMA, NHAM and HEAA.

[0299] According to another aspect, the hydroxylated synthons of the invention may be compounds of formula (II):

##STR00016##

[0300] in which R.sub.3 represents a covalent bond; a C.sub.1-C.sub.20 alkylene group; or a group (C.sub.2H.sub.4O).sub.n, with n being an integer between 1 and 10.

[0301] Preferably, R.sub.3 represents a covalent bond or a C.sub.1-C.sub.20 alkylene group.

[0302] Such an alkylene group may in particular be of C.sub.1-C.sub.10, especially C.sub.1-C.sub.5. More particularly, R.sub.3 may be chosen from the group consisting of a methylene, an ethylene, a propylene, a butylene and a pentylene, and is preferably a methylene or an ethylene.

[0303] Thus, according to a particular embodiment, R.sub.3 represents a covalent bond, a methylene or an ethylene.

[0304] A synthon of formula (II) may in particular be a 4-vinylphenol (VP) or a 4-vinylbenzyl alcohol (VBA):

##STR00017##

[0305] According to another aspect, the hydroxylated synthons of the invention may be compounds of formula (III):

##STR00018##

[0306] in which R.sub.4 represents a covalent bond; a C.sub.1-C.sub.20 alkylene group; or a group (C.sub.2H40).sub.n, with n being an integer between 1 and 10.

[0307] Preferably, R.sub.4 represents a C.sub.1-C.sub.20, in particular C.sub.1-C.sub.10 and especially C.sub.1-C.sub.5 alkylene group. More particularly, R.sub.4 may be chosen from the group consisting of a methylene, an ethylene, a propylene, a butylene and a pentylene, and is preferably a methylene or an ethylene, more particularly a methylene.

[0308] A synthon of formula (III) may in particular be a 4-(hydroxy)methyloxazolidine-2,5-dione (HMNCA):

##STR00019##

[0309] According to another aspect, the hydroxylated synthons of the invention may be compounds of formula (IV):

##STR00020##

[0310] in which:

[0311] R.sub.5 represents a covalent bond; a C.sub.1-C.sub.20 alkylene group; or a group (C.sub.2H.sub.4O).sub.m, with m being an integer between 1 and 10;

[0312] n represents an integer between 1 and 20;

[0313] X.sub.2 represents (O), (NH) or (S); and

[0314] R.sub.6 represents a hydrogen or a C.sub.1-C.sub.20 alkyl group.

[0315] According to a preferred embodiment, X.sub.2 represents (O).

[0316] According to one embodiment, n is between 1 and 10, especially between 1 and 5. n is in particular chosen from 1, 2, 3, 4 and 5, and preferably represents the value 1 or 2.

[0317] Preferably, R.sub.5 represents a covalent bond or a C.sub.1-C.sub.10 and especially C.sub.1-C.sub.5 alkylene group. More particularly, the alkylene group may be chosen from the group consisting of a methylene, an ethylene, a propylene, a butylene and a pentylene, preferably a methylene or an ethylene, more particularly a methylene.

[0318] Thus, in a particularly preferred manner, R.sub.5 represents a covalent bond or a methylene.

[0319] According to one embodiment, R.sub.6 represents a hydrogen or a C.sub.1-C.sub.10 and especially C.sub.1-C.sub.5 alkyl group. More particularly, the alkyl group may be chosen from the group consisting of a methyl, an ethyl, a propyl, a butyl and a pentyl, preferably a methyl or an ethyl, more particularly a methyl.

[0320] Thus, in a particularly preferred manner, R.sub.6 represents a hydrogen or a methyl.

[0321] According to a particular embodiment, a compound of formula (IV) is such that:

[0322] R.sub.5 represents a C.sub.1-C.sub.10 and especially C.sub.1-C.sub.5 alkylene group, and is in particular a methylene;

[0323] n represents an integer between 1 and 5; and preferably represents the value 1 or 2, in particular the value 2;

[0324] X.sub.2 represents (O); and

[0325] R.sub.6 represents a hydrogen.

[0326] Such a synthon of formula (IV) may in particular be an -(hydroxy)methylcaprolactone (AHMCL):

##STR00021##

[0327] According to another particular embodiment, a compound of formula (IV) is such that:

[0328] R.sub.5 represents a covalent bond;

[0329] n represents an integer between 1 and 5; and preferably represents the value 1 or 2, in particular the value 1;

[0330] X.sub.2 represents (O); and

[0331] R.sub.6 represents a C.sub.1-C.sub.10 and especially C.sub.1-C.sub.5 alkyl group and is in particular a methyl.

[0332] Such a synthon of formula (IV) may in particular be a ()-mevalonolactone (MVL):

##STR00022##

[0333] According to a particular embodiment, a synthon of the invention of formula (IV) is chosen from cx-(hydroxy)methylcaprolactone (AHMCL) and ()-mevalonolactone (MVL).

[0334] According to another aspect, the hydroxylated synthons of the invention may be compounds of formula (V):

##STR00023##

[0335] in which R.sub.7 represents a C.sub.1-C.sub.20 alkylene group.

[0336] Preferably, R.sub.7 represents a C.sub.1-C.sub.10 and especially C.sub.1-C.sub.5 alkylene group. More particularly, R.sub.7 may be chosen from the group consisting of a methylene, an ethylene, a propylene, a butylene and a pentylene, preferably a methylene or an ethylene, more particularly an ethylene.

[0337] Such a synthon of formula (V) may in particular be a 2-mercaptoethanol (BME):

##STR00024##

[0338] According to another aspect, the hydroxylated synthons of the invention may be compounds of formula (VI):

##STR00025##

[0339] in which R.sub.8 represents a C.sub.1-C.sub.20 alkylene group.

[0340] Preferably, R.sub.8 represents a C.sub.1-C.sub.10 and especially C.sub.1-C.sub.5 alkylene group. More particularly, R.sub.8 may be chosen from the group consisting of a methylene, an ethylene, a propylene, a butylene and a pentylene, preferably a methylene or an ethylene, more particularly a methylene.

[0341] Such a synthon of formula (VI) may in particular be a 2-propen-1-ol (allyl alcohol):

##STR00026##

[0342] According to one embodiment, a synthon of the invention may be chosen from the group consisting of 2-(hydroxy)ethyl methacrylate (HEMA), N-(hydroxy)methylacrylamide (NHAM), N-(hydroxy)ethylacrylamide (HEAA), 4-vinylphenol (VP), 4-vinylbenzyl alcohol (VBA), 4-(hydroxy)methyloxazolidine-2,5-dione (HMNCA), -(hydroxy)methylcaprolactone (AHMCL), ()-mevalonolactone (MVL), 2-mercaptoethanol (BME), 2-propen-1-ol (allyl alcohol) and N,N-bis(2-hydroxyethyl)acrylamide (NNHEA).

[0343] A synthon according to the invention is in particular chosen from the group consisting of 2-(hydroxy)ethyl methacrylate (HEMA), N-(hydroxy)methylacrylamide (NHAM), N-(hydroxy)ethylacrylamide (HEAA), 4-vinylbenzyl alcohol (VBA), 2-propen

[0344] 1 -ol (allyl alcohol) and 2-mercaptoethanol (BME).

[0345] b) Glycosylated Synthons or Monomers

[0346] The enzymatic glycosylation of hydroxylated synthons, and in particular mono-hydroxylated synthons, of the invention is performed in the presence of sucrose.

[0347] In the present patent application, the terms glycosylated synthons and monomers are used interchangeably to denote the glycosylated synthons obtained on conclusion of the enzymatic process according to the invention for the glycosylation of hydroxylated synthons.

[0348] Thus, the synthons of the invention are more particularly glycosylated or fructosylated during the enzymatic glycosylation process according to the invention.

[0349] The process according to the invention for the manufacture of a glycosylated synthon, or monomer, of the invention may especially be performed under the conditions listed in example 1, point 1.3 below.

[0350] The monomers of the invention may be mono

[0351] or poly-glycosylated, as illustrated in the examples of the present patent application.

[0352] On conclusion of this glycosylation of the synthons of the invention, the enzyme may advantageously be inactivated. By way of illustration, this inactivation may be performed by thermal inactivation, for example at a temperature above 60 C., especially above 80 C., preferably above 90 C.

[0353] According to a particular embodiment, the reaction medium containing the glycosylated synthons according to the invention is concentrated by lyophilization, especially in anticipation of a subsequent purification step.

[0354] According to another embodiment, the reaction medium containing the glycosylated synthons according to the invention is not concentrated by lyophilization.

[0355] According to one embodiment, the glycosylated synthons according to the invention are purified after their preparation. This purification step, when it is performed, may take place after a step of inactivating the enzyme used and/or after a lyophilization step. Preferably, such a purification step takes place after a step of inactivating the enzyme, in the absence of a lyophilization step.

[0356] This purification step may advantageously also comprise a step of liquid/liquid extraction so as to remove the residual synthon.

Preferred Embodiments

[0357] In the case where the hydroxylated synthon used in the process of the invention is HEMA, the glycan-saccharase used may advantageously be chosen from the group comprising:

[0358] a sequence having at least 80% identity with SEQ ID NO: 1 (ASNP WT),

[0359] a sequence having at least 80% identity with SEQ ID NO: 2 (ASNP R.sub.226X.sub.1), said sequence having an amino acid X.sub.1 representing an amino acid chosen from the group consisting of A, C, N, P, S and T, preferably C;

[0360] a sequence having at least 80% identity with SEQ ID NO: 3 (ASNP I228X.sub.2), said sequence having an amino acid X.sub.2 representing an amino acid chosen from the group consisting of P, T and V, preferably T;

[0361] a sequence having at least 80% identity with SEQ ID NO: 4 (ASNP F229X.sub.3), said sequence having an amino acid X.sub.3 representing W;

[0362] a sequence having at least 80% identity with the sequence SEQ ID NO: 5 (ASNP A289X.sub.4), said sequence having an amino acid X.sub.4 representing H, I, K, L, M and W, preferably H and L;

[0363] a sequence having at least 80% identity with the sequence SEQ ID NO: 6 (ASNP F290X.sub.5), said sequence having an amino acid X.sub.5 representing an amino acid chosen from the group consisting of A, C, H, I, K, L, M, N, P, Q, V and W, preferably A, C, I, K, L, M, P and V, in particular A, C, I, K, L, M and V, and especially A, C, I, L and V;

[0364] a sequence having at least 80% identity with the sequence SEQ ID NO: 7 (ASNP I330X.sub.6), said sequence having an amino acid X.sub.6 representing A, C, E, F, G, H, K, L, M and N, preferably A;

[0365] a sequence having at least 80% identity with SEQ ID NO: 8 (ASNP V331X.sub.7), said sequence having an amino acid X.sub.7 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, K, L, M, in particular C, D, E, G, H, and especially E;

[0366] a sequence having at least 80% identity with SEQ ID NO: 9 (ASNP D394X.sub.8), said sequence having an amino acid X.sub.8 representing A, C, E, G, H, I, L, M and N, in particular A;

[0367] a sequence having at least 80% identity with SEQ ID NO: 10 (ASNP R446X.sub.9), said sequence having an amino acid X.sub.9 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, K, L, M and N, preferably C, G, K, L and N, especially N;

[0368] a sequence having at least 80% identity with SEQ ID NO: 12 (alpha-1,2 BrS);

[0369] a sequence having at least 80% identity with SEQ ID NO: 13 (N.sub.123-GBD-CD2);

[0370] a sequence having at least 80% identity with SEQ ID NO: 14 (ASDg);

[0371] a sequence having at least 80% identity with SEQ ID NO: 16 (alpha-1,3 BrS);

[0372] a sequence having at least 80% identity with SEQ ID NO: 17 (ASR-C-del-bis); and

[0373] a sequence having at least 80% identity with SEQ ID NO: 18 (fructosyltransferase of Bacillus subtilis).

[0374] In addition, in the case where the hydroxylated synthon used is NHAM, the glycan-saccharase used in a process of the invention may be chosen from the group comprising:

[0375] a sequence having at least 80% identity with SEQ ID NO: 1 (ASNP WT),

[0376] a sequence having at least 80% identity with SEQ ID NO: 2 (ASNP R.sub.226X.sub.1), said sequence having an amino acid X.sub.1 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, Q, S, T, V, W and Y;

[0377] a sequence having at least 80% identity with SEQ ID NO: 3 (ASNP I228X.sub.2), said sequence having an amino acid X.sub.2 representing an amino acid chosen from the group consisting of C, E, L, M, N, P, Q, R, T, V and Y;

[0378] a sequence having at least 80% identity with SEQ ID NO: 4 (ASNP F229X.sub.3), said sequence having an amino acid X.sub.3 representing an amino acid chosen from the group consisting of A, C, I, L, M, N, P, Q, V, W and Y, preferably M;

[0379] a sequence having at least 80% identity with the sequence SEQ ID NO: 5 (ASNP A289X.sub.4), said sequence having an amino acid X.sub.4 representing an amino acid chosen from the group consisting of C, D, E, F, G, H, I, L, M, N, P, Q, S, T and V, preferably N, P, Q, S, and V, especially N, P and Q;

[0380] a sequence having at least 80% identity with the sequence SEQ ID NO: 6 (ASNP F290X.sub.5), said sequence having an amino acid X.sub.5 representing an amino acid chosen from the group consisting of A, C, G, L, M, N, P, Q, V, W and Y;

[0381] a sequence having at least 80% identity with the sequence SEQ ID NO: 7 (ASNP I330X.sub.6), said sequence having an amino acid X.sub.6 representing an amino acid chosen from the group consisting of A, M, N and V, preferably N;

[0382] a sequence having at least 80% identity with SEQ ID NO: 8 (ASNP V331X.sub.7), said sequence having an amino acid X.sub.7 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T and Y, preferably C, D, E, N, and T, especially E;

[0383] a sequence having at least 80% identity with SEQ ID NO: 9 (ASNP D394X.sub.8), said sequence having an amino acid X.sub.8 representing an amino acid chosen from the group consisting of C, E, G and N, preferably E;

[0384] a sequence having at least 80% identity with SEQ ID NO: 10 (ASNP R446X.sub.9), said sequence having an amino acid X.sub.9 representing an amino acid chosen from the group consisting of A, C, F, G, K, L, M, N, Q, S, T and Y;

[0385] a sequence having at least 80% identity with SEQ ID NO: 11 (DSR-S vardel4N-S512C);

[0386] a sequence having at least 80% identity with SEQ ID NO: 12 (alpha-1,2 BrS);

[0387] a sequence having at least 80% identity with SEQ ID NO: 13 (N.sub.123-GBD-CD2);

[0388] a sequence having at least 80% identity with SEQ ID NO: 14 (ASDg);

[0389] a sequence having at least 80% identity with SEQ ID NO: 15 (DSR-S-OK);

[0390] a sequence having at least 80% identity with SEQ ID NO: 16 (alpha-1,3 BrS);

[0391] a sequence having at least 80% identity with SEQ ID NO: 17 (ASR-C-del-bis); and

[0392] a sequence having at least 80% identity with SEQ ID NO: 18 (fructosyltransferase of Bacillus subtilis).

[0393] According to a particular embodiment, a process for manufacturing a glycosylated synthon, or monomer, comprises at least one step of placing at least one glycan-saccharase in contact with at least 2-mercaptoethanol (BME) as hydroxylated synthon and at least one sucrose, in which the glycan-saccharase is chosen from the group comprising:

[0394] a sequence having at least 80% identity with SEQ ID NO: 1 (ASNP WT);

[0395] a sequence having at least 80% identity with SEQ ID NO: 3 (ASNP I228X.sub.2), said sequence having an amino acid X.sub.2 representing an amino acid chosen from the group consisting of A, E, F, H, L, M, N, Q, R, V, W and Y, preferably L, V, W and Y;

[0396] a sequence having at least 80% identity with SEQ ID NO: 4 (ASNP F229X.sub.3), said sequence having an amino acid X.sub.3 representing an amino acid chosen from the group consisting of A, C, I, L, M, P, Q, R, V, W and Y, preferably C, M, P, Q, V, W and Y, in particular C, M, P, V and Y, especially Y;

[0397] a sequence having at least 80% identity with the sequence SEQ ID NO: 5 (ASNP A289X.sub.4), said sequence having an amino acid X.sub.4 representing an amino acid chosen from the group consisting of C, D, E, F, G, H, I, M, N, P, Q, R, S, T, V and W, preferably C, D, E, F, M, N, P, Q, S, T, V and W, and especially F, M, N, P, Q, S and T;

[0398] a sequence having at least 80% identity with the sequence SEQ ID NO: 6 (ASNP F290X.sub.5), said sequence having an amino acid X.sub.5 representing an amino acid chosen from the group consisting of A, C, D, E, G, H, I, K, L, M, P, Q, R, S, T, V, W and Y, preferably A, C, D, E, G, I, M, P, Q, S, T, V and W, in particular D, Q, S, T and W, and especially S, T and W;

[0399] a sequence having at least 80% identity with the sequence SEQ ID NO: 7 (ASNP I330X.sub.6), said sequence having an amino acid X.sub.6 representing an amino acid chosen from the group consisting of A, N, Q, S, T, V and W, preferably Q and V;

[0400] a sequence having at least 80% identity with SEQ ID NO: 8 (ASNP V331X.sub.7), said sequence having an amino acid X.sub.7 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, K, L, N, Q, R, S, T, W and Y, preferably A, C, D, E, F, G, H, I, N, Q, R, S, T, W and Y, in particular C, D, E, F, N, R, S, T, W and Y, and especially E, T, and W;

[0401] a sequence having at least 80% identity with SEQ ID NO: 9 (ASNP D3943(.sub.8), said sequence having an amino acid X.sub.8 representing an amino acid chosen from the group consisting of A, E and S, preferably E;

[0402] a sequence having at least 80% identity with SEQ ID NO: 10 (ASNP R446X.sub.9), said sequence having an amino acid X.sub.9 representing an amino acid chosen from the group consisting of A, C, Q, S and T, preferably S;

[0403] a sequence having at least 80% identity with SEQ ID NO: 12 (alpha-1,2 BrS);

[0404] a sequence having at least 80% identity with SEQ ID NO: 13 (N.sub.123-GBD-CD2);

[0405] a sequence having at least 80% identity with SEQ ID NO: 14 (ASDg); and

[0406] a sequence having at least 80% identity with SEQ ID NO: 16 (alpha-1,3 BrS).

[0407] According to a particular embodiment, a process for manufacturing a glycosylated synthon, or monomer, comprises at least one step of placing at least one glycan-saccharase in contact with at least propen

[0408] 1 -ol (allyl alcohol) as hydroxylated synthon and at least one sucrose, in which the glycan-saccharase is chosen from the group comprising:

[0409] a sequence having at least 80% identity with SEQ ID NO: 1 (ASNP WT),

[0410] a sequence having at least 80% identity with SEQ ID NO: 2 (ASNP R.sub.226X.sub.1), said sequence having an amino acid X.sub.1 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V and Y;

[0411] a sequence having at least 80% identity with SEQ ID NO: 3 (ASNP I228X.sub.2), said sequence having an amino acid X.sub.2 representing an amino acid chosen from the group consisting of D, E, F, G, H, P, Q, R, S, T, V, W and Y, preferably H;

[0412] a sequence having at least 80% identity with SEQ ID NO: 4 (ASNP F229X.sub.3), said sequence having an amino acid X.sub.3 representing an amino acid chosen from the group consisting of C, D, E, G, H, I, K, L, M, P, Q, R, S, T, V, W and Y, preferably D, E, G, H, I, K and M, in particular D, E, G, I, K and M;

[0413] a sequence having at least 80% identity with the sequence SEQ ID NO: 5 (ASNP A289X.sub.4), said sequence having an amino acid X.sub.4 representing an amino acid chosen from the group consisting of C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W and Y, preferably C, D, E, F, G, H, I, K, L, M W and Y;

[0414] a sequence having at least 80% identity with the sequence SEQ ID NO: 6 (ASNP F290X.sub.5), said sequence having an amino acid X.sub.5 representing an amino acid chosen from the group consisting of A, C, D, E, G, H, I, K, L, M, P, Q, R, S, T, V, W and Y, preferably C, D, E, G, H, I, K, L, M and W, in particular C and H;

[0415] a sequence having at least 80% identity with the sequence SEQ ID NO: 7 (ASNP I330X.sub.6), said sequence having an amino acid X.sub.6 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W and Y, preferably C, D, E, F, G, H, K, L, M, S and Y, in particular C;

[0416] a sequence having at least 80% identity with SEQ ID NO: 8 (ASNP V331X.sub.7), said sequence having an amino acid X.sub.7 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W and Y, preferably C, D, E, F, G, H, I, K, L, N and W;

[0417] a sequence having at least 80% identity with SEQ ID NO: 9 (ASNP D394X.sub.8), said sequence having an amino acid X.sub.8 representing an amino acid chosen from the group consisting of A, C, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W and Y, preferably E, F, G, H, I, K and L, in particular E;

[0418] a sequence having at least 80% identity with SEQ ID NO: 10 (ASNP R446X.sub.9), said sequence having an amino acid X.sub.9 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, K, L, M, Q, S, T, V, W and Y, preferably M;

[0419] a sequence having at least 80% identity with SEQ ID NO: 12 (alpha-1,2 BrS);

[0420] a sequence having at least 80% identity with SEQ ID NO: 13 (N.sub.123-GBD-CD2);

[0421] a sequence having at least 80% identity with SEQ ID NO: 14 (ASDg);

[0422] a sequence having at least 80% identity with SEQ ID NO: 16 (alpha-1,3 BrS); and

[0423] a sequence having at least 80% identity with SEQ ID NO: 18 (fructosyltransferase of Bacillus subtilis).

[0424] According to a particular embodiment, a process for manufacturing a glycosylated synthon, or monomer, comprises at least one step of placing at least one glycan-saccharase in contact with at least VBA as hydroxylated synthon and at least one sucrose, in which the glycan-saccharase is chosen from the group comprising:

[0425] a sequence having at least 80% identity with SEQ ID NO: 1 (ASNP WT),

[0426] a sequence having at least 80% identity with SEQ ID NO: 2 (ASNP R.sub.226X.sub.1), said sequence having an amino acid X.sub.1 representing an amino acid chosen from the group consisting of H, K, M, N, Q, S, T, V and Y, in particular H, K, M, N, Q, S, T and V, preferably H, K, M, N, Q, T and V;

[0427] a sequence having at least 80% identity with SEQ ID NO: 3 (ASNP I228X.sub.2), said sequence having an amino acid X.sub.2 representing an amino acid chosen from the group consisting of V;

[0428] a sequence having at least 80% identity with the sequence SEQ ID NO: 5 (ASNP A289X.sub.4), said sequence having an amino acid X.sub.4 representing an amino acid chosen from the group consisting of M, N, P, Q, S, T and V, preferably M, N, P, Q, S and T, and especially P, Q and S;

[0429] a sequence having at least 80% identity with the sequence SEQ ID NO: 6 (ASNP F290X.sub.5), said sequence having an amino acid X.sub.5 representing an amino acid chosen from the group consisting of V and W;

[0430] a sequence having at least 80% identity with SEQ ID NO: 8 (ASNP V331X.sub.7), said sequence having an amino acid X.sub.7 representing an amino acid chosen from the group consisting of C, D, G, S, T and Y, preferably C, G, S, T and Y;

[0431] a sequence having at least 80% identity with SEQ ID NO: 10 (ASNP R446X.sub.9), said sequence having an amino acid X.sub.9 representing the amino acid A;

[0432] a sequence having at least 80% identity with SEQ ID NO: 12 (alpha-1,2 BrS); and

[0433] a sequence having at least 80% identity with SEQ ID NO: 17 (ASR-C-del-bis).

[0434] According to a particular embodiment, a process for manufacturing a glycosylated synthon, or monomer, comprises at least one step of placing at least one glycan-saccharase in contact with at least NNHEA as hydroxylated synthon and at least one sucrose, in which the glycan-saccharase is chosen from the group comprising:

[0435] a sequence having at least 80% identity with SEQ ID NO: 1 (ASNP WT),

[0436] a sequence having at least 80% identity with SEQ ID NO: 2 (ASNP R.sub.226X.sub.1), said sequence having an amino acid X.sub.1 representing an amino acid chosen from the group consisting of A, D, E, I, K, L, M, N, Q, S, T, V, W and Y;

[0437] a sequence having at least 80% identity with SEQ ID NO: 3 (ASNP I228X.sub.2), said sequence having an amino acid X.sub.2 representing an amino acid chosen from the group consisting of A, C, E, F, H, L, M, N, P, Q, S, T, V, W and Y, preferably V;

[0438] a sequence having at least 80% identity with SEQ ID NO: 4 (ASNP F229X.sub.3), said sequence having an amino acid X.sub.3 representing an amino acid chosen from the group consisting of C, I, L, M, N, Q, R, V, W and Y, preferably M;

[0439] a sequence having at least 80% identity with the sequence SEQ ID NO: 5 (ASNP A289X.sub.4), said sequence having an amino acid X.sub.4 representing an amino acid chosen from the group consisting of C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V and W, preferably C, G, M, N, Q, S, T and V, in particular Q;

[0440] a sequence having at least 80% identity with the sequence SEQ ID NO: 6 (ASNP F290X.sub.5), said sequence having an amino acid X.sub.5 representing an amino acid chosen from the group consisting of A, C, D, E, G, H, I, K, L, M, P, Q, R, S, T, V, W and Y, preferably A, C, G, I, K, L, M, Q, S, T, V and W, in particular C, L, V and W;

[0441] a sequence having at least 80% identity with the sequence SEQ ID NO: 7 (ASNP I330X.sub.6), said sequence having an amino acid X.sub.6 representing an amino acid chosen from the group consisting of C, K, M, Q, T, V and Y, preferably V;

[0442] a sequence having at least 80% identity with SEQ ID NO: 8 (ASNP V331X.sub.7), said sequence having an amino acid X.sub.7 representing an amino acid chosen from the group consisting of C, D, E, F, G, H, I, K, L, M, N, R, S, T, W and Y, preferably D, E, G, N, S, T and Y;

[0443] a sequence having at least 80% identity with SEQ ID NO: 9 (ASNP D394X.sub.8), said sequence having an amino acid X.sub.8 representing an amino acid chosen from the group consisting of E, G, R and S;

[0444] a sequence having at least 80% identity with SEQ ID NO: 10 (ASNP R446X.sub.9), said sequence having an amino acid X.sub.9 representing an amino acid chosen from the group consisting of C, F, G, K, L, M, N, Q, S, T and Y;

[0445] a sequence having at least 80% identity with SEQ ID NO: 16 (alpha-1,3 BrS); and

[0446] a sequence having at least 80% identity with SEQ ID NO: 17 (ASR-C-del-bis).

[0447] A sequence having at least 80% identity with SEQ ID NO: 12 (alpha-1,2 BrS) may also be used in a process for manufacturing a glycosylated synthon according to the invention when NNHEA is the hydroxylated synthon to be glycosylated, in particular to be glucosylated.

[0448] According to a particular embodiment, a process for manufacturing a glycosylated synthon, or monomer, comprises at least one step of placing at least one glycan-saccharase in contact with at least HEAA as hydroxylated synthon and at least one sucrose, in which the glycan-saccharase is chosen from the group comprising:

[0449] a sequence having at least 80% identity with SEQ ID NO: 9 (ASNP D394X.sub.8), said sequence having an amino acid X.sub.8 representing E;

[0450] a sequence having at least 80% identity with SEQ ID NO: 16 (alpha-1,3 BrS);

[0451] a sequence having at least 80% identity with SEQ ID NO: 17 (ASR-C-del-bis); and

[0452] a sequence having at least 80% identity with SEQ ID NO: 18 (fructosyltransferase of Bacillus subtilis).

[0453] Thus, the present invention more preferentially relates to a process for manufacturing a glycosylated synthon, or monomer, comprising at least one step of placing at least one glycan-saccharase in contact with at least one hydroxylated synthon and at least one sucrose, in which:

[0454] (i) the glycosylated synthon is HEMA and the glycan-saccharase used is chosen from the group comprising:

[0455] a sequence having at least 80% identity with SEQ ID NO: 1 (ASNP WT),

[0456] a sequence having at least 80% identity with SEQ ID NO: 2 (ASNP R.sub.226X.sub.1), said sequence having an amino acid X.sub.1 representing an amino acid chosen from the group consisting of A, C, N, P, S and T, preferably C;

[0457] a sequence having at least 80% identity with SEQ ID NO: 3 (ASNP I228X.sub.2), said sequence having an amino acid X.sub.2 representing an amino acid chosen from the group consisting of P, T and V, preferably T;

[0458] a sequence having at least 80% identity with SEQ ID NO: 4 (ASNP F229X.sub.3), said sequence having an amino acid X.sub.3 representing W;

[0459] a sequence having at least 80% identity with the sequence SEQ ID NO: 5 (ASNP A289X.sub.4), said sequence having an amino acid X.sub.4 representing H, I, K, L, M and W, preferably H and L;

[0460] a sequence having at least 80% identity with the sequence SEQ ID NO: 6 (ASNP F290X.sub.5), said sequence having an amino acid X.sub.5 representing an amino acid chosen from the group consisting of A, C, H, I, K, L, M, N, P, Q, V and W, preferably A, C, I, K, L, M, P and V, in particular A, C, I, K, L, M and V, and especially A, C, I, L and V;

[0461] a sequence having at least 80% identity with the sequence SEQ ID NO: 7 (ASNP I330X.sub.6), said sequence having an amino acid X.sub.6 representing A, C, E, F, G, H, K, L, M and N, preferably A;

[0462] a sequence having at least 80% identity with SEQ ID NO: 8 (ASNP V331X.sub.7), said sequence having an amino acid X.sub.7 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, K, L, M, in particular C, D, E, G, H, and especially E;

[0463] a sequence having at least 80% identity with SEQ ID NO: 9 (ASNP D394X.sub.8), said sequence having an amino acid X.sub.8 representing A, C, E, G, H, I, L, M and N, in particular A;

[0464] a sequence having at least 80% identity with SEQ ID NO: 10 (ASNP R446X.sub.9), said sequence having an amino acid X.sub.9 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, K, L, M and N, preferably C, G, K, L and N, especially N;

[0465] a sequence having at least 80% identity with SEQ ID NO: 12 (alpha-1,2 BrS);

[0466] a sequence having at least 80% identity with SEQ ID NO: 13 (N.sub.123-GBD-CD2);

[0467] a sequence having at least 80% identity with SEQ ID NO: 14 (ASDg);

[0468] a sequence having at least 80% identity with SEQ ID NO: 16 (alpha-1,3 BrS);

[0469] a sequence having at least 80% identity with SEQ ID NO: 17 (ASR-C-del-bis); and

[0470] a sequence having at least 80% identity with SEQ ID NO: 18 (fructosyltransferase of Bacillus subtilis);

[0471] (ii) the hydroxylated synthon is NHAM and the glycan-saccharase used in a process of the invention is chosen from the group comprising:

[0472] a sequence having at least 80% identity with SEQ ID NO: 1 (ASNP WT),

[0473] a sequence having at least 80% identity with SEQ ID NO: 2 (ASNP R.sub.226X.sub.1), said sequence having an amino acid X.sub.1 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, Q, S, T, V, W and Y;

[0474] a sequence having at least 80% identity with SEQ ID NO: 3 (ASNP I228X.sub.2), said sequence having an amino acid X.sub.2 representing an amino acid chosen from the group consisting of C, E, L, M, N, P, Q, R, T, V and Y;

[0475] a sequence having at least 80% identity with SEQ ID NO: 4 (ASNP F229X.sub.3), said sequence having an amino acid X.sub.3 representing an amino acid chosen from the group consisting of A, C, I, L, M, N, P, Q, V, W and Y, preferably M;

[0476] a sequence having at least 80% identity with the sequence SEQ ID NO: 5 (ASNP A289X.sub.4), said sequence having an amino acid X.sub.4 representing an amino acid chosen from the group consisting of C, D, E, F, G, H, I, L, M, N, P, Q, S, T and V, preferably N, P, Q, S, and V, especially N, P and Q;

[0477] a sequence having at least 80% identity with the sequence SEQ ID NO: 6 (ASNP F290X.sub.5), said sequence having an amino acid X.sub.5 representing an amino acid chosen from the group consisting of A, C, G, L, M, N, P, Q, V, W and Y;

[0478] a sequence having at least 80% identity with the sequence SEQ ID NO: 7 (ASNP I330X.sub.6), said sequence having an amino acid X.sub.6 representing an amino acid chosen from the group consisting of A, M, N and V, preferably N;

[0479] a sequence having at least 80% identity with SEQ ID NO: 8 (ASNP V331X.sub.7), said sequence having an amino acid X.sub.7 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T and Y, preferably C, D, E, N, and T, especially E;

[0480] a sequence having at least 80% identity with SEQ ID NO: 9 (ASNP D394X.sub.8), said sequence having an amino acid X.sub.8 representing an amino acid chosen from the group consisting of C, E, G and N, preferably E;

[0481] a sequence having at least 80% identity with SEQ ID NO: 10 (ASNP R446X.sub.9), said sequence having an amino acid X.sub.9 representing an amino acid chosen from the group consisting of A, C, F, G, K, L, M, N, Q, S, T and Y;

[0482] a sequence having at least 80% identity with SEQ ID NO: 11 (DSR-S vardel4N-S512C);

[0483] a sequence having at least 80% identity with SEQ ID NO: 12 (alpha-1,2 BrS);

[0484] a sequence having at least 80% identity with SEQ ID NO: 13 (N.sub.123-GBD-CD2);

[0485] a sequence having at least 80% identity with SEQ ID NO: 14 (ASDg);

[0486] a sequence having at least 80% identity with SEQ ID NO: 15 (DSR-S-OK);

[0487] a sequence having at least 80% identity with SEQ ID NO: 16 (alpha-1,3 BrS);

[0488] a sequence having at least 80% identity with SEQ ID NO: 17 (ASR-C-del-bis); and

[0489] a sequence having at least 80% identity with SEQ ID NO: 18 (fructosyltransferase of Bacillus subtilis);

[0490] (iii) the glycosylated synthon is 2-mercaptoethanol (BME) and the glycan-saccharase is chosen from the group comprising:

[0491] a sequence having at least 80% identity with SEQ ID NO: 1 (ASNP WT);

[0492] a sequence having at least 80% identity with SEQ ID NO: 3 (ASNP I228X.sub.2), said sequence having an amino acid X2 representing an amino acid chosen from the group consisting of A, E, F, H, L, M, N, Q, R, V, W and Y, preferably L, V, W and Y;

[0493] a sequence having at least 80% identity with SEQ ID NO: 4 (ASNP F229X.sub.3), said sequence having an amino acid X.sub.3 representing an amino acid chosen from the group consisting of A, C, I, L, M, P, Q, R, V, W and Y, preferably C, M, P, Q, V, W and Y, in particular C, M, P, V and Y, especially Y;

[0494] a sequence having at least 80% identity with the sequence SEQ ID NO: 5 (ASNP A289X.sub.4), said sequence having an amino acid X.sub.4 representing an amino acid chosen from the group consisting of C, D, E, F, G, H, I, M, N, P, Q, R, S, T, V and W, preferably C, D, E, F, M, N, P, Q, S, T, V and W, and especially F, M, N, P, Q, S and T;

[0495] a sequence having at least 80% identity with the sequence SEQ ID NO: 6 (ASNP F290X.sub.5), said sequence having an amino acid X.sub.5 representing an amino acid chosen from the group consisting of A, C, D, E, G, H, I, K, L, M, P, Q, R, S, T, V, W and Y, preferably A, C, D, E, G, I, M, P, Q, S, T, V and W, in particular D, Q, S, T and W, and especially S, T and W;

[0496] a sequence having at least 80% identity with the sequence SEQ ID NO: 7 (ASNP I330X.sub.6), said sequence having an amino acid X.sub.6 representing an amino acid chosen from the group consisting of A, N, Q, S, T, V and W, preferably Q and V;

[0497] a sequence having at least 80% identity with SEQ ID NO: 8 (ASNP V331X.sub.7), said sequence having an amino acid X.sub.7 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, K, L, N, Q, R, S, T, W and Y, preferably A, C, D, E, F, G, H, I, N, Q, R, S, T, W and Y, in particular C, D, E, F, N, R, S, T, W and Y, and especially E, T, and W;

[0498] a sequence having at least 80% identity with SEQ ID NO: 9 (ASNP D394X.sub.8), said sequence having an amino acid X.sub.8 representing an amino acid chosen from the group consisting of A, E and S, preferably E;

[0499] a sequence having at least 80% identity with SEQ ID NO: 10 (ASNP R446X.sub.9), said sequence having an amino acid X.sub.9 representing an amino acid chosen from the group consisting of A, C, Q, S and T, preferably S;

[0500] a sequence having at least 80% identity with SEQ ID NO: 12 (alpha-1,2 BrS);

[0501] a sequence having at least 80% identity with SEQ ID NO: 13 (N.sub.123-GBD-CD2);

[0502] a sequence having at least 80% identity with SEQ ID NO: 14 (ASDg); and

[0503] a sequence having at least 80% identity with SEQ ID NO: 16 (alpha-1,3 BrS);

[0504] (iv) the hydroxylated synthon is propen

[0505] 1 -ol (allyl alcohol) and the glycan-saccharase is chosen from the group comprising:

[0506] a sequence having at least 80% identity with SEQ ID NO: 1 (ASNP WT),

[0507] a sequence having at least 80% identity with SEQ ID NO: 2 (ASNP R.sub.226X.sub.1), said sequence having an amino acid X.sub.1 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V and Y;

[0508] a sequence having at least 80% identity with SEQ ID NO: 3 (ASNP I228X.sub.2), said sequence having an amino acid X.sub.2 representing an amino acid chosen from the group consisting of D, E, F, G, H, P, Q, R, S, T, V, W and Y, preferably H;

[0509] a sequence having at least 80% identity with SEQ ID NO: 4 (ASNP F229X.sub.3), said sequence having an amino acid X.sub.3 representing an amino acid chosen from the group consisting of C, D, E, G, H, I, K, L, M, P, Q, R, S, T, V, W and Y, preferably D, E, G, H, I, K and M, in particular D, E, G, I, K and M;

[0510] a sequence having at least 80% identity with the sequence SEQ ID NO: 5 (ASNP A289X.sub.4), said sequence having an amino acid X.sub.4 representing an amino acid chosen from the group consisting of C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W and Y, preferably C, D, E, F, G, H, I, K, L, M, W and Y;

[0511] a sequence having at least 80% identity with the sequence SEQ ID NO: 6 (ASNP F290X.sub.5), said sequence having an amino acid X.sub.5 representing an amino acid chosen from the group consisting of A, C, D, E, G, H, I, K, L, M, P, Q, R, S, T, V, W and Y, preferably C, D, E, G, H, I, K, L, M and W, in particular C and H;

[0512] a sequence having at least 80% identity with the sequence SEQ ID NO: 7 (ASNP I330X.sub.6), said sequence having an amino acid X.sub.6 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W and Y, preferably C, D, E, F, G, H, K, L, M, S and Y, in particular C;

[0513] a sequence having at least 80% identity with SEQ ID NO: 8 (ASNP V331X.sub.7), said sequence having an amino acid X.sub.7 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W and Y, preferably C, D, E, F, G, H, I, K, L, N and W;

[0514] a sequence having at least 80% identity with SEQ ID NO: 9 (ASNP D394X.sub.8), said sequence having an amino acid X.sub.8 representing an amino acid chosen from the group consisting of A, C, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W and Y, preferably E, F, G, H, I, K and L, in particular E;

[0515] a sequence having at least 80% identity with SEQ ID NO: 10 (ASNP R446X.sub.9), said sequence having an amino acid X.sub.9 representing an amino acid chosen from the group consisting of A, C, D, E, F, G, H, I, K, L, M, Q, S, T, V, W and Y, preferably M;

[0516] a sequence having at least 80% identity with SEQ ID NO: 12 (alpha-1,2 BrS);

[0517] a sequence having at least 80% identity with SEQ ID NO: 13 (N.sub.123-GBD-CD2);

[0518] a sequence having at least 80% identity with SEQ ID NO: 14 (ASDg);

[0519] a sequence having at least 80% identity with SEQ ID NO: 16 (alpha-1,3 BrS); and

[0520] a sequence having at least 80% identity with SEQ ID NO: 18 (fructosyltransferase of Bacillus subtilis);

[0521] (v) the glycosylated synthon is VBA and the glycan-saccharase is chosen from the group comprising:

[0522] a sequence having at least 80% identity with SEQ ID NO: 1 (ASNP WT),

[0523] a sequence having at least 80% identity with SEQ ID NO: 2 (ASNP R.sub.226X.sub.1), said sequence having an amino acid X.sub.1 representing an amino acid chosen from the group consisting of H, K, M, N, Q, S, T, V and Y, in particular H, K, M, N, Q, S, T and V, preferably H, K, M, N, Q, T and V;

[0524] a sequence having at least 80% identity with SEQ ID NO: 3 (ASNP I228X.sub.2), said sequence having an amino acid X.sub.2 representing an amino acid chosen from the group consisting of V;

[0525] a sequence having at least 80% identity with the sequence SEQ ID NO: 5 (ASNP A289X.sub.4), said sequence having an amino acid X.sub.4 representing an amino acid chosen from the group consisting of M, N, P, Q, S, T and V, preferably M, N, P, Q, S and T, and especially P, Q and S;

[0526] a sequence having at least 80% identity with the sequence SEQ ID NO: 6 (ASNP F290X.sub.5), said sequence having an amino acid X.sub.5 representing an amino acid chosen from the group consisting of V and W;

[0527] a sequence having at least 80% identity with SEQ ID NO: 8 (ASNP V331X.sub.7), said sequence having an amino acid X.sub.7 representing an amino acid chosen from the group consisting of C, D, G, S, T and Y, preferably C, G, S, T and Y;

[0528] a sequence having at least 80% identity with SEQ ID NO: 10 (ASNP R446X.sub.9), said sequence having an amino acid X.sub.9 representing the amino acid A;

[0529] a sequence having at least 80% identity with SEQ ID NO: 12 (alpha-1,2 BrS); and

[0530] a sequence having at least 80% identity with SEQ ID NO: 17 (ASR-C-del-bis); (vi) the glycosylated synthon is NNHEA and the glycan-saccharase is chosen from the group comprising:

[0531] a sequence having at least 80% identity with SEQ ID NO: 1 (ASNP WT),

[0532] a sequence having at least 80% identity with SEQ ID NO: 2 (ASNP R.sub.226X.sub.1), said sequence having an amino acid X.sub.1 representing an amino acid chosen from the group consisting of A, D, E, I, K, L, M, N, Q, S, T, V, W and Y;

[0533] a sequence having at least 80% identity with SEQ ID NO: 3 (ASNP I228X.sub.2), said sequence having an amino acid X.sub.2 representing an amino acid chosen from the group consisting of A, C, E, F, H, L, M, N, P, Q, S, T, V, W and Y, preferably V;

[0534] a sequence having at least 80% identity with SEQ ID NO: 4 (ASNP F229X.sub.3), said sequence having an amino acid X.sub.3 representing an amino acid chosen from the group consisting of C, I, L, M, N, Q, R, V, W and Y, preferably M;

[0535] a sequence having at least 80% identity with the sequence SEQ ID NO: 5 (ASNP A289X.sub.4), said sequence having an amino acid X.sub.4 representing an amino acid chosen from the group consisting of C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V and W, preferably C, G, M, N, Q, S, T and V, in particular Q;

[0536] a sequence having at least 80% identity with the sequence SEQ ID NO: 6 (ASNP F290X.sub.5), said sequence having an amino acid X.sub.5 representing an amino acid chosen from the group consisting of A, C, D, E, G, H, I, K, L, M, P, Q, R, S, T, V, W and Y, preferably A, C, G, I, K, L, M, Q, S, T, V and W, in particular C, L, V and W;

[0537] a sequence having at least 80% identity with the sequence SEQ ID NO: 7 (ASNP I330X.sub.6), said sequence having an amino acid X.sub.6 representing an amino acid chosen from the group consisting of C, K, M, Q, T, V and Y, preferably V;

[0538] a sequence having at least 80% identity with SEQ ID NO: 8 (ASNP V331X.sub.7), said sequence having an amino acid X.sub.7 representing an amino acid chosen from the group consisting of C, D, E, F, G, H, I, K, L, M, N, R, S, T, W and Y, preferably D, E, G, N, S, T and Y;

[0539] a sequence having at least 80% identity with SEQ ID NO: 9 (ASNP D394X.sub.8), said sequence having an amino acid X.sub.8 representing an amino acid chosen from the group consisting of E, G, R and S;

[0540] a sequence having at least 80% identity with SEQ ID NO: 10 (ASNP R446X.sub.9), said sequence having an amino acid X.sub.9 representing an amino acid chosen from the group consisting of C, F, G, K, L, M, N, Q, S, T and Y;

[0541] a sequence having at least 80% identity with SEQ ID NO: 12 (alpha-1,2 BrS);

[0542] a sequence having at least 80% identity with SEQ ID NO: 16 (alpha-1,3 BrS); and

[0543] a sequence having at least 80% identity with SEQ ID NO: 17 (ASR-C-del-bis); or

[0544] (vii) the glycosylated synthon is HEAA and the glycan-saccharase is chosen from the group comprising:

[0545] a sequence having at least 80% identity with SEQ ID NO: 9 (ASNP D394X.sub.8), said sequence having an amino acid X.sub.8 representing E;

[0546] a sequence having at least 80% identity with SEQ ID NO: 16 (alpha-1,3 BrS);

[0547] a sequence having at least 80% identity with SEQ ID NO: 17 (ASR-C-del-bis); and

[0548] a sequence having at least 80% identity with SEQ ID NO: 18 (fructosyltransferase of Bacillus subtilis).

[0549] c) Implementation of the Monomers of the Invention

[0550] The monomers of the invention are polymerizable and/or may be coupled via a coupling reaction, and may be used in a process for manufacturing a glyco(co)polymer according to the invention, comprising the polymerization and/or coupling reaction of at least two of these monomers.

[0551] A chemo-enzymatic process according to the invention is advantageous in many respects, especially such as the very short reaction time, making it possible, in the space of a few hours, especially in the space of 24 hours, to go from the hydroxylated synthons to the glyco(co)polymers of interest.

[0552] In addition, the determination by the inventors (i) of synthons with variable structures that are capable of being glycosylated in a process according to the invention and (ii) of enzymes with different specificities, allows the tailor-made production of glyco(co)polymers with great variability.

[0553] The polymerization and the coupling reaction according to the invention also make it possible to gain access to novel molecular architectures, such as comb or block (co)polymers, which may be evaluated for the development of novel materials of modifiable hydrophilic/hydrophobic balance.

[0554] Such a process may especially be performed under the conditions stated in example 6 below.

[0555] According to one embodiment, a process for manufacturing a glyco(co)polymer by polymerization according to the invention comprises, in the following order, the following steps:

[0556] a) polymerization of two monomers of the invention, making it possible to obtain a chain of two monomers;

[0557] b) polymerization of the monomer chain obtained on conclusion of the preceding step with a monomer of the invention; and then

[0558] c) one or more successive, and independent, steps consisting in polymerizing the monomer chain obtained on conclusion of the preceding step with a monomer of the invention.

[0559] According to one embodiment, such a polymerization process may also comprise, independently:

[0560] at least one step a) between steps a) and b);

[0561] at least one step b) between steps b) and c); and/or

[0562] at least one step c) after any one of the steps c),

[0563] in which the monomer chain obtained on conclusion of the preceding step is polymerized with at least one non-glycosylated synthon.

EXAMPLES

Example 1

Production and Use of Glucan-Saccharases for the Glucosylation of 2-(Hydroxy)ethyl Methacrylate (HEMA) and N-(Hydroxy)Methylacrylamide (NHAM)

[0564] A library comprising 8 wild-type enzymes (belonging to the glycoside-hydrolase families GH70 and 13) and 171 single mutants (positions 226, 228, 229, 289, 290, 330, 331, 394 and 446) constructed from the amylosaccharase of Neisseria polysaccharea (ASNp) (GH13 family) were tested for their ability to glucosylate HEMA and NHAM.

[0565] The glucan-saccharases selected for the study, and the origin thereof, are indicated in Table 1.

[0566] Table 1 in fact illustrates a certain number of glucan-saccharases tested in the examples of the present text and specifies: column 1: the organism from which the enzyme is derived; column 2: the various wild-type enzymes tested and also the mutated positions of the active site of these wild-type enzymes in the mutated glucan-saccharases also tested; column 3: the bibliographic references in which these enzymes, in both wild-type and mutated forms, were described in the prior art.

[0567] These enzymes were used in recombinant form and are expressed in Escherichia coli.

[0568] 1.1. Production of the Enzymes in Microplates

[0569] All of the strains of Escherichia coli, overexpressing the heterologous glucan-saccharases of the families GH13 and GH70, of wild type or mutants thereof (Table 1), are stored in 96-well microplate format in order to facilitate the future steps of screening for glucosylation of the hydroxylated synthons.

[0570] From the source microplates, preculturing of these E. coli strains is performed for 22 hours at 30 C., 700 rpm in 96-well microplates, in 200 L of Luria-Bertani culture medium supplemented with 100 g/mL of ampicillin.

[0571] These pre-cultures are in turn used to seed deep-well microplates, each well of which contains 1 mL per well of auto-inducible medium ZYM5052 especially containing 0.2% (w/v) of -lactose, 0.05% (w/v) of D-glucose, 0.5% (w/v) of glycerol and 0.05% (w/v) of L-arabinose (Studier et al., Protein Expr. Purif. 2005 May; 41(1): 207-34).

[0572] After culturing for 22 hours at 30 C. and at 700 rpm, the cell suspension is centrifuged for 20 minutes at 3000 g at 4 C. The cell pellets are resuspended in the 96-well deep-well microplates, with 300 L of phosphate-buffered saline (24 mM sodium/potassium phosphate and 274 mM NaCl) containing 0.5 g/L of lysozyme and 5 mg/L of bovine pancreatic RNAse.

[0573] This is followed by incubation for 30 minutes at 30 C. with stirring, and these microplates are then stored overnight at 80 C. After thawing, the microplates are shaken vigorously and then centrifuged for 20 minutes at 3000 g at 4 C.

[0574] The centrifuged supernatants containing the recombinant enzymes are transferred into clean 96-well deep-well microplates to perform the acceptor reactions.

[0575] 1.2. Test of Enzymatic Activity on Sucrose

[0576] Before performing the enzymatic glucosylation screening reactions, 50 L of the supernatants are used to perform an enzymatic activity test on sucrose.

[0577] The enzymatic activity is evaluated in microplate format at the end point after 30 minutes of incubation of 146 mM final of sucrose by assaying the reducing sugars with 3,5-dinitrosalicylic acid (DNS).

[0578] After twofold dilution in water, the absorbance is read at 540 nm.

[0579] 1.3. Conditions for Performing the Enzymatic Activity Tests on the Acceptors

[0580] For the screening of the bank of Neisseria polysaccharea amylosaccharase mutants, the acceptor reactions are performed in deep-well microplates in a volume of 300 L, in the presence of 73 mM of sucrose, 73 mM of acceptor (HEMA, NHAM or the like) at final concentrations and 150 L of centrifuged cell lyzate.

[0581] The microplates are incubated at 30 C. and at 700 rpm.

[0582] After reaction for 24 hours, the enzymes are denatured at 95 C. for 10 minutes. These microplates are stored at 20 C. for the purpose of rapid analysis of the glucosylation by HPLC/MS.

[0583] For the screening of the wild-type enzymes, the acceptor reactions are performed in tubes in a volume of 1 mL, in the presence of 146 mM of sucrose, 438 mM of acceptor (HEMA or NHAM) at final concentrations of 1 U/mL of enzymatic activity.

[0584] The tubes are incubated at 30 C. and shaken at 500 rpm.

[0585] After reaction for 24 hours, the enzymes are denatured at 95 C. for 10 minutes and the reaction media are centrifuged, filtered, diluted and analyzed by LC/MS.

[0586] 1.4. LC and LC/MS Analytical Methods for the Acceptor Reaction Products

[0587] Analysis of the acceptor reactions is performed in two stages.

[0588] A first short HPLC analysis on a Hypercarb column (6 minutes) is performed to identify the presence or absence of glucosylation products.

[0589] The second HPLC analysis on a Hypercarb or Amino column (30 minutes) allows separation and identification of all the constituents of the reaction mixture.

[0590] In the case of an LC-MS analysis, the Dionex HPLC system is coupled to a ThermoScientific MSQP1us single quadrupole mass spectrometer.

[0591] The conditions used are summarized in Table 2.

[0592] The amount of glycosylation products (in g/L) was estimated on the basis of the coefficient of response of the acceptor in UV detection.

Example 2

Determination of the Efficiencies of HEMA and NHAM Glucosylation by the Enzymes of Example 1

[0593] The reactions in the presence of acceptor were performed by applying the conditions described in example 1.

[0594] In a first stage, these acceptor reactions were performed with a panel of seven wild-type glycan-saccharases of different specificities, these enzymes being indicated in Table 1, namely: ASDg, ASR, GBD-CD2, DSR-S-4N, DSR-OK, -1,2-BrS and -1,3-BrS.

[0595] After reaction for 24 hours, the reaction medium is analyzed by HPLC-MS on a Hypercarb column (30 minutes) to identify the glucosylation products.

[0596] Tables 3 and 4 show the degree of conversion of sucrose and the three main glucosylation products obtained in the presence, respectively, of HEMA and of NHAM in g/L, characterized by MS and corresponding, respectively, to the mono-glucosylated acceptor (Acceptor-Glc1), di-glucosylated acceptor (Acceptor-Glc2) and tri-glucosylated acceptor (Acceptor-Glc3). Products in smaller amounts are also detected, corresponding to tetra-, penta-, hexa- and hepta-glucosylated forms.

[0597] Given the presence of only one reactive hydroxyl group on the molecule, only one type of mono-glycosylation of the molecule is expected, and thus the same mono-glucosylated product irrespective of the enzyme.

[0598] On the other hand, the structure of the di-and tri-glucosylated products may differ as a function of the specificity of the enzyme, and the structure of the products will be able to be determined unambiguously only by NMR analysis.

[0599] Glucosylation Results

[0600] With the exception of DSR-S-4N and DSR-OK, which do not recognize HEMA, all the wild-type glycan-saccharases tested glucosylate the acceptors HEMA and NHAM with variable efficiencies and variable glucosylation product sizes.

[0601] HEMA Glucosylation Results

[0602] The reactions performed in the presence of the enzymes ASR and ASDg led to particularly high degrees of sucrose conversion (95%) accompanied by the production of glucosylated acceptor products ranging from 2.7 to 21 g/L.

[0603] Among these enzymes, ASR synthesizes a significantly higher level of glucosylated HEMA (21 g/L). With ASR, the products formed are distributed in equivalent proportions between the mono-, di- and tri-glucosylated forms of HEMA.

[0604] It is also observed that the use of the enzyme GBD-CD2 leads only to mono-glucosylated HEMAs. Thus, the use of this enzyme advantageously makes it possible to obtain only mono-glucosylated HEMAs.

[0605] In this sense, it is observed that the use of the enzymes -1,2-BrS and -1,3-BrS, also show a very high degree of sucrose conversion (93% and 84%, respectively), leads mainly to the production of mono-glucosylated HEMAs.

[0606] NHAM Glucosylation Results

[0607] All the glycan-saccharases prove to be capable of recognizing NHAM and of glucosylating it, but in proportions 2.5 to 5 times lower than the levels observed for HEMA.

[0608] The enzymes GBD-CD2, -1,2-BrS and -1,3-BrS are the greatest producers of glucosylated NHAM with levels of the order of 2 g/L.

[0609] The mono-glucosylated form of NHAM remains the product observed in the largest amount.

Example 3

Determination of the Efficiencies of HEMA and NHAM Glucosylation with N. Polvsaccharea Amylosaccharase (ASNp) and with its Mutants

[0610] HEMA and NHAM were then tested in an acceptor reaction using Neisseria polysaccharea amylosaccharase (ASNP) and its bank of mono-mutants identified in Table 1.

[0611] The glucosylation reactions performed in the presence of acceptor were analyzed in a first stage using a short HPLC method (6 minutes) for the purpose of rapidly identifying the enzymes that are efficient in the glucosylation of the acceptor.

[0612] The results obtained for HEMA are summarized in Table 5. The values given represent the productions in g/L calculated from the relative areas derived from the detection by ELSD of the HEMA glucosylation products relative to the wild-type enzyme (the relative area of which is 1).

[0613] The results obtained for NHAM are summarized in Table 6. The amount of the glycosylation products (in g/L) was estimated on the basis of the coefficient of response of the acceptor in UV detection.

[0614] HEMA Glucosvlation Results

[0615] The wild-type enzyme ASNp and 69 mono-mutated enzymes proved to be capable of glucosylating HEMA, as represented in Table 5.

[0616] More particularly, 25 mutants were seen to glucosylate HEMA more efficiently than the parent wild-type enzyme, namely R.sub.226C, I228T, F229W, A289H, A289L, F290A, F290C, F290I, F290K, F290L, F290M, F290P, F290V, I330A, V331C, V331D, V331E, V331G, V331H, D394A, R446C, R446G, R446K, R446L and R446N, and especially the mutants F290A, F290C, F290I, F290K, F290L, F290M, F290V, I330A, V331E, D394A and R446N, in particular F290A, F290C, F290I, F290L, F290V and I330A.

[0617] Among these mutants, those targeting position 290 proved to be the most efficient in terms of HEMA glucosylation.

[0618] NHAM Glucosvlation Results

[0619] The wild-type enzyme ASNp and 103 mono-mutated enzymes proved to be capable of glucosylating NHAM, as represented in Table 6.

[0620] More particularly, 13 mutants were seen to glucosylate NHAM at least as efficiently as the parent wild-type enzyme, namely F229M, A289N, A289P, A289Q, A289S, A289V, I330N, V331C, V331D, V331E, V331N, V331T and D394E.

[0621] In particular, 11 of them were seen to glucosylate NHAM more efficiently than the parent wild-type enzyme, namely F229M, A289N, A289P, A289Q, I330N, V331C, V331D, V331E, V331N, V331T and D394E, and especially the mutants F229M, V331E and D394E.

Example 4

Study of the HEMA and NHAM Glucosylation Products of Example 3

[0622] Following the screening, a certain number of mutants tested in Example 3 were analyzed more finely by LC-MS (UV.sub.210 detection for HEMA, UV.sub.215 detection for NHAM), according to the protocol indicated in example I so as to analyze the glucosylation products obtained.

[0623] Thus, HEMA was glucosylated with the enzymes described in Table 7, resulting from the screening presented in example 3. Mono-, di- and/or tri-glucosylated HEMA compounds were thus obtained.

[0624] In other similar tests, tetra-glucosylated HEMA compounds, or even HEMA compounds glucosylated up to 10 times, were also obtained.

[0625] As regards NHAM, it was glucosylated with the enzymes described in Table 8, resulting from the screening presented in example 3. Mono-, di- and/or tri-glucosylated NHAM compounds were thus obtained.

Example 5

Gram-Scale Production of HEMA and NHAM Glucosvlation Products Using the Selected Enzymes

[0626] 1. Gram-Scale Production

[0627] Using the most efficient glycan-saccharases identified, ASR and -1,3-BrS, and also the mono-mutants F290C and D394E of ASNp, batches of glucosylated HEMA and of glucosylated NHAM were produced at the gram scale in order to perform the polymerization tests.

[0628] The reactions are performed in a final volume of 500 mL, in the presence of 143 mM of sucrose, 438 mM of acceptors and 1 U/mL of enzyme. After total consumption of the sucrose, the enzyme is deactivated at 95 C. and the reaction medium is concentrated by lyophilization for a subsequent purification step.

[0629] The estimated production levels are given in Table 9.

[0630] 2. Purification of the Glucosvlation Products

[0631] The object of the purification is to remove the residual sugars.

[0632] The purification is performed by flash chromatography on a Reveleris C18 column of 80 g to 120 g (Alltech, Epernon, France) using a water/acetonitrile gradient.

Example 6

Implementation of the Polymerization Reactions Using the Glucosylated HEMAs

[0633] Mixtures of glycosylated monomers were polymerized. Typically, the radical polymerization of a 61/18/21 HEMA-Glc/HEMA-(Glc)2/HEMA-(Glc)3 molar mixture was performed.

[0634] Controlled radical polymerization techniques such as ATRP (atom-transfer radical polymerization) and RAFT (reversible addition fragmentation transfer) were favored.

[0635] A typical ATRP polymerization proceeds as follows.

[0636] 4-(Bromomethyl)benzoic acid (polymerization initiator, 10.7 mg, 50 mol, 1 eq.) is poured into 10 mL of water (milliQ) and aqueous NaOH solution (0.5 mL, 0.1 M) is added. The mixture is stirred until dissolution is complete.

[0637] The solution is then degassed by sparging with argon, and bipyridine (ligand, 15.7 mg, 100 mol, 2 eq.) and CuIBr (catalyst, 7.1 mg, 50 mol, 1 eq.) are added in this order. 20 mL of a degassed solution of the mixture of glucosylated HEMA monomers are added (0.78 g, 2.0 mmol, 40 eq.).

[0638] The polymerization then proceeds for 8 hours at room temperature.

[0639] The reaction is stopped by air oxidation of the CuI to CuII (the solution changes from brown to blue). The solution is then passed through a column of silica to remove the Cull. The reaction medium is then lyophilized to recover the polymer in the form of a white powder.

[0640] The polymerization yield is generally greater than 90%.

Example 7

Implementation of the Glucosylation Method on 2-Propenol (Allyl Alcohol) and on 2-Mercaptoethanol (BME)

[0641] Glucosvlation of Allyl Alcohol and BME

[0642] The process described in the preceding examples was used in order to glucosylate other hydroxylated synthons suitable for use in the invention in order to perform coupling reactions.

[0643] Thus, 2-propenol (allyl alcohol) and 2-mercaptoethanol (BME) were tested in the same protocol described above using the wild-type and mutated glycan-saccharases previously used with HEMA and NHAM.

[0644] Results

[0645] The results relating to allyl alcohol are presented in Tables 10 and 12. The results relating to BME are presented in Tables 11 and 13.

[0646] The results indicate that four of the wild-type enzymes tested are capable of glycosylating the acceptor molecules, namely ASDg, GBD-CD2, -1,2-BrS and -1,3-BrS.

[0647] In a similar manner to what was observed for HEMA and NHAM, we observe that -1,2-BrS and -1,3-BrS are the most efficient enzymes for performing the glucosylation of these two acceptors.

[0648] In addition, the wild-type ASNp and the very large majority of the mutants tested prove to be capable of glucosylating 2-propenol, as illustrated in Table 12.

[0649] More particularly, 60 mutants were seen to glucosylate allyl alcohol at least as efficiently as the parent wild-type enzyme, namely I228H, F229D, F229E, F229G, F229H, F229I, F229K, F229M, A289C, A289D, A289E, A289F, A289G, A289H, A289I, A289K, A289L, A289M, A289W, A289Y, F290C, F290D, F290E, F290G, F290H, F290I, F290K, F290L, F290M, F290W, I330C, I330D, I330E, I330F, I330G, I330H, I330K, I330L, I330M, I330S, I330Y, V331C, V331D, V331E, V331F, V331G, V331H, V331I, V331K, V331L, V331N, V331W, D394E, D394F, D394G, D394H, D3941, D394K, D394L and R446M.

[0650] In particular, with the exception of F229H, all these mono-mutants were seen to glucosylate allyl alcohol more efficiently than the parent wild-type enzyme, and especially F290C, F290H, I330C, D394E and R446M.

[0651] The wild-type ASNp and 89 mono-mutants also prove to be capable of glucosylating BME, as illustrated in Table 13.

[0652] More particularly, 59 mutants were seen to glucosylate BME at least as efficiently as the parent wild-type enzyme, namely:

[0653] I228L, I228V, I228W, I228Y, F229C, F229M, F229P, F229Q, F229V, F229Y, A289C, A289D, A289E, A289F, A289G, A289H, A289I, A289M, A289N, A289P, A289Q, A289R, A289S, A289T, A289V, A289W, F290A, F290C, F290D, F290E, F290G, F290I, F290K, F290M, F290P, F290Q, F290S, F290T, F290V, F290W, I330Q, I330V, V331A, V331C, V331D, V331E, V331F, V331G, V331H, V331I, V331N, V331Q, V331R, V331S, V331T, V331W, V331Y, D394E and R446S.

[0654] In particular, 57 of them were seen to glucosylate BME more efficiently than the parent wild-type enzyme, namely:

[0655] I228L, I228V, I228W, I228Y, F229C, F229M, F229P, F229V, F229Y, A289C, A289D, A289E, A289F, A289G, A289H, A289I, A289M, A289N, A289P, A289Q, A289R, A289S, A289T, A289V, A289W, F290A, F290C, F290D, F290E, F290G, F290I, F290M, F290P, F290Q, F290S, F290T, F290V, F290W, I330Q, I330V, V331A, V331C, V331D, V331E, V331F, V331G, V331H, V3311, V331N, V331Q, V331R, V331S, V331T, V331W, V331Y, D394E and R446S, and in particular F229Y, A289C, A289D, A289E, A289F, A289M, A289N, A289P, A289Q, A289S, A289T, A289V, A289W, F290D, F290Q, F290S, F290T, F290W, V331C, V331D, V331E, V331F, V331N, V331R, V331S, V331T, V331W and V331Y, and especially A289F, A289M, A289N, A289P, A289Q, A289S, A289T, F290S, F290T, F290W, V331E, V331T and V331W.

Example 8

Determination of the Efficiencies of Glucosylation of 4-Vinylbenzyl Alcohol (VBA) with N, Polysaccharea Amylosaccharase (ASNp), with its Mutants and with Certain Enzymes of Example 1

[0656] VBA was tested in an acceptor reaction using Neisseria polysaccharea amylosaccharase (ASNp), its bank of mono-mutants identified in Table 1, as described in example 3, and also using -1,2-BrS and ASR.

[0657] The results obtained for VBA with the enzymes -1,2-BrS and ASR are represented in Table 14, while the results obtained for VBA with ASNP and its mono-mutants are summarized in Table 15.

[0658] VBA Glucosvlation Results

[0659] Firstly, it is observed that the enzymes -1,2-BrS and ASR can glucosylate VBA.

[0660] In addition, VBA may be glucosylated with wild-type ASNp, and also with 26 of its tested mono-mutants, namely: R226H, R226K, R226M, R226N, R226Q, R226S, R226T, R226V, R226Y, I228V, A289M, A289N, A289P, A289Q, A289S, A289T, A289V, F290V, F290W, V331C, V331D, V331G, V331S, V331T, V331Y and R446A.

[0661] In particular, all these mono-mutants, with the exception of R226S, were seen to glucosylate VBA more efficiently than the parent wild-type enzyme, and especially A289M, A289N, A289P, A289Q, A289S, A289T, V331C, V331G, V331S, V331T, V331Y and R446A, in particular A289P, A289Q, A289S and R446A.

Example 9

Determination of the Efficiencies of Glucosylation of N,N-bis(2-Hydroxyethyl)Acrylamide (NNHEA) with N. polysaccharea Amylosaccharase (ASNp), with its Mutants and with Certain Enzymes of Example 1

[0662] NNHEA was tested in an acceptor reaction using Neisseria polysaccharea amylosaccharase (ASNp), its bank of mono-mutants identified in Table 1, as described in example 3, and also using -1,2-BrS, -1,3-BrS and ASR.

[0663] The results obtained for NNHEA with the enzymes -1,2-BrS, -1,3-BrS and ASR are represented in Table 16, while the results obtained for NNHEA with ASNp and its mono-mutants are summarized in Table 17.

[0664] NNHEA Glucosvlation Results

[0665] Firstly, it is observed that the enzymes -1,2-BrS, -1,3-BrS and ASR can glucosylate NNHEA and lead solely to the production of mono-glucosylated NNHEAs. Traces of di-glucosylated NNHEA were also detected.

[0666] For the purposes of the invention, the term traces of a compound means that this compound is present in a sample in an amount sufficient to be detected by a measuring method such as that used in the present examples, but in an amount that is too low to be able to be measured.

[0667] Similarly, the value 0 indicated in the tables of the present document means that the compound concerned is either absent or present in an amount that is so low that it cannot be detected by a measuring method such as that used in the present examples.

[0668] In addition, NNHEA can be glucosylated with wild-type ASNp, and also with 113 of its tested mono-mutants, as illustrated in Table 17.

[0669] In particular, 30 of them were seen to glucosylate NNHEA more efficiently than the parent wild-type enzyme, namely:

[0670] I228V, F229M, A289C, A289G, A289M, A289N, A289Q, A289S, A289T, A289V, F290A, F290C, F290G, F290I, F290K, F290L, F290M, F290Q, F290S, F290T, F290V, F290W, I330V, V331D, V331 E, V331G, V331N, V331S, V331T and V331Y.

Example 10

Glycosylation of Acceptors Catalyzed with a Fructosyltransferase

[0671] In order to vary the nature of the sugar transferred onto the acceptors, the potential of a commercial fructosyltransferase was evaluated on HEMA, NHAM and HEAA (N-(hydro)ethylacrylamide), under conditions similar to those used previously with the glucan-saccharases.

[0672] These acceptors were thus fructosylated with Bacillus subtilis fructosyltransferase (see Table 1).

[0673] Results

[0674] The chromatograms obtained on Hypercarb and Amino columns, as described previously, after a fructosylation reaction using B. Subtilis fructosyltransferase, made it possible to observe fructosylation of all the tested acceptors.

[0675] More particularly, the total fructosylation observed is 32.5 mg/L for HEMA, 84.8 mg/L for HEAA and 21.1 mg/L for NHAM.

[0676] More particularly, whereas only mono-fructosylated HEMAs and NHAMs were obtained. HEAA was fructosylated 1, 4, 5, 6 and even 7 times. Insofar as these acceptors bear only one reactive hydroxyl group, only one type of each level of fructosylation of these molecules is obtained.

[0677] In addition, the sucrose consumption of the fructosyltransferase used and the levels of production (in g/L) of the fructosylated acceptors tested were measured.

[0678] It is observed that, in all the cases, more than 98% of the sucrose was consumed by the enzyme. In addition, the fructosylated HEAA production observed is 3 to 4 times higher than that observed with NHAM and HEMA.

Example 11

Study of the NNHEA Glucosylation Products of Example 9

[0679] The glucosylation products obtained in example 9 with some of the enzymes tested were analyzed more finely by LC-MS (UV.sub.204 detection for NNHEA), according to the protocol indicated in example 1.

[0680] The results thus obtained are represented in Table 18.

[0681] Thus, NNHEA was very predominantly and exclusively mono-glucosylated by the enzymes tested, in particular by wild-type ASNp and its mutants A289Q, F290C, F290L and F290V, Traces of di-glucosylated NNHEA were also detected with the mono-mutants F290C, F290L and F290V.

[0682] The mutant F290W, for its part, made it possible to obtain both mono-glucosylated NNHEAs and di-glucosylated NNHEAs.

Example 12

Determination of the Efficiencies of Glucosylation of HEAA by Certain Enzymes of Example 1

[0683] The reactions in the presence of HEAA were performed by applying the conditions described in example 1.

[0684] These acceptor reactions were performed with a panel of three wild-type glycan-saccharases, namely: ASR, -1,3-BrS and fructosyltransferase of Bacillus subtilis indicated in Table I.

[0685] One of the mono-mutants of the wild-type ASNp, the mono-mutant D394E, was also tested.

[0686] After reaction for 24 hours, the reaction medium is analyzed by HPLC-MS on a Hypercarb column (30 minutes) to identify the glucosylation products.

[0687] Table 19 shows the degree of sucrose conversion and the total glucosylation for each of these enzymes.

[0688] In addition, the glucosylation products obtained with ASR, -1,3-BrS and the mono-mutant D394E of ASNp were analyzed more finely by LC-MS (UV.sub.215 detection for HEAA), according to the protocol indicated in the preceding examples. The results obtained are indicated in Table 20.

[0689] Thus, ASR makes it possible to obtain mono-glycosylated HEAAs, di-glucosylated HEAAs and tri-glucosylated HEAAs.

[0690] In other similar experiments performed by the inventors, HEAAs glucosylated 4, 5, 6, 7 or 8 times were also able to be observed.

[0691] Conversely, -1,3-BrS and the mono-mutant D394E of the wild-type ASNp make it possible to obtain only mono-glucosylated HEAAs. Only traces of di-glucosylated HEAAs were observed with these two enzymes.

TABLE-US-00001 TABLE 1 Organism Glycan-saccharase References Neisseria polysaccharea ASNp WT and 171 single Potocki de Montalk et al, J. (EC 2.4.1.4) mutants of the active site of Bacteriology. 1999, 181, (Positions 226, 228, 229, 289, 375-381 290, 330, 331, 394, 446) Champion E., 2008. Doctoral Glucan-saccharases thesis. INSA. Toulouse Champion C. et al., J. Am. Chem. Soc., 2009, 131, 7379-7389 Cambon E. et al., Biotechnol. Bioeng. 2014 Sep.; 111(9): 1719-28 Deinococcus geothermalis ASDg WT Emond et al., FEMS Glucan-saccharase Microbiol. Lett. 2008 Aug.; 285(1): 25-32 Leuconostoc mesesnteroides Truncated altemane- Joucla. G., 2003. Doctoral NRRL B-1355 saccharase (ASR-C-del-bis or thesis, INSA. Toulouse ASR) Joucla et al., FEBS Lett. 2006 Glucan-saccharase Feb. 6; 580(3): 763-8 Leuconostoc mesesnteroides Truncated dextran-saccharase Moulis C., 2006. Doctoral B-512F DSR-S vardel 4N (DSR-S- thesis, INSA. Toulouse 4N) Moulis C. et al., FEMS Glucan-saccharase Microbiol. Lett., 2006 261 203-210 Leuconostoc mesesnteroides Truncated dextran-sucrase WO/2002/074943 NRRL B-1299 DSR-E (GBD-CD2) Brison et al, J. Biol. Chem., Glucan-saccharase 2012. 287, 7915-24 Oenococcus kitaharae Dextran-saccharase FR1301402 DSM17330 (DSR-S-OK) Glucan-saccharase Leuconostoc citreum -1,3 BrS FR1301402 NRRL B-742 Glucan-saccharase Leuconostoc citreum -1,2 BrS FR1301402 NRRL B-1299 Glucan-saccharase WO/2002/074943 Bacillus subtilis Fructosyltransferase Cheetham et al., Enzyme NC1MB11871 Microb. Technol. 1989, 11, 212-219; Baciu et al, Journal of Biotechnology, Volume 116, Issue 4, 6 Apr. 2005, Pages 347-357

TABLE-US-00002 TABLE 2 HPLC Dionex U3000 (Thermo Hypercarb Hypercarb Amino Scientific) (6 min.) (30 min.) (30 min) C18 Column Hypercarb 5 m Hypercarb 5 m Sperisorb Amino, C18 SB ZORBAX, Eluent (100 2.1 mm)- (100 2.1 mm)- 5 m (250 5 m (250 Flow rate/ Thermo ACN Thermo Gradient 4.0 mm)-Bischoff 4.6 mm)-Agilent Temperature 10%/H2O 90% H2O-ACN 0.5 ACN 80%/H2O Gradient H2O-ACN 0.5 ml/min; 8 C. ml/min; 8 C. 20% 1 ml/min; 30 C. 1 ml/min; 30 C. LC detection ELSD UV.sub.210/215 nm + ELSD UV.sub.204 nm + ELSD (Evaporative light scattering detector) LC-MS detection Positive electrospray ionization (ESI+); source at 450 C. Capillary voltage: 3kV: Cone voltage: 50 V

TABLE-US-00003 TABLE 3 Ratio: sucrose 143 mM/ HEMA 438 mM Sucrose HEMA glucosylation (g/L) conversion Total HEMA- HEMA- HEMA- Enzymes (%) glucosylation Glc1 Glc2 Glc3 ASDg 95.0 2.709 1.306 1.403 0 ASR 95.0 21.030 6.745 7.046 7.240 GBD-CD2 23.7 2.168 2.168 0 0 DSR-S-4N 39.0 0 0 0 0 DSR-OK 29.0 0 0 0 0 -1,2-BrS 93.2 10.635 10.421 0.215 0 -1,3-BrS 84.4 13.486 12.628 0.858 0

TABLE-US-00004 TABLE 4 Ratio: sucrose 143 mM/ 438 NHAM nM NHAM Sucrose glucosylation (g/L) conversion Total NHAM- NHAM- NHAM- Enzymes (%) glucosylation Glc1 Glc2 Glc3 ASDg 12 0.136 0.136 0 0 ASR >95 0.340 0.135 0.205 0 GBD-CD2 42 2.201 1.517 0.684 0 DSR-S-4N 60 0.062 0.062 0 0 DSR-OK >95 0.149 0.149 0 0 -1,2-BrS >95 1.886 1.781 0.054 0.050 -1,3-BrS >95 2.078 1.918 0.160 0

TABLE-US-00005 TABLE 7 Ratio: sucrose 73 mM/ HEMA 73 mM Sucrose HEMA glucosylation (g/L) conversion Total HEMA- HEMA- HEMA- Enzymes (%) glucosylation Glc1 Glc2 Glc3 Wild-type 87 0.141 0.079 0.062 Traces ASNp F229W 92.5 0.121 0.069 0.052 0 F290A 73.5 4.532 1.961 0.486 2.084 F290C 83 8.966 6.064 1.734 1.167 F290I 69 3.134 2.377 0.420 0.337 F290K 57 0.795 0.616 0.179 Traces F290L 92 2.197 1.531 0.621 0.045 F290M 92 0.793 0.544 0.249 Traces F290V 40 5.938 4.535 0.704 0.699 I330A 4 0.287 0.188 0.099 0 V331E 88 0.444 0.299 0.145 0 D394A 23 0.236 0.149 0.087 0 R446G 14.5 0.191 0.094 0.041 0.055

TABLE-US-00006 TABLE 8 Ratio: sucrose 73 mM/ NHAM 73 mM Sucrose NHAM glucosylation (g/L) conversion Total NHAM- NHAM- NHAM- Enzymes (%) glucosylation Glc1 Glc2 Glc3 Wild-type 76.5 0.101 0.025 0.076 0 ASNp F229M 73.7 0.169 0.130 0.033 0.007 F229N 2.5 0.100 0.051 0.049 0 A289N 90.8 0.211 0.126 0.084 0 A289P 81.0 0.127 0.032 0.096 0 A289Q 52.1 0.083 0.037 0.045 0 I330N 0.6 0.096 0.033 0.063 0 V331C 75.0 0.065 0.031 0.029 0.004 V331D 17.7 0.077 0.039 0.032 0.007 V331E 64.2 0.145 0.097 0.038 0.010 V331T 86.9 0.100 0.031 0.069 0 D394E 86.6 0.187 0.137 0.050 0

TABLE-US-00007 TABLE 9 Estimated production Acceptor Enzyme Volume Lyophilized g/L (g) HEMA F290C 500 yes 38.8 19.4 ASR 500 yes 29.7 14.8 -1,3-BrS 500 yes 15.1 7.5 NHAM D394E 500 yes 1 0.5 ASR 500 no 1 0.5 -1,3-BrS 500 yes 2.5 1.25

TABLE-US-00008 TABLE 10 Allyl alcohol Ratio: sucrose glucosylation (g/L) 143 mM/2-propen-ol Sucrose 438 mM conversion Total Enzymes (%) glucosylation ASDg 82.6 0.166 ASR 91.5 0 GBD-CD2 46.3 1.225 DSR-S-4N 76.1 0 DSR-OK 97.4 0 -1,2-BrS 88.8 1.908 -1,3-BrS 76.6 1.207

TABLE-US-00009 TABLE 11 Ratio: sucrose BME glucosylation (g/L) 143 mM/BME Sucrose 438 mM conversion Total Enzymes (%) glucosylation ASDg 80.4 1.849 ASR 91.3 0 GBD-CD2 3.0 1.674 DSR-S-4N 5.5 0 DSR-OK 97.2 0 -1,2-BrS 89.1 2.848 -1,3-BrS 81.9 2.736

TABLE-US-00010 TABLE 14 Ratio: sucrose VBA glucosylation 73 mM/ Sucrose Total VBA 73 mM conversion glucosylation Enzymes (%) (g/L) -1,2-BrS 63.1 7.9 ASR 95.3 2.5

TABLE-US-00011 TABLE 16 Ratio: sucrose 73 mM/ NNHEA 73 mM Sucrose NNHEA glucosylation (g/L) conversion Total NNHEA- NNHEA- NNHEA- Enzymes (%) glucosylation Glc1 Glc2 Glc3 ASR >98 0.86 0.86 Traces 0 -1,2-BrS 90 1.76 1.76 Traces 0 -1,3-BrS >98 1.47 1.47 Traces 0

TABLE-US-00012 TABLE 18 Ratio: sucrose 73 mM/ NNHEA 73 mM Sucrose NNHEA glucosylation (g/L) conversion Total NNHEA- NNHEA- NNHEA- Enzymes (%) glucosylation Glc1 Glc2 Glc3 Wild-type 98 1.7 1.7 0 0 ASNp A289Q 99 5.1 5.1 0 0 F290C 69 7.2 7.2 Traces 0 F290L 89 6.6 6.6 Traces 0 F290V 99 9.0 9.0 Traces 0 F290W 68 5.3 3.0 2.3 0

TABLE-US-00013 TABLE 19 Ratio: sucrose HEAA glucosylation (g/L) 146 mM/HEAA Sucrose 438 mM conversion Total Enzymes (%) glucosylation ASR 92 2.8 -1,3-BrS 97 2.4 D394E 81 3.9 Bacillus subtilis fructosyltransferase 99.2 0.08 of Table I

TABLE-US-00014 TABLE 20 Ratio: sucrose 146 mM/ HEAA 348 mM Sucrose HEAA glucosylation (g/L) conversion Total HEAA- HEAA- HEAA- Enzymes (%) glucosylation Glc1 Glc2 Glc3 ASR 92 2.823 0.851 1.54 0.431 a-1.3-BrS 97 2.441 2.441 Traces 0 D394E 81 3.883 3.883 Traces 0

TABLE-US-00015 SEQUENCES: SeriesSEQIDNO:1:(Protein= sequenceofthewild-typeglucansaccharase ASNp(AmylosucraseofNeisseriapolysaccharea)) SPNSQYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSVYGNNEALLPMLEMLLAQAWQSYSQR NSSLKDIDIARENNPDWILSNKQVGGVCYVDLFAGDLKGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVS SYRDVNPALGTIGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMPDQYDRTL REIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEMLFLANLGVDILRMDAVAFIWKQMGTSCE NLPQAHALIRAFNAVMRIAAPAVFFKSEAIVHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREVNLLHQALTY RHNLPEHTAWVNYVRSHDDIGWTFADEDAAYLGSIGYDHRQFLNRFFVNRFDGSFARGVPFQYNPSTGDCRVSGT AAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLNDDDWSQDSNKSDDSRWAHRPRYNEALYAQRN DPSTAAGQIYQDRLHMIAVRQSNPRFDGGLRVTFNTNNKHIIGYIRNNALLAFGNFSEYPQTVTAHTLQAMPFKA HDLIGGKTVSLNQDLTLQPYQVMWLEIA SeriesSEQIDNO:2:(Proteins= mutatedsequencesofglucan-saccharase ASNp(AmylosucraseofNeisseriapolysaccharea)R226X.sub.1) SPNSQYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSVYGNNEALLPMLEMLLAQAWQSYSQR NSSLKDIDIARENNPDWILSNKQVGGVCYVDLFAGDLKGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVS SYRDVNPALGTIGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMPDQYDRTL X.sub.1EIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEMLFLANLGVDILRMDAVAFIWKQMGTSC ENLPQAHALIRAFNAVMRIAAPAVFFKSEAIVHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREVNLLHQALT YRHNLPEHTAWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQYNPSTGDCRVSG TAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLNDDDWSQDSNKSDDSRWAHRPRYNEALYAQR NDPSTAAGQIYQDLRHMAIVRQSNPRFDGGRLVTFNTNNKHIIGYIRNNALLAFGNFSEYPQTVTAHTLQAMPFK AHDLIGGKTVSLNQDLTLQPYQVMWLEIA SeriesSEQIDNO:3:(Proteins= mutatedsequencesofglucan-saccharase ASNp(AmylosucraseofNeisseriapolysaccharea)I228X.sub.2) SPNSQYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSVYGNNEALLPMLEMLLAQAWQSYSQR NSSLKDIDIARENNPDWILSNKQVGGVCYVDLFAGDLKGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVS SYRDVNPALGTIGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMPDQYDRTL REX.sub.2FPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEMLFLANLGVDILRMDAVAFIWKQMGTSC ENLPQAHALIRAFNAVMRIAAPAVFFKSEAIVHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREVNLLHQALT YRHNLPEHTAWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQYNPSTGDCRVSG TAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLNDDDWSQDSNKSDDSRWAHRPRYNEALYAQR NDPSTAAGQIYQDLRHMIAVRQSNPRFDGGRLVTFNTNNKHIIGYIRNNALLAFGNFSEYPQTVTAHTLQAMPFK AHDLIGGKTVSLNQDLTLQPYQVMWLEIA SeriesSEQIDNO:4:(Proteins= mutatedsequencesofglucan-saccharase ASNp(AmylosucraseofNeisseriapolysaccharea)F229X.sub.3) SPNSQYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSVYGNNEALLPMLEMLLAQAWQSYSQR NSSLKDIDIARENNPDWILSNKQVGGVCYVDLFAGDLKGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVS SYRDVNPALGTIGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMPDQYDRTL REIX.sub.3PDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEMLFLANLGVDILRMDAVAFIWKQMGTSC ENLPQAHALIRAFNAVMRIAAPAVFFKSEIAVHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREVNLLHQALT YRHNLPEHTAWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQYNPSTGDCRVSG TAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLNDDDWSQDSNKSDDSRWAHRPRYNEALYAQR NDPSTAAGQIYQDLRHMIAVRQSNPRFDGGRLVTFNTNNKHIIGYIRNNALLAFGNFSEYPQTVTAHTLQAMPFK AHDLIGGKTVSLNQDLTLQPYQVMWLEIA SEQIDNO:5:(Protein= mutatedsequencesofglucan-saccharase ASNp(AmylosucraseofNeisseriapolysaccharea)A289X.sub.4) SPNSQYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSVTGNNEALLPMLEMLLAQAWQSYSQR NSSLKDIDIARENNPDWILSNKQVGGVCYVDLFAGDLKGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVS SYRDVNPALGTIGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMPDQYDRTL REIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEMLFLANLGVDILRMDAVX.sub.4FIWKQMGTSC ENLPQAHALIRAFNAVMRIAAPAVFFKSEAIVHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREVNLLHQALT YRHNLPEHTAWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQUNPSTGDCRVSG TAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLNDDDWSQDSNKSDDSRWAHRPRYNEALYAQR NDPSTAAGQIYQDLRHMIAVRQSNPRFDGGRLVTFNTNNKHIIGYIRNNALLAFGNFSEYPQTVTAHTLQAMPFK AHDLIGKGTVSLNQDLTLQPYQVMWLEIA SeriesSEQIDNO:6:(Proteins= mutatedsequencesofglucan-saccharase ASNp(AmylosucraseofNeisseriapolysaccharea)F290X.sub.5) SPNQSYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSVYGNNEALLPMLEMLLAQAWQSYSQR NSSLKDIDIARENNPDWILSNKQVGGVCYVDLFAGDLKGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVS SYRDVNPALGTIGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMPDQYDRTL REIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEMLFLANLGVDILRMDAVAX.sub.5IWKQMGTSC ENLPQAHALIRAFNAVMRIAAPAVFFKSEAIVHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREVNLLHQALT YRHNLPEHTAWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQYNPSTGDCRVSG TAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLNDDDWSQDSNKSDDSRWAHRPRYNEALYAQR NDPSTAAGQIYQDLRHMIAVRQSNPRFDGGRLVTFNTNNKHIIGYIRNNALLAFGNFSEYPQTVTAHTLQAMPFK AHDLIGGKTVSLNQDLTLQPYQVMWLEIA SeriesSEQIDNO:7:(Proteins= mutatedsequencesofglucan-saccharase ASNp(AmylosucraseofNeisseriapolysaccharea)I330X.sub.6) SPNSQYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSVYGNNEALLPMLEMLLAQAWQSYSQR NSSLKDIDIARENNPDWILSNKQVGGVCYVDLFAGDLKGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVS SYRDVNPALGTIGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMPDQYDRTL REIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEMLFLANLGVDILRMDAVAFIWKQMGTSCE NLPQAHALIRAFNAVMRIAAPAVFFKSEAX.sub.6VHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREVNLLHQALT YRHNLPEHTAWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQYNPSTGDCRVSG TAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLNDDDWSQDSNKSDDSRWAHRPRYNEALYAQR NDPSTAAGQIYQDLRHMIAVRQSNPRFDGGRLVTFNTNNKHIIGYIRNNALLAFGNFSEYPQTVTAHTLQAMPFK AHDLIGGKTVSLNQDLTLQPYQVMWLEIA SeriesSEQIDNO:8:(Proteins= mutatedsequencesofglucan-saccharase ASNp(AmylosucraseofNeisseriapolysaccharea)V331X.sub.7) SPNSQYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSVYGNNEALLPMLEMLLAQAWQSYSQR NSSLKDIDIARENNPDWILSNKQVGGVCYVDLFAGDLKGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVS SYRDVNPALGTIGDLREVIALLHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMPDQYDRTL REIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEMLFLANLGVDILRMDAVAFIWKQMGTSCE NLPQAHALIRAFNAVMRIAAPAVFFKSEAIX.sub.7HPDQVVQYIGQDECQIGYNPLQMALLWNTLATREVNLLHQALT YRHNLPEHTAWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQYNPSTGDCRVSG TAAALVGALQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLNDDDWSQDSNKSDDSRWAHRPRYNEALYAQR NDPSTAAGQIYQDLRHMIAVRQSNPRFDGGRLVTFNTNNKHIIGYIRNNALLAFGNFSEYPQTVTAHTLQAMPFK AHDLIGGKTVSLNQDLTLQPYQVMWLEIA SeriesSEQIDNO:9:(Proteins= mutatedsequencesofglucan-saccharase ASNp(AmylosucraseofNeisseriapolysaccharea)D394X.sub.8) SPNSQYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSVYGNNEALLPMLEMLLAQAWQSYSQR NSSLKDIDIARENNPDWILSNKQVGGVCYVDLFAGDLKGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVS SYRDVNPALGTIGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMPDQYDRTL REIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEMLFLANLGVDILRMDAVAFIWKQMGTSCE NLPQAHALIRAFNAVMRIAAPAVFFKSEAIVHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREVNLLHQALTY RHNLPEHTAWVNYVRSHDX.sub.8IGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQYNPSTGDCRVSG TAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLNDDDWSQDSNKSDDSRWAHRPRYNEALYAQR NDPSTAAGQIYQDLRHMIAVRQSNPRFDGGRLVTFNTNNKHIIGYIRNNALLAFGNFSEYPQTVTAHTLQAMPFK AHDLIGGKTVSLNQDLTLQPYQVMWLEIA SEQIDNO:10:(Protein= mutatedsequencesofglucan-saccharase ASNp(AmylosucraseofNeisseriapolysaccharea)R446X.sub.9) SPNSQYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSVYGNNEALLPMLEMLLAQAWQSYSQR NSSLKDIDIARENNPDWILSNKQVGGVCYVDLFAGDLKGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVS SYRDVNPALGTIGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMPDQYDRTL REIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEMLFLANLGVDILRMDAVAFIWKQMGTSCE NLPQAHALIRAFNAVMRIAAPAVFFKSEAIVHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREVNLLHQALTY RHNLPEHTAWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQYNPSTGDCX.sub.9VSG TAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLNDDDWSQDSNKSDDSRWAHRPRYNEALYAQR NDPSTAAGQIYQDLRHMIAVRQSNPRFDGGRLVTFNTNNKHIIGYIRNNALLAFGNFSEYPQTVTAHTLQAMPFK AHDLIGGKTVSLNQDLTLQPYQVMWLEIA SeriesSEQIDNO:11:(Protein= sequenceofDSR-S-4N(truncated dextran-saccharaseDSR-Svardel4NofLeuconostocmesenteroidesB-512F)) TQQVSGKYVEKDGSWYYYFDDGKNAKGLSTIDNNIQYFYESGKQAKGQYVTIDNQTYYFDKGSGDELTGLQSIDG NIVAFNDEGQQIFNQYYQSENGTTYYFDDKGHAATGIKNIEGKNYYFDNLGQLKKGFSGVIDGQIMTFDQETGQE VSNTTSEIKEGLTTQNTDYSEHNAAHGTDAEDFENIDGYLTASSWYRPTGILRNGTDWEPSTDTDFRPILSVWWP DKNTQVNYLNYMADLGFISNADSFETGDSQSLLNEASNYVQKSIEMKISAQQSTEWLKDAMAAFIVAQPQWNETS EDMSNDHLQNGALTYVNSPLTPDANSNFRLLNRTPTNQTGEQAYNLDNSKGGFELLLANQEDNSNVVVEAEQLNW LYYLMNFGTITANDADANFDGIRVDAVDNVDADLLQIAADYFKLAYGVDQNDATANQHLSILEDWSHNDPLYVTD DQGSNQLTMDDYVHTQLIWSLTKSSDIRGTMQRFVDYYMVDRSNDSTENEAIPNYSFVRAHDSEVQTVIAQIVSD LYPDVENSLAPTTEQLAAAFKVYNEDEKLADKKYTQYNMASAYAMLLTNKDTVPRVYYGDLYTDDGQYMATKSPY YDAINTLLKARVQYVAGGQSMSVDSNDVLTSVRYGKDAMTASDTGTSETRTEGIGVIVSNNAELQLEDGHTVTLH MGAAHKNQAYRALLSTTADGLAYYDTDENAPVAYTDANGDLIFTNESIYGVQNPQVSGYLAVWVPVGAQQDQDAR TASDTTTNTSDKVFHSNAALDSQVIYEGFSNFQAFATDSSEYTNVVIAQNADQFKQWGVTSFQLAPQYRSSTDTS FLDSIIQNGYAFTDRYDLGYGTPTKYGTADQLRDALKALHASGIQAIADWVPDQIYNLPEQELATVTRTNSFGDD DTDSDIDNALYVVQSRGGGQYQEMYGGAFLEELQALYPSLFKVNQISTGVPIDGSVKITEWAAKYFNGSNIQGKG AGYVLKDMGSNKYFKVVSNTEDGDYLPKQLTNDLSETGFTHDDKGIIYYTLSGYRAQNAFIQDDDNNYYYFDKTG HLVTGLQKINNHTYFFLPNGIELVKSFLQNEDGTIVYFDKKGHQVFDQYITDQNGNAYYFDDAGVMLKSGLATID GHQQYFDQNGVQVKDKFVIGTDGYKYYFEPGSGNLAILRYVQNSKNQWFYFDGNGHAVTGFQTINGKKQYFYNDG HQSKFEFIDADGDTFYTSATDGRLVTGVQKINGITYAFDNTGNLITNQYYQLADGKYMLLDDSGRAKTGFVLQDG VLRYFDQNGEQVKDAIIVDPDTNLS SeriesSEQIDNO:12:(Protein= sequenceofglucan-saccharase-1,2BrS (-1,2BrSofLeuconostoccitreumNRRLB-1299)) MRQKETITRKKLYKSGKSWVAAATAFAVMGVSAVTTVSADTQTPVGTTQSQQDLTGQRGQDKPTTKEVIDKKEPV PQVSAQNAGDLSADAKTTKADDKQDTQPTNAQLPDQGNKQTNSNSDKGVKESTTAPVKTTDVPSKSVTPETNTSI NGGQYVEKDGQFVYIDQSGKQVSGLQNIEGHTQYFDPKTGYQTKGELKNIDDNAYYFDKNSGNGRTFTKISNGSY SEKDGMWQYVDSHDKQPVKGLYDVEGNLQYFDLSTGNQAKHQIRSVDGVTYYFDADSGNATAFKAVTNGRYAEQT TKDKDGNETSYWAYLDNQGNAIKGLNDVNGEIQYFDEHTGEQLKGHTATLDGTTYYFEGNKGNLVSVVNTAPTGQ YKINGDNVYYLDNNNEAIKGLYGINGNLNYFDLATGIQLKGQAKNIDGIGYYFDKDTGNGSYQYTLMAPSNKNDY TQHNVVNNLSESNFKNLVDGFLTAETWYRPAQILSHGTDWVASTDKDFRPLITVWWPNKDIQVNYLRLMQNEGVL NQSAVYDLNTDQLLLNEAAQQAQIGIEKKISQTGNTDWLNNVLFTTHDGQPSFIKQQYLWNSDSEYHTGPFQGGY LKYQNSDLTPNVNSKYRNADNSLDFLLANDVDNSNPIVQAEDLNWLYYLLNFGSITTQGKENNSNFDSIRIDAVD FVSNDLIQRTYDYLRAAYGVDKNDKEANAHLSLVEAGLDAGTTTIHQDALIESDIREAMKKSLTNGPGSNISLSN LIQDKEGDKLIADRANNSTENVAIPNYSIIHAHDKDIQDKVGAAITDATGADWTNFTPEQLQKGLSLYYEDQRKI EKKYNQYNIPSAYALLLTNKDTVPRVYYGDMYQDDGQYMQKQSLYFDTITALMEARKQFVAGGQTINVDDNGVLT SVRFGKGAMTANDIGTNETRTQGIGVVIANDPSLKLSKDSKVTLHMGAAHRNQNYRALLLTTDNGIDSYSSSKNA PVIKTDDNGDLVFSNQDINDQLNTKVHGFLNSEVSGYLSAWVPLDATEQQDARTLPSEKSVNDGKVLHSNAALDS NLIYEAFSNFQPMPTNRNEYTNVVIADKADTFKSWGITSFEMAPQYRSSQDKTFLDSTIDNGYAFTDRYDLGFEK PTKYGNELSDRQAIKQLHSSGMQVMADVVANQIYNLPGKEVASTNRVDWNGNNLSTPFGTQMYVVNTVGGGKYQN KYGGEFLDKLKAAYPDIFRSKNYEYDVKNYGGNGTGSVYYTVDSKTRAELDTDTKIKEWSAKYMNGTNVLGLGMG YVLKDWQTGQYFNVSNQNMKFLLPSDLISNDITVQLGVPVTDKKIIFDPASAYNMYSNLPEDMQVMDYQDDKKST PSIKPLSSYNNKQVQVTRQYTDSKGVSWNLITFAGGDLQGQKLWVDSRALTMTPFKTMNQISFISYANRNDGLFL NAPYQVKGYQLAGMSNQYKGQQVTIAGVANVSGKDWSLISFNGTQYWIDSQALNTNFTHDMNQKVFVNTTSNLDG LFLNAPYRQPGYKLAGLAKNYNNQTVTVSQQYFDDQGTVWSQVVLGGQTVWVDNHALAQMQVRDTNQQLYVNSNG RNDGLFLNAPYRGQGSQLIGMTADYNGQHVQVTKQGQDAYGAQWRLITLNNQQVWVDSRALSTTIMQAMNDDMYV NSSQRTDGLWLNAPYTMSGAKWAGDTRSANGRYVHISKAYSNEVGNTYYLTNLNGQSTWIDKRAFTATFDQVVAL NATIVARQRPDGMFKTAPYGEAGAQFVDYVTNYNQQTVPVTKQHSDAQGNQWYLATVNGTQYWIDQRSFSPVVTK VVDYQAKIVPRTTRDGVFSGAPYGEVNAKLVNMATAYQNQVVHATGEYTNASGITWSQFALSGQEDKLWIDKRAL QA SeriesSEQIDNO:13:(Protein= sequenceofglucan-saccharaseGBD-CD2 (TruncateddextransucraseDSR-EofLeuconostocmesenteroidesNRRLB-1299)) MAHHHHHHVTSLYKKAGSAAAPFTMAQAGHYITKNGNDWQYDTNGELAKGLRQDSNGKLRYFDLTTGIQAKGQFV TIGQETYYFSKDHGDAQLLPMVTEGHYGTITLKQGQGTKTAWVYRDQNNTILKGLQNINGTLQFFDPYTGEQLKG GVAKYDDKLFYFESGKGNLVSTVAGDYQDGHYISQDGQTRYADKQNQLVKGLVTVNGALQYFDNATGNQIKNQQV IVDGKTYYFDDKGNGEYLFTNTLDMSTNAFSTKNVAFNHDSSSFDHTVDGFLTADTWYRPKSILANGTTWRDSTD KDMRPLITVWWPNKNVQVNYLNFMKANGLLTTAAQYTLHSDQYDLNQAAQDVQVAIERRAISEHGTDWLQKLLFE SQNNNPSFVKQQFIWNKDSEYHGGGDAWFQGGYLKYGNNPLTPTTNSDYRQPGNAFDFLLANDVDNSNPVVQAEN LNWLHYLMNFGTITAGQDDANFDSIRIDAVDFIHNDTIQRTYDYLRDAYQVQQSEAKANQHISLVEAGLDAGTST IHNDALIESNLREAATLSLTNEPGKNKPLTNMLQDVDGGTLITDHTQNSTENQATPNYSIIHAHDKGVQEKVGAA ITDATGADWTNFTDEQLKAGLELFYKDQRATNKKYNSYNIPSIYALMLTNKDTVPRMYYGDMYQDDGQYMANKSI YYDALVSLMTARKSYVSGGQTMSVDNHGLLKSVRFGKDAMTANDLGTSATRTEGLGVIIGNDPKLQLNDSDKVTL DMGAAHKNQKYRAVILTTRDGLATFNSDQAPTAWTNDQGTLTFSNQEINGQDNTQIRGVANPQVSGYLAVWVPVG ASDNQDARTAATTTENHDGKVLHSNAALDSNLIYEGFSNFQPKATTHDELTNVVIAKNADVFNNWGITSFEMAPQ YRSSGDHTFLDSTIDNGYAFTDRYDLGFNTPTKYGTDGDLRATIQALHHANMQVMADVVDNQVYNLPGKEVVSAT RAGVYGNDDATGFGTQLYVTNSVGGGQYQEKYAGQYLEALKAKYPDLFEGKAYDYWYKNYANDGSNPYYTLSHGD RESIPADVAIKQWSAKYMNGTNVLGNGMGYVLKDWHNGQYFKLDGDKSTLPKGGRADPAFLYKVVSAWSHPQFEK SeriesSEQIDNO:14:(Protein= sequenceofglucan-saccharaseASDg (AmylosaccharaseofDeinococcusgeothermalis)) MLKDVLTSELAAQVRDAFDDDRDAETFLLRLERYGEDLWESLRAVYGDQVRALPGRLLEVMLHAYHARPAELRRL DEARLLRPDWLQRPEMVGYVAYTDRFAGTLKGVEERLDYLEGLGVKYLHLMPLLRPREGENDGGYAVQDYRAVRP DLGTMDDLSALARALRGRGISLVLDLVLNHVAREHAWAQKARAGDPKYRAYFHLFPDRRGPDAFEATLPEIFPDF APGNFSWDEEIGEGEGGWVWTTFNSYQWDLNWANPDVFLEFVDIILYLANRGVEVFRLDAIAFIWKRLGTDCQNQ PEVHHLTRALRAAARIVAPAVAFKAEAIVAPADLIHYLGTRAHHGKVSDMAYHNSLMVQLWSSLASRNTRLFEEA LRAFPPKPTSTTWGLYVRCHDDIGWAISDEDAARAGLNGAAHRHFLSDFYSGQFPGSFARGLVFQYNPVNGDRRI SGSAASLAGLEAALETGDPGRIEDAVRRLLLLHTVILGFGGVPLLYMGDELALLNDYAFEDVPEHAPDNRWVHRP QMDWALAERVRQEPSSPAGRVNTGLRHLLRVRRDTPQLHASIESQVLPSPDSRALLLRRDHPLGGMVQVYNFSEE TVMLPSHVLRDVLGDHVQDRLSGSAFRLDRPTVRLEGYRALWLTAGEAPA SeriesSEQIDNO:15:(Protein= sequenceofglucan-saccharaseDSR-S-OK (Dextran-saccharaseofOenococcuskitaharaeDSM17330)) MMATGSNLITAQADDLNQEGTAAQSVSPSTAAANQSESSAQSTEQSATQAATDGEASTVSTAVTTITPHYVQQAG KWLYMGSDGEFVKGPQTIDGNLQFFDEQGIQIKGSFETVDGSSYYFDSQSGNAVTGFKIINNDLHYFEEDGKETV NNYATDKQGNIFYFDENGQMATGVKTIQGQSYYFDQDGHMRKGYSGVFDNQVLYFDKTTGALANTNVSSIKEGLT AQNDDFTAHNAVYSTKSESFTNIDGYLTAEAWYRPADILENGTDWRASRADEFRPILTTWWPDKQTEVNYLNYMK TQGFITNDQDFKLSDDQLLLNHAAQSVQGEIEKKISQQGSTDWLKTLLQTFINQQPSWNGESEDPGSDHLQGGAL TFVNSPLTPDSNSNFLLNRTPTNQTGTPQYDTDASLGGFELLLANDVDNSNPVVQAEQLNWLYYLLNFGSITADD PNANFDGIRIDAVDNVDADLLQIAAAYFKDAFKSGSNDQTTNQHLSILEDWSHNDPEYMKAQGYPQLTMDDYMHT QLIWSLTKPDNIRGTMQRFMDYYLVNRANDSTNNEAVANYSFVRAHDSEVQTVIAQIISDLYPNSGSGLIPTTDQ LQAAFEVYNADMKSDVKKYTQYNIPSAYAMLLTNKDTVPRVYYGDMYTDDGDYMANKSPYFDAISTLLKARVKYA AGGQSMAVDKNDILTSVRFGQNAMLASDSGDNQTRQEGIGVIVSNNSHLKLAENDQVVLHMGAAHKNQAFRALLL TIESGLENFDTDLQPAVKYTDANGDLIFTAAELAGYLNPEVSGYLSAWVPVGAADNQDARTAADSATSTDGNVFH SNAALDSNVIFEGFSNFQSIPTAEQHDDFTNVKIAENAGLFKDWGITSFQLAPQYRSSTDSTFLDSIIQNGYAFT DRYDLGFDTPTKYGDVDDLRAAIKALHANNIQVMADWVPDQIYNLQNPEIITVNRTDSYGQPIAGSDLQNDLYLA YTNGGGQYQTKFGGAFLEKLQQLYPDLFTKTQISTGQTIDPSQKITEWSAKYFNGSNIQGRGAYYVLRDSGTDQY FKVISNDENEAFLPKQLTNQPGETGFSQDDQGIIFFSTSGYQAKNAFVQGDDGNYYYFDNTGHMVTGPQTINGRH YLFFPNGVEAQNVFVQNDRGETYYYDQRGRQVANQYVTDTNGNSFRFDENGIMLANQLAQVDGHWQFFKSSGVQA KDAFILGSDGKLRYFESGNGNMAVNEFKGSENGRYYYFGADGQAVSGLQTINGRQLYFDDHGQQMKDAFYTNQSG QRFYFNALTGDLVKFNFIYTSASSSFTPDNDSSDSYQGDSHLWYYADSQGQIVTGFQTINGHLQYFDDISGQMIT NRFMRRADGNWIYLDENGEAVRGMRVINGLTNYFRDDFTQVKDGFAQDPNSGERHYFNGTNGAMVTNDYFSPDQI HWYYADDSGQPVTGFQTIKGQVQYFDQDGIQLKGGSQTDPVTKQTYYFDDKFGNGQIL SeriesSEQIDNO:16:(Protein= sequenceofglucan-saccharase-1,3BrS (-1,3BrSofLeuconostoccitreumNRRLB-742)) MEMKETITRKKLYKSGKSWVAAATAFAVMGVSAVTTVSADTQTPVGTTQSQQDLTGQTGQDKPTTKEVIDKKEPV PQVSAQNVGDLSADAKTPKADDKQDTQPTNAQLPDQGNKQTNSNSDKGVKESTTAPVKTTDVPSKSVAPETNTSI NGGQYVEKDGQFVYIDQSGKQVSGLQNIEGHTQYFDPKTGYQTKGELKNIDDNAYYFDKNSGNGRTFTKISNGSY SEKDGMWQYVDSHDKQPVKGLYDVEGNLQYFDLSTGNQAKHQIRSVDGVTYYFDADSGNATAFKAVTNGRYAEQT TKDKDGNETSYWAYLDNQGNAIKGLNDVNGEIQYFDEHTGEQLKGHTATVDGTTYYFEGNKGNLVSVVNTAPTGQ YKINGDNVYYLDNNNEAIKGLYGINGNLNYFDLATGIQLKGQAKNIDGIGYYFDQNNGNGEYRTSLTGPVVKDVY SQHNAVNNLSANNFKNLVDGFLTAETWYRPAQILSHGTDWVASTDKDFRPLITVWWPNKDIQVNYLKLMQQIGIL DNSVVFDTNNDQLVLNKGAESAQIGIEKKVSETGNTDWLNELLFAPNGNQPSFIKQQYLWNVDSEYPGGWFQGGY LAYQNSDLTPYANTNPDYRTHNGLEFLLANDVDNSNPVVQAEQLNWLYYLMNFGQITANDSNANFDSMRIDAISF VDPQIAKKAYDLLDKMYGLTDNEAVANQHISIVEAPKGETPITVEKQSALVESNWRDRMKQSLSKNATLDKLDPD PAINSLEKLVADDLVNRSQSSDKDSSTIPNYSIVHAHDKDIQDTVHIIMKIVNNNPNISMSDFTMQQLQNGLKAF YEDQHQSVKKYNQYNIPSAYALLLTNKDTVPRVFYGDMYQDYGDDLDGGQYMATKSIYYNAIEQMMKARLKYVAG GQIMAVTKIKNDGINKDGTNKSGEVLTSVRFGKDIMDAQGQGTAESRNQGIGVIVSNSSGLELKNSDSITLHMGI AHKNQAYRALMLTNDKGIVNYDQDNNAPIAWTNDHGDLIFTNQMINGQSDTAVKGYLNPEVAGYLAVWVPVGAND NQDARTVTTNQKNTDGKVLHTNAALDSKLMYEGFSNFQKMPTRGNQYANVVITKNIDLFKSWGITDFELAPQYRS SDGKDITDRFLDSIVQNGYGLSDRYDLGFKTPTKYGTDQDLRKAIERLHQAGMSVMADFVANQIYGLHADKEVVS AQHVNINGDTKLVVDPRYGTQMTVVNSVGGGDYQAKYGGEYLDTISKLYPGLLLDSNGQKIDLSTKIKEWSAKYL NGNSIPQVGMGYVLKDWNNGQYFHILDKEGQYSLPTQLVSNDPETQIGESVNYKYFIGNSDATYNMYHNLPNTVS LINSQEGQIKTQQSGVTSDYEGQQVQVTRQYTDSKGVSWNLITFAGGDLQGQKLWVDSRALTMTPFKTMNQISFI SYANRNDGLFLNAPYQVKGYQLAGMSNQYKGQQVTIAGVANVSGKDWSLISFNGTQYWIDSQALNTNFTHDMNQK VFVNTTSNLDGLFLNAPYRQPGYKLAGLAKNYNNQTVTVSQQYFDDQGTVWSEVVLGGQTVWVDNHALAQMQVSD TSQQLYVNSNGRNDGLFLNAPYRGQGSQLIGMTADYNGQHVQVTKQGQDAYGAQWRLITLNNQQVWVDSRALSTT IVQAMNDDMYVNSNQRTDGLWLNAPYTMSGAKWAGDTRSANGRYVHISKAYSNEVGNTYYLTNLNGQSTWIDKRA FTATFDQVVALNATIVARQRPDGMFKTAPYGEAGAQFVDYVTNYNQQTVPVTKQHSDAQGNQWYLATVNGTQYWI DQRSFSPVVTKVVDYQAKIVPRTTRDGVFSGAPYGEVNAKLVNMATAYQNQVVHATGEYTNASGITWSQFALSGQ EDKLWIDKRALQA SeriesSEQIDNO:17:(Protein= sequenceofglucan-saccharaseASR-C-del- bis(truncatedalternane-saccharaseofLeuconostocmesenteroides NRRLB-1355)) MEQQETVTRKKLYKSGKVWVAAATAFAVLGVSTVTTVHADTNSNVAVKQINNTGTNDSGEKKVPVPSTNNDSLKQ GTDGFWYDSDGNRVDQKTNQILLTAEQLKKNNEKNLSVISDDTSKKDDENISKQTKIANQQTVDTAKGLTTSNLS DPITGGHYENHNGYFVYIDASGKQVTGLQNIDGNLQYFDDNGYQVKGSFRDVNGKHIYFDSVTGKASSNVDIVNG KAQGYDAQGNQLKKSYVADSSGQTYYFDGNGQPLIGLQTIDGNLQYFNQQGVQIKGGFQDVNNKRIYFAPNTGNA VANTEIINGKLQGRDANGNQVKNAFSKDVAGNTFYFDANGVMLTGLQTISGKTYYLDEQGHLRKNYAGTFNNQFM YFDADTGAGKTAIEYQFDQGLVSQSNENTPHNAAKSYDKSSFENVDGYLTADTWYRPTDILKNGDTWTASTETDM RPLLMTWWPDKQTQANYLNFMSSKGLGITTTYTAATSQKTLNDAAFVIQTAIEQQISLKKSTEWLRDAIDSFVKT QANWNKQTEDEAFDGLQWLQGGFLAYQDDSHRTPTDSGNNRKLGRQPINIDGSKDTTDGKGSEFLLANDIDNSNP IVQAEQLNWLHYLMNFGSITGNNDNANFDGIRVDAVDNVDADLLKIAGDYFKALYGTDKSDANANKHLSILEDWN GKDPQYVNQQGNAQLTMDYTVTSQFGNSLTHGANNRSNMWYFLDTGYYLNGDLNKKIVDKNRPSGTLVNRIANSG DTKVIPNYSFVRAHDYDAQDPIRKAMIDHGIIKNMQDTFTFDQLAQGMEFYYKDQENPSGFKKYNDYNLPSAYAM LLTNKDTVPRVYYGDMYLEGGQYMEKGTIYNPVISALLKARIKYVSGGQTMATDSSGKDLKDGETDLLTSVRFGK GIMTSDQTTTQDNSQDYKNQGIGVIVGNNPDLKLNNDKTITLHMGKAHKNQLYRALVLSNDSGIDVYDSDDKAPT LRTTNDNGDLIFHKTNTFVKQDGTIINYEMKGSLNALISGYLGVWVPVGASDSQDARTVATESSSSNDGSVFHSN AALDSNVIYEGFSNFQAMPTSPEQSTNVVIATKANLFKELGITSFELAPQYRSSGDTNYGGMSFLDSFLNNGYAF TDRYDLGFNKADGNPNPTKYGTDQDLRNAIEALHKNGMQAIADWVPDQIYALPGKEVVTATRVDERGNQLKDTDF VNLLYVANTKSSGVDYQAKYGGEFLDKLREEYPSLFKQNQVSTGQPIDASTKIKQWSAKYMNGTNILHRGAYYVL KDWATNQYFNIAKTNEVFLPLQLQNKDAQTGFISDASGVKYYSISGYQAKDTFIEDGNGNWYYFDKDGYMVRSQQ FENPIRTVESTSVNTRNGNYYFMPNGVELRKGFGTDNSGNVYYFDDQGKMVRDKYINDDANNFYHLNVDGTMSRG SeriesSEQIDNO:18:(Protein= sequenceoffructosyltransferaseof BacillussubtilisNCIMB11871) MNIKKFAKQATVLTFTTALLAGGATQAFAKETNQKPYKETYGISHITRHDMLQIPEQQKNEKYQVPEFDSSTIKN ISSAKGLDVWDSWPLQNADGTVANYHGYHIVFALAGDPKNADDTSIYMFYQKVGETSIDSWKNAGRVFKDSDKFD ANDSILKDQTQEWSGSATFTSDGKIRLFYTDFSGKHYGKQTLTTAQVNVSASDSSLNINGVEDYKSIFDGDGKTY QNVQQFIDEGNYSSGDNHTLRDPHYVEDKGHKYLVFEANTGTEDGYQGEESLFNAKYYGKSTSFFRQESQKLLQS DKKRTAELANGALGMIELNDDYTLKKVMLPLIANSTVTDEIERANVFKMNGKYLFTDSRGSKMTIDGITSNDIYM LVYVSNSLTGPYKPLNKTGLVLKMDLDPNDVTFTYSHFAVPQAKGNNVVITSYMTNRGFYADKQSTFAPSFLLNI KGKKTSVVKDSILEQGQLTVNK