DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF THE CRISPR-CAS SYSTEMS AND COMPOSITIONS FOR MODELING MUTATIONS IN LEUKOCYTES
20180255751 ยท 2018-09-13
Inventors
- Aviv Regev (Cambridge, MA)
- Oren Parnas (Jerusalem, IL)
- Marko Jovanovic (Boston, MA, US)
- Nir Hacohen (Brookline, MA)
- Thomas Eisenhaure (North Reading, MA, US)
Cpc classification
C12N2320/12
CHEMISTRY; METALLURGY
C12N15/1082
CHEMISTRY; METALLURGY
C12N9/22
CHEMISTRY; METALLURGY
C12N2750/14143
CHEMISTRY; METALLURGY
A61K48/005
HUMAN NECESSITIES
A01K2207/05
HUMAN NECESSITIES
C12N7/04
CHEMISTRY; METALLURGY
A01K2217/077
HUMAN NECESSITIES
A01K67/0271
HUMAN NECESSITIES
C12N2310/20
CHEMISTRY; METALLURGY
A01K67/0275
HUMAN NECESSITIES
C12N15/113
CHEMISTRY; METALLURGY
A01K2207/12
HUMAN NECESSITIES
C12N15/111
CHEMISTRY; METALLURGY
C12N2740/15043
CHEMISTRY; METALLURGY
A01K2267/0362
HUMAN NECESSITIES
International classification
C12N9/22
CHEMISTRY; METALLURGY
C12N15/90
CHEMISTRY; METALLURGY
C12N15/10
CHEMISTRY; METALLURGY
C12N7/04
CHEMISTRY; METALLURGY
Abstract
The invention involves a method for modulating leukocyte activity, comprising delivering to a leukocyte a vector containing nucleic acid molecule(s), whereby the leukocyte contains Cas9 and the vector expresses one or more RNAs to guide the Cas9 to introduce mutations in one or more target genetic loci in the leukocyte, thereby modulating expression of one or more genes expressed in the leukocyte. The invention also involves identifying genes associated with leukocyte responses and experimental modeling of aberrant leukocyte activation and diseases associated with leukocytes by introducing mutations into leukocytes. The invention comprehends testing putative treatments with such models, e.g., testing putative chemical compounds that may be pharmaceutically relevant for treatment or gene therapy that may be relevant for treatment, or combinations thereof. The invention allows for the study of genetic diseases and putative treatments to better understand and alleviate leukocyte associated diseases.
Claims
1-79. (canceled)
80. A method for modeling an aberrant leukocyte response or a disease associated with leukocytes, comprising delivering to leukocytes a vector containing nucleic acid molecule(s), whereby the leukocytes contain or express or are able to be induced to express or conditionally express Cas9 and the vector expresses a plurality of guides (i) to guide the Cas9 to introduce mutations in target genetic loci or (ii) to guide the Cas9 to activate or inhibit expression of target genes in the leukocytes, thereby modulating expression of one or more genes expressed in the leukocytes, wherein expression of the one or more genes is associated with the response or disease and optionally deliver donor templates and plurality of leukocyte-specific mutations or precise sequence substitutions.
81. The method of claim 80, wherein the leukocytes are derived from a non-human transgenic mammal having cells that contain or express or are able to be induced to express or conditionally express Cas9, and the vector is delivered to the leukocyte ex vivo.
82. The method of claim 80, wherein the specific mutations or precise sequence substitutions are or have been correlated to the aberrant leukocyte response or disease associated with leukocytes.
83. The method of claim 80, wherein each of the guides targets a different genetic locus associated with an aberrant leukocyte response or disease associated with leukocytes.
84. The method of claim 80, wherein the leukocytes comprise T cells and the response comprises differentiation, exhaustion, activation, or inhibition.
85. The method of claim 84, wherein the T cells are stimulated with interleukin-12 and the response comprises differentiation to a Th1 phenotype.
86. The method of claim 84, wherein the T cells are stimulated with interleukin-4 and the response comprises differentiation to a Th2 phenotype.
87. The method of claim 84, wherein the T cells are stimulated with TGF- and the response comprises differentiation to a Treg phenotype.
88. The method of claim 84, wherein the T cells are stimulated with TGF- and interleukin-6 and the response comprises differentiation to a Th17 phenotype.
89. The method of claim 84, wherein the T cells are from a transgenic mouse having cells that express Cas9 and an ovalbumin-specific -T cell receptor.
90. The method of claim 80, wherein the guides target one or more leukocyte genes so as to introduce a loss-of-function or a gain-of-function mutation.
91. The method of claim 80, wherein the guides target one or more loci which are transcriptional control elements.
92. The method of claim 81, wherein the transgenic non-human mammal comprises a non-human primate, a rodent, a canine, a bovine, an ovine, a mouse, a dog, a goat, a pig, a rabbit, or a fowl or poultry.
93. A method for modulating leukocyte activity, comprising delivering to a leukocyte a vector containing nucleic acid molecule(s), whereby the leukocyte contains or expresses or is able to be induced to express or conditionally expresses Cas9 and the vector expresses a plurality of guides to guide the Cas9 to a plurality of leukocyte-specific target loci and optionally delivers donor template(s) to introduce mutations in one or more target genetic loci in the leukocyte, thereby modulating expression of one or more genes in the leukocyte.
94. The method of any claim 93, wherein the guides target one or more genes expressed in the leukocyte so as to introduce loss-of-function or gain-of-function mutations.
95. An isolated leukocyte comprising a vector containing a nucleic acid molecule(s), wherein the leukocyte contains or expresses or is able to be induced to express or conditionally express Cas9, (i) one or more target genetic loci in the leukocyte comprise mutations derived from Cas9 activity guided by a plurality of guides encoded by the vector or (ii) expression of one or more target genes in the leukocytes is activated or inhibited by Cas9 guided by a plurality of guides encoded by the vector, and wherein expression of one or more genes in the leukocyte is modulated thereby.
96. The isolated leukocyte of claim 94, wherein the one or more target genetic loci or one or more target genes comprise a plurality pf target genetic loci or target genes associated with an aberrant leukocyte response or a disease associated with leukocytes.
97. The isolated leukocyte of claim 94, wherein the leukocyte is derived from a non-human transgenic animal having cells that contain or express or are able to be induced to express or conditionally express Cas9.
98. The isolated leukocyte of claim 97, wherein the non-human transgenic animal comprises a non-human primate, a rodent, a canine, a bovine, an ovine, a mouse, a dog, a goat, a pig, a rabbit, or a fowl or poultry.
99. A non-human transgenic mammal comprising cells that express or that are able to be induced to express or that conditionally express Cas9 and an aberrant leukocyte response or a disease associated with leukocytes, obtained or obtainable by the method of claim 80.
100. An individualized or personalized treatment of a leukocyte-associated disease in a subject in need of such treatment comprising: (a) introducing multiple mutations ex vivo in a tissue, organ, or cell line comprising Cas9-expressing leukocytes that are able to be induced to express or conditionally express Cas9, or in vivo in a transgenic non-human mammal comprising cells that express or that are able to be induced to express or that conditionally express Cas9, comprising delivering to the cell(s) of the tissue, organ, cell or mammal a vector which expresses a plurality of guides (i) to guide the Cas9 and optionally delivers one or more donor template(s) to introduce mutations in one or more target genetic loci or (ii) to guide the Cas9 to activate or inhibit expression of a target gene in the leukocytes, thereby modulating expression of one or more genes in the leukocytes; (b) testing treatment(s) for the disease on the leukocytes to which the vector has been delivered; and (c) treating the subject based on results from the testing of treatment(s) of step (b).
101. The method of claim 100, wherein the leukocytes are derived from a non-human transgenic animal having cells that contain or express or are able to be induced to express or conditionally express Cas9, and the vector is delivered to the leukocyte ex vivo.
102. The method of claim 100, wherein the disease is an immune system disorder.
103. The method of claim 100, wherein the disease is cancer.
104. A method of identifying a gene associated with a leukocyte response, comprising: (a) delivering to a plurality of leukocytes a plurality of different vectors containing nucleic acid molecule(s), whereby the leukocytes contain or express or are able to be induced to express or conditionally express Cas9 and each vector expresses a plurality of guides (i) to guide the Cas9 and optionally delivers donor template(s) to introduce mutations in different target genetic loci or (ii) to guide the Cas9 to activate or inhibit expression of target gene(s) in the leukocytes, thereby modulating expression of different genes expressed in the leukocytes; (b) measuring a response in the leukocytes; and (c) isolating leukocyte(s) in which the response is modulated following delivery of the vector, thereby identifying gene(s) or genetic elements associated with the leukocyte response.
105. The method of claim 104, wherein the genes or genetic elements associated with the leukocyte response are identified by sequencing one or more nucleic acid molecules present in the isolated or sorted leukocytes.
106. The method of claim 104, wherein the leukocyte response is activation, inhibition, exhaustion, differentiation, migration, adhesion, death or proliferation.
107. A non-human transgenic eukaryote or mammal having leukocytes that express or that are able to be induced to express or that conditionally express Cas9, and a plurality of mutations in one or more gene(s) associated with a leukocyte response or a leukocyte-associated disease.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0057] The novel features of the invention are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which:
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089] The figures herein are for illustrative purposes only and are not necessarily drawn to scale.
DETAILED DESCRIPTION OF THE INVENTION
[0090] There are currently two major strategies for associating targets with their putative regulators on a genomic scale (reviewed in (Kim et al., 2009)): (1) observational (correlative) approaches that relate them based on statistical dependencies in their quantities or physical associations; and (2) perturbational (causal) approaches, that relate them by the effect that a perturbation in a putative regulator has on its target.
[0091] In an aspect of the invention, Applicants adapt the CRISPR-Cas9 technology to develop a marker based genome-wide knockout screen in primary mammalian cells derived from Cas9-expressing transgenic mice, and applied it to dissect gene regulatory circuits in the response of DCs to LPS. In an aspect of the invention, Applicants infect DCs with a pooled, genome-wide library of lentiviruses, stimulate them with LPS, and monitor their responses by intra-cellular staining for the inflammatory cytokine TNF, a major marker of the early response to LPS.
[0092] In a further aspect, Applicants use Fluorescence Activated Cell Sorting (FACS) to isolate cells that failed to respond to LPS (i.e., caused by a loss-of-function mutation in a positive regulator) or that responded more strongly (i.e., caused by a loss-of-function mutation in a negative regulator), and determine their resident sgRNAs by deep sequencing. Many of the key known regulators of TLR signaling are recovered as the highest regulators in the screen. In a further aspect, Applicants analyze each of 57 validated positive regulators by their effect on four additional protein markers reflecting different aspects of DC biology, and on genome wide expression profiles at four time points post LPS, identify 3 key functional modules, each with a distinct regulatory effect. These modules allow one to relate new regulators to their functions by a guilt-by-functional-association approach, as well as highlight novel distinctive functions in the response. These include roles for the members of the PAF complex, involved in RNA transcription and processing, and of the OST complex important for protein glycosylation. Applicants identify new facets in the complex response of immune cells to pathogens, and provide a general strategy for systematically dissecting circuits in other primary mammalian cells.
[0093] In an aspect of the invention, Applicants provide a new method to investigate modules and factors in immune pathways applicable across diverse biological systems. In a further aspect of the invention, the methods provided are coupled with advances in single cell profiling that bridge the gap between genome-wide pooled screens and deep molecular readouts.
[0094] With respect to single cell genomic readouts, methods such as DropSeq may be employed. Drop-seq is a method which enables highly parallel analysis of individual cells by RNA-seq. Specifically, the RNA content of tens and hundreds of thousands of individual human cells are profiled quickly and inexpensively. In an embodiment of Drop-Seq, special microfluidic devices are used to encapsulate each cell in an individual drop, associate the RNA of each cell with a cell barcode unique to that cell/drop, measure the expression level of each RNA with sequencing, and then use the cell barcodes to determine which cell each RNA molecule came from. (Macosko et al., 2015, Cell 161, 1202-1214)
[0095] Currently, techniques or instruments for single molecule or single cell analysis exist (e.g., digital polymerase chain reactions (PCR) or Fluidigm C1, respectively), however none currently allow a scalable method for dynamically delivering reagents and/or appending molecular information to individual reactions such that a large population of reactions/assays can be processed and analyzed en masse while still maintaining the ability to partition results by individual reactions/assays. It is an aspect of the present invention to provide a method to screen pathways and modules of interest in systems such as immune diseases coupled to current advances in DropSeq methodology.
[0096] In a further aspect, Droplet microfluidics offers significant advantages for performing high-throughput screens and sensitive assays. Droplets allow sample volumes to be significantly reduced, leading to concomitant reductions in cost. Manipulation and measurement at kilohertz speeds enable up to 108 discrete biological entities (including, but not limited to, individual cells or organelles) to be screened in a single day. Compartmentalization in droplets increases assay sensitivity by increasing the effective concentration of rare species and decreasing the time required to reach detection thresholds. Droplet microfluidics combines these powerful features to enable currently inaccessible high-throughput screening applications, including single-cell and single-molecule assays. (Klein et al., 2015, Cell 161, 1187-1201).
[0097] With respect to general information on CRISPR-Cas Systems, components thereof, and delivery of such components, including methods, materials, delivery vehicles, vectors, particles, AAV, and making and using thereof, including as to amounts and formulations, all useful in the practice of the instant invention, reference is made to: U.S. Pat. Nos. 8,999,641, 8,993,233, 8,945,839, 8,932,814, 8,906,616, 8,895,308, 8,889,418, 8,889,356, 8,871,445, 8,865,406, 8,795,965, 8,771,945 and 8,697,359; US Patent Publications US 2014-0310830 (U.S. application Ser. No. 14/105,031), US 2014-0287938 A1 (U.S. application Ser. No. 14/213,991), US 2014-0273234 A1 (U.S. application Ser. No. 14/293,674), US2014-0273232 A1 (U.S. application Ser. No. 14/290,575), US 2014-0273231 (U.S. application Ser. No. 14/259,420), US 2014-0256046 A1 (U.S. application Ser. No. 14/226,274), US 2014-0248702 A1 (U.S. application Ser. No. 14/258,458), US 2014-0242700 A1 (U.S. application Ser. No. 14/222,930), US 2014-0242699 A1 (U.S. application Ser. No. 14/183,512), US 2014-0242664 A1 (U.S. application Ser. No. 14/104,990), US 2014-0234972 A1 (U.S. application Ser. No. 14/183,471), US 2014-0227787 A1 (U.S. application Ser. No. 14/256,912), US 2014-0189896 A1 (U.S. application Ser. No. 14/105,035), US 2014-0186958 (U.S. application Ser. No. 14/105,017), US 2014-0186919 A1 (U.S. application Ser. No. 14/104,977), US 2014-0186843 A1 (U.S. application Ser. No. 14/104,900), US 2014-0179770 A1 (U.S. application Ser. No. 14/104,837) and US 2014-0179006 A1 (U.S. application Ser. No. 14/183,486), US 2014-0170753 (U.S. application Ser. No. 14/183,429); European Patents EP 2 784 162 B1 and EP 2 771 468 B1; European Patent Applications EP 2 771 468 (EP13818570.7), EP 2 764 103 (EP13824232.6), and EP 2 784 162 (EP14170383.5); and PCT Patent Publications PCT Patent Publications WO 2014/093661 (PCT/US2013/074743), WO 2014/093694 (PCT/US2013/074790), WO 2014/093595 (PCT/US2013/074611), WO 2014/093718 (PCT/US2013/074825), WO 2014/093709 (PCT/US2013/074812), WO 2014/093622 (PCT/US2013/074667), WO 2014/093635 (PCT/US2013/074691), WO 2014/093655 (PCT/US2013/074736), WO 2014/093712 (PCT/US2013/074819), WO2014/093701 (PCT/US2013/074800), WO2014/018423 (PCT/US2013/051418), WO 2014/204723 (PCT/US2014/041790), WO 2014/204724 (PCT/US2014/041800), WO 2014/204725 (PCT/US2014/041803), WO 2014/204726 (PCT/US2014/041804), WO 2014/204727 (PCT/US2014/041806), WO 2014/204728 (PCT/US2014/041808), WO 2014/204729 (PCT/US2014/041809). Reference is also made to U.S. provisional patent applications 61/758,468; 61/802,174; 61/806,375; 61/814,263; 61/819,803 and 61/828,130, filed on Jan. 30, 2013; Mar. 15, 2013; Mar. 28, 2013; Apr. 20, 2013; May 6, 2013 and May 28, 2013 respectively. Reference is also made to U.S. provisional patent application 61/836,123, filed on Jun. 17, 2013. Reference is additionally made to U.S. provisional patent applications 61/835,931, 61/835,936, 61/836,127, 61/836,101, 61/836,080 and 61/835,973, each filed Jun. 17, 2013. Further reference is made to U.S. provisional patent applications 61/862,468 and 61/862,355 filed on Aug. 5, 2013; 61/871,301 filed on Aug. 28, 2013; 61/960,777 filed on Sep. 25, 2013 and 61/961,980 filed on Oct. 28, 2013. Reference is yet further made to: PCT Patent applications Nos: PCT/US2014/041803, PCT/US2014/041800, PCT/US2014/041809, PCT/US2014/041804 and PCT/US2014/041806, each filed Jun. 10, 2014 6/10/14; PCT/US2014/041808 filed Jun. 11, 2014; and PCT/US2014/62558 filed Oct. 28, 2014, and U.S. Provisional Patent Applications Ser. Nos. 61/915,150, 61/915,301, 61/915,267 and 61/915,260, each filed Dec. 12, 2013; 61/757,972 and 61/768,959, filed on Jan. 29, 2013 and Feb. 25, 2013; 61/835,936, 61/836,127, 61/836,101, 61/836,080, 61/835,973, and 61/835,931, filed Jun. 17, 2013; 62/010,888 and 62/010,879, both filed Jun. 11, 2014; 62/010,329 and 62/010,441, each filed Jun. 10, 2014; 61/939,228 and 61/939,242, each filed Feb. 12, 2014; 61/980,012, filed Apr. 15, 2014; 62/038,358, filed Aug. 17, 2014; 62/054,490, 62/055,484, 62/055,460 and 62/055,487, each filed Sep. 25, 2014; and 62/069,243, filed Oct. 27, 2014. Reference is also made to U.S. provisional patent applications Nos. 62/055,484, 62/055,460, and 62/055,487, filed Sep. 25, 2014; U.S. provisional patent application 61/980,012, filed Apr. 15, 2014; and U.S. provisional patent application 61/939,242 filed Feb. 12, 2014. Reference is made to PCT application designating, inter alia, the United States, application No. PCT/US14/41806, filed Jun. 10, 2014. Reference is made to U.S. provisional patent application 61/930,214 filed on Jan. 22, 2014. Reference is made to U.S. provisional patent applications 61/915,251; 61/915,260 and 61/915,267, each filed on Dec. 12, 2013. Reference is made to US provisional patent application U.S. Ser. No. 61/980,012 filed Apr. 15, 2014. Reference is made to PCT application designating, inter alia, the United States, application No. PCT/US14/41806, filed Jun. 10, 2014. Reference is made to U.S. provisional patent application 61/930,214 filed on Jan. 22, 2014. Reference is made to U.S. provisional patent applications 61/915,251; 61/915,260 and 61/915,267, each filed on Dec. 12, 2013.
[0098] Mention is also made of U.S. application 62/091,455, filed, 12 Dec. 2014, PROTECTED GUIDE RNAS (PGRNAS); U.S. application 62/096,708, 24 Dec. 2014, PROTECTED GUIDE RNAS (PGRNAS); U.S. application 62/091,462, 12 Dec. 2014, DEAD GUIDES FOR CRISPR TRANSCRIPTION FACTORS; U.S. application 62/096,324, 23 Dec. 2014, DEAD GUIDES FOR CRISPR TRANSCRIPTION FACTORS; U.S. application 62/091,456, 12 Dec. 2014, ESCORTED AND FUNCTIONALIZED GUIDES FOR CRISPR-CAS SYSTEMS; U.S. application 62/091,461, 12 Dec. 2014, DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF THE CRISPR-CAS SYSTEMS AND COMPOSITIONS FOR GENOME EDITING AS TO HEMATOPOETIC STEM CELLS (HSCs); U.S. application 62/094,903, 19 Dec. 2014, UNBIASED IDENTIFICATION OF DOUBLE-STRAND BREAKS AND GENOMIC REARRANGEMENT BY GENOME-WISE INSERT CAPTURE SEQUENCING; U.S. application 62/096,761, 24 Dec. 2014, ENGINEERING OF SYSTEMS, METHODS AND OPTIMIZED ENZYME AND GUIDE SCAFFOLDS FOR SEQUENCE MANIPULATION; U.S. application 62/098,059, 30 Dec. 2014, RNA-TARGETING SYSTEM; U.S. application 62/096,656, 24 Dec. 2014, CRISPR HAVING OR ASSOCIATED WITH DESTABILIZATION DOMAINS; U.S. application 62/096,697, 24 Dec. 2014, CRISPR HAVING OR ASSOCIATED WITH AAV; U.S. application 62/098,158, 30 Dec. 2014, ENGINEERED CRISPR COMPLEX INSERTIONAL TARGETING SYSTEMS; U.S. application 62/151,052, 22 Apr. 2015, CELLULAR TARGETING FOR EXTRACELLULAR EXOSOMAL REPORTING; U.S. application 62/054,490, 24 Sep. 2014, DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF THE CRISPR-CAS SYSTEMS AND COMPOSITIONS FOR TARGETING DISORDERS AND DISEASES USING PARTICLE DELIVERY COMPONENTS; U.S. application 62/055,484, 25 Sep. 2014, SYSTEMS, METHODS AND COMPOSITIONS FOR SEQUENCE MANIPULATION WITH OPTIMIZED FUNCTIONAL CRISPR-CAS SYSTEMS; U.S. application 62/087,537, 4 Dec. 2014, SYSTEMS, METHODS AND COMPOSITIONS FOR SEQUENCE MANIPULATION WITH OPTIMIZED FUNCTIONAL CRISPR-CAS SYSTEMS; U.S. application 62/054,651, 24 Sep. 2014, DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF THE CRISPR-CAS SYSTEMS AND COMPOSITIONS FOR MODELING COMPETITION OF MULTIPLE CANCER MUTATIONS IN VIVO; U.S. application 62/067,886, 23 Oct. 2014, DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF THE CRISPR-CAS SYSTEMS AND COMPOSITIONS FOR MODELING COMPETITION OF MULTIPLE CANCER MUTATIONS IN VIVO; U.S. application 62/054,675, 24 Sep. 2014, DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF THE CRISPR-CAS SYSTEMS AND COMPOSITIONS IN NEURONAL CELLS/TISSUES; U.S. application 62/054,528, 24 Sep. 2014, DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF THE CRISPR-CAS SYSTEMS AND COMPOSITIONS IN IMMUNE DISEASES OR DISORDERS; U.S. application 62/055,454, 25 Sep. 2014, DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF THE CRISPR-CAS SYSTEMS AND COMPOSITIONS FOR TARGETING DISORDERS AND DISEASES USING CELL PENETRATION PEPTIDES (CPP); U.S. application 62/055,460, 25 Sep. 2014, MULTIFUNCTIONAL-CRISPR COMPLEXES AND/OR OPTIMIZED ENZYME LINKED FUNCTIONAL-CRISPR COMPLEXES; U.S. application 62/087,475, 4 Dec. 2014, FUNCTIONAL SCREENING WITH OPTIMIZED FUNCTIONAL CRISPR-CAS SYSTEMS; U.S. application 62/055,487, 25 Sep. 2014, FUNCTIONAL SCREENING WITH OPTIMIZED FUNCTIONAL CRISPR-CAS SYSTEMS; U.S. application 62/087,546, 4 Dec. 2014, MULTIFUNCTIONAL CRISPR COMPLEXES AND/OR OPTIMIZED ENZYME LINKED FUNCTIONAL-CRISPR COMPLEXES; and U.S. application 62/098,285, 30 Dec. 2014, CRISPR MEDIATED IN VIVO MODELING AND GENETIC SCREENING OF TUMOR GROWTH AND METASTASIS.
[0099] Each of these patents, patent publications, and applications, and all documents cited therein or during their prosecution (appln cited documents) and all documents cited or referenced in the appln cited documents, together with any instructions, descriptions, product specifications, and product sheets for any products mentioned therein or in any document therein and incorporated by reference herein, are hereby incorporated herein by reference, and may be employed in the practice of the invention. All documents (e.g., these patents, patent publications and applications and the appln cited documents) are incorporated herein by reference to the same extent as if each individual document was specifically and individually indicated to be incorporated by reference.
[0100] Also with respect to general information on CRISPR-Cas Systems, mention is made of the following (also hereby incorporated herein by reference): [0101] Multiplex genome engineering using CRISPR/Cas systems. Cong, L., Ran, F. A., Cox, D., Lin, S., Barretto, R., Habib, N., Hsu, P. D., Wu, X., Jiang, W., Marraffini, L. A., & Zhang, F. Science February 15; 339(6121):819-23 (2013); [0102] RNA-guided editing of bacterial genomes using CRISPR-Cas systems. Jiang W., Bikard D., Cox D., Zhang F, Marraffini L A. Nat Biotechnol March; 31(3):233-9 (2013); [0103] One-Step Generation of Mice Carrying Mutations in Multiple Genes by CRISPR/Cas-Mediated Genome Engineering. Wang H., Yang H., Shivalila C S., Dawlaty M M., Cheng A W., Zhang F., Jaenisch R. Cell May 9; 153(4):910-8 (2013); [0104] Optical control of mammalian endogenous transcription and epigenetic states. Konermann S, Brigham M D, Trevino A E, Hsu P D, Heidenreich M, Cong L, Platt R J, Scott D A, Church G M, Zhang F. Nature. August 22; 500(7463):472-6. doi: 10.1038/Nature12466. Epub 2013 Aug. 23 (2013); [0105] Double Nicking by RNA-Guided CRISPR Cas9 for Enhanced Genome Editing Specificity. Ran, F A., Hsu, P D., Lin, C Y., Gootenberg, J S., Konermann, S., Trevino, A E., Scott, D A., Inoue, A., Matoba, S., Zhang, Y., & Zhang, F. Cell August 28. pii: S0092-8674(13)01015-5 (2013-A); [0106] DNA targeting specificity of RNA-guided Cas9 nucleases. Hsu, P., Scott, D., Weinstein, J., Ran, F A., Konermann, S., Agarwala, V., Li, Y., Fine, E., Wu, X., Shalem, O., Cradick, T J., Marraffini, L A., Bao, G., & Zhang, F. Nat Biotechnol doi:10.1038/nbt.2647 (2013); [0107] Genome engineering using the CRISPR-Cas9 system. Ran, F A., Hsu, P D., Wright, J., Agarwala, V., Scott, D A., Zhang, F. Nature Protocols November; 8(11):2281-308 (2013-B); [0108] Genome-Scale CRISPR-Cas9 Knockout Screening in Human Cells. Shalem, O., Sanjana, N E., Hartenian, E., Shi, X., Scott, D A., Mikkelson, T., Heckl, D., Ebert, B L., Root, D E., Doench, J G., Zhang, F. Science December 12. (2013). [Epub ahead of print]; [0109] Crystal structure of cas9 in complex with guide RNA and target DNA. Nishimasu, H., Ran, F A., Hsu, P D., Konermann, S., Shehata, S I., Dohmae, N., Ishitani, R., Zhang, F., Nureki, O. Cell February 27, 156(5):935-49 (2014); [0110] Genome-wide binding of the CRISPR endonuclease Cas9 in mammalian cells. Wu X., Scott D A., Kriz A J., Chiu A C., Hsu P D., Dadon D B., Cheng A W., Trevino A E., Konermann S., Chen S., Jaenisch R., Zhang F., Sharp P A. Nat Biotechnol. April 20. doi: 10.1038/nbt.2889 (2014); [0111] CRISPR-Cas9 Knockin Mice for Genome Editing and Cancer Modeling. Platt R J, Chen S, Zhou Y, Yim M J, Swiech L, Kempton H R, Dahlman J E, Parnas O, Eisenhaure T M, Jovanovic M, Graham D B, Jhunjhunwala S, Heidenreich M, Xavier R J, Langer R, Anderson D G, Hacohen N, Regev A, Feng G, Sharp P A, Zhang F. Cell 159(2): 440-455 DOI: 10.1016/j.cell.2014.09.014(2014); [0112] Development and Applications of CRISPR-Cas9 for Genome Engineering, Hsu P D, Lander E S, Zhang F., Cell. June 5; 157(6):1262-78 (2014). [0113] Genetic screens in human cells using the CRISPR/Cas9 system, Wang T, Wei J J, Sabatini D M, Lander E S., Science. January 3; 343(6166): 80-84. doi:10.1126/science.1246981 (2014); [0114] Rational design of highly active sgRNAs for CRISPR-Cas9-mediated gene inactivation, Doench J G, Hartenian E, Graham D B, Tothova Z, Hegde M, Smith I, Sullender M, Ebert B L, Xavier R J, Root D E., (published online 3 Sep. 2014) Nat Biotechnol. December; 32(12):1262-7 (2014); [0115] In vivo interrogation of gene function in the mammalian brain using CRISPR-Cas9, Swiech L, Heidenreich M, Banerjee A, Habib N, Li Y, Trombetta J, Sur M, Zhang F., (published online 19 Oct. 2014) Nat Biotechnol. January; 33(1):102-6 (2015); [0116] Genome-scale transcriptional activation by an engineered CRISPR-Cas9 complex, Konermann S, Brigham M D, Trevino A E, Joung J, Abudayyeh O O, Barcena C, Hsu P D, Habib N, Gootenberg J S, Nishimasu H, Nureki O, Zhang F., Nature. Jan. 29; 517(7536):583-8 (2015). [0117] A split-Cas9 architecture for inducible genome editing and transcription modulation, Zetsche B, Volz S E, Zhang F., (published online 2 Feb. 2015) Nat Biotechnol. February; 33(2):139-42 (2015); [0118] Genome-wide CRISPR Screen in a Mouse Model of Tumor Growth and Metastasis, Chen S, Sanjana N E, Zheng K, Shalem O, Lee K, Shi X, Scott D A, Song J, Pan J Q, Weissleder R, Lee H, Zhang F, Sharp P A. Cell 160, 1246-1260, Mar. 12, 2015 (multiplex screen in mouse), and [0119] In vivo genome editing using Staphylococcus aureus Cas9, Ran F A, Cong L, Yan W X, Scott D A, Gootenberg J S, Kriz A J, Zetsche B, Shalem O, Wu X, Makarova K S, Koonin E V, Sharp P A, Zhang F., (published online 1 Apr. 2015), Nature. April 9; 520(7546):186-91 (2015).
each of which is incorporated herein by reference, may be considered in the practice of the instant invention, and discussed briefly below: [0120] Cong et al. engineered type II CRISPR-Cas systems for use in eukaryotic cells based on both Streptococcus thermophilus Cas9 and also Streptococcus pyogenes Cas9 and demonstrated that Cas9 nucleases can be directed by short RNAs to induce precise cleavage of DNA in human and mouse cells. Their study further showed that Cas9 as converted into a nicking enzyme can be used to facilitate homology-directed repair in eukaryotic cells with minimal mutagenic activity. Additionally, their study demonstrated that multiple guide sequences can be encoded into a single CRISPR array to enable simultaneous editing of several at endogenous genomic loci sites within the mammalian genome, demonstrating easy programmability and wide applicability of the RNA-guided nuclease technology. This ability to use RNA to program sequence specific DNA cleavage in cells defined a new class of genome engineering tools. These studies further showed that other CRISPR loci are likely to be transplantable into mammalian cells and can also mediate mammalian genome cleavage. Importantly, it can be envisaged that several aspects of the CRISPR-Cas system can be further improved to increase its efficiency and versatility. [0121] Jiang et al. used the clustered, regularly interspaced, short palindromic repeats (CRISPR)-associated Cas9 endonuclease complexed with dual-RNAs to introduce precise mutations in the genomes of Streptococcus pneumoniae and Escherichia coli. The approach relied on dual-RNA:Cas9-directed cleavage at the targeted genomic site to kill unmutated cells and circumvents the need for selectable markers or counter-selection systems. The study reported reprogramming dual-RNA:Cas9 specificity by changing the sequence of short CRISPR RNA (crRNA) to make single- and multinucleotide changes carried on editing templates. The study showed that simultaneous use of two crRNAs enabled multiplex mutagenesis. Furthermore, when the approach was used in combination with recombineering, in S. pneumoniae, nearly 100% of cells that were recovered using the described approach contained the desired mutation, and in E. coli, 65% that were recovered contained the mutation. [0122] Wang et al. (2013) used the CRISPR/Cas system for the one-step generation of mice carrying mutations in multiple genes which were traditionally generated in multiple steps by sequential recombination in embryonic stem cells and/or time-consuming intercrossing of mice with a single mutation. The CRISPR/Cas system will greatly accelerate the in vivo study of functionally redundant genes and of epistatic gene interactions. [0123] Konermann et al. (2013) addressed the need in the art for versatile and robust technologies that enable optical and chemical modulation of DNA-binding domains based CRISPR Cas9 enzyme and also Transcriptional Activator Like Effectors [0124] Ran et al. (2013-A) described an approach that combined a Cas9 nickase mutant with paired guide RNAs to introduce targeted double-strand breaks. This addresses the issue of the Cas9 nuclease from the microbial CRISPR-Cas system being targeted to specific genomic loci by a guide sequence, which can tolerate certain mismatches to the DNA target and thereby promote undesired off-target mutagenesis. Because individual nicks in the genome are repaired with high fidelity, simultaneous nicking via appropriately offset guide RNAs is required for double-stranded breaks and extends the number of specifically recognized bases for target cleavage. The authors demonstrated that using paired nicking can reduce off-target activity by 50- to 1,500-fold in cell lines and to facilitate gene knockout in mouse zygotes without sacrificing on-target cleavage efficiency. This versatile strategy enables a wide variety of genome editing applications that require high specificity. [0125] Hsu et al. (2013) characterized SpCas9 targeting specificity in human cells to inform the selection of target sites and avoid off-target effects. The study evaluated >700 guide RNA variants and SpCas9-induced indel mutation levels at >100 predicted genomic off-target loci in 293T and 293FT cells. The authors that SpCas9 tolerates mismatches between guide RNA and target DNA at different positions in a sequence-dependent manner, sensitive to the number, position and distribution of mismatches. The authors further showed that SpCas9-mediated cleavage is unaffected by DNA methylation and that the dosage of SpCas9 and sgRNA can be titrated to minimize off-target modification. Additionally, to facilitate mammalian genome engineering applications, the authors reported providing a web-based software tool to guide the selection and validation of target sequences as well as off-target analyses. [0126] Ran et al. (2013-B) described a set of tools for Cas9-mediated genome editing via non-homologous end joining (NHEJ) or homology-directed repair (HDR) in mammalian cells, as well as generation of modified cell lines for downstream functional studies. To minimize off-target cleavage, the authors further described a double-nicking strategy using the Cas9 nickase mutant with paired guide RNAs. The protocol provided by the authors experimentally derived guidelines for the selection of target sites, evaluation of cleavage efficiency and analysis of off-target activity. The studies showed that beginning with target design, gene modifications can be achieved within as little as 1-2 weeks, and modified clonal cell lines can be derived within 2-3 weeks. [0127] Shalem et al. described a new way to interrogate gene function on a genome-wide scale. Their studies showed that delivery of a genome-scale CRISPR-Cas9 knockout (GeCKO) library targeted 18,080 genes with 64,751 unique guide sequences enabled both negative and positive selection screening in human cells. First, the authors showed use of the GeCKO library to identify genes essential for cell viability in cancer and pluripotent stem cells. Next, in a melanoma model, the authors screened for genes whose loss is involved in resistance to vemurafenib, a therapeutic that inhibits mutant protein kinase BRAF. Their studies showed that the highest-ranking candidates included previously validated genes NF1 and MED12 as well as novel hits NF2, CUL3, TADA2B, and TADA1. The authors observed a high level of consistency between independent guide RNAs targeting the same gene and a high rate of hit confirmation, and thus demonstrated the promise of genome-scale screening with Cas9. [0128] Nishimasu et al. reported the crystal structure of Streptococcus pyogenes Cas9 in complex with sgRNA and its target DNA at 2.5 A resolution. The structure revealed a bilobed architecture composed of target recognition and nuclease lobes, accommodating the sgRNA:DNA heteroduplex in a positively charged groove at their interface. Whereas the recognition lobe is essential for binding sgRNA and DNA, the nuclease lobe contains the HNH and RuvC nuclease domains, which are properly positioned for cleavage of the complementary and non-complementary strands of the target DNA, respectively. The nuclease lobe also contains a carboxyl-terminal domain responsible for the interaction with the protospacer adjacent motif (PAM). This high-resolution structure and accompanying functional analyses have revealed the molecular mechanism of RNA-guided DNA targeting by Cas9, thus paving the way for the rational design of new, versatile genome-editing technologies. [0129] Wu et al. mapped genome-wide binding sites of a catalytically inactive Cas9 (dCas9) from Streptococcus pyogenes loaded with single guide RNAs (sgRNAs) in mouse embryonic stem cells (mESCs). The authors showed that each of the four sgRNAs tested targets dCas9 to between tens and thousands of genomic sites, frequently characterized by a 5-nucleotide seed region in the sgRNA and an NGG protospacer adjacent motif (PAM). Chromatin inaccessibility decreases dCas9 binding to other sites with matching seed sequences; thus 70% of off-target sites are associated with genes. The authors showed that targeted sequencing of 295 dCas9 binding sites in mESCs transfected with catalytically active Cas9 identified only one site mutated above background levels. The authors proposed a two-state model for Cas9 binding and cleavage, in which a seed match triggers binding but extensive pairing with target DNA is required for cleavage. [0130] Platt et al. established a Cre-dependent Cas9 knockin mouse. The authors demonstrated in vivo as well as ex vivo genome editing using adeno-associated virus (AAV)-, lentivirus-, or particle-mediated delivery of guide RNA in neurons, immune cells, and endothelial cells. [0131] Hsu et al. (2014) is a review article that discusses generally CRISPR-Cas9 history from yogurt to genome editing, including genetic screening of cells. [0132] Wang et al. (2014) relates to a pooled, loss-of-function genetic screening approach suitable for both positive and negative selection that uses a genome-scale lentiviral single guide RNA (sgRNA) library. [0133] Doench et al. created a pool of sgRNAs, tiling across all possible target sites of a panel of six endogenous mouse and three endogenous human genes and quantitatively assessed their ability to produce null alleles of their target gene by antibody staining and flow cytometry. The authors showed that optimization of the PAM improved activity and also provided an on-line tool for designing sgRNAs. [0134] Swiech et al. demonstrate that AAV-mediated SpCas9 genome editing can enable reverse genetic studies of gene function in the brain. [0135] Konermann et al. (2015) discusses the ability to attach multiple effector domains, e.g., transcriptional activator, functional and epigenomic regulators at appropriate positions on the guide such as stem or tetraloop with and without linkers. [0136] Zetsche et al. demonstrates that the Cas9 enzyme can be split into two and hence the assembly of Cas9 for activation can be controlled. [0137] Chen et al. relates to multiplex screening by demonstrating that a genome-wide in vivo CRISPR-Cas9 screen in mice reveals genes regulating lung metastasis. [0138] Ran et al. (2015) relates to SaCas9 and its ability to edit genomes and demonstrates that one cannot extrapolate from biochemical assays.
[0139] Also, Dimeric CRISPR RNA-guided FokI nucleases for highly specific genome editing, Shengdar Q. Tsai, Nicolas Wyvekens, Cyd Khayter, Jennifer A. Foden, Vishal Thapar, Deepak Reyon, Mathew J. Goodwin, Martin J. Aryee, J. Keith Joung Nature Biotechnology 32(6): 569-77 (2014), relates to dimeric RNA-guided FokI Nucleases that recognize extended sequences and can edit endogenous genes with high efficiencies in human cells.
[0140] In general, the CRISPR-Cas or CRISPR system is as used in the foregoing documents, such as WO 2014/093622 (PCT/US2013/074667) and refers collectively to transcripts and other elements involved in the expression of or directing the activity of CRISPR-associated (Cas) genes, including sequences encoding a Cas gene, a tracr (trans-activating CRISPR) sequence (e.g. tracrRNA or an active partial tracrRNA), a tracr-mate sequence (encompassing a direct repeat and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system), a guide sequence (also referred to as a spacer in the context of an endogenous CRISPR system), or RNA(s) as that term is herein used (e.g., RNA(s) to guide Cas9, e.g. CRISPR RNA and transactivating (tracr) RNA or a single guide RNA (sgRNA) (chimeric RNA)) or other sequences and transcripts from a CRISPR locus. In general, a CRISPR system is characterized by elements that promote the formation of a CRISPR complex at the site of a target sequence (also referred to as a protospacer in the context of an endogenous CRISPR system). In the context of formation of a CRISPR complex, target sequence refers to a sequence to which a guide sequence is designed to have complementarity, where hybridization between a target sequence and a guide sequence promotes the formation of a CRISPR complex. A target sequence may comprise any polynucleotide, such as DNA or RNA polynucleotides. In some embodiments, a target sequence is located in the nucleus or cytoplasm of a cell. In some embodiments, direct repeats may be identified in silico by searching for repetitive motifs that fulfill any or all of the following criteria: 1. found in a 2 Kb window of genomic sequence flanking the type II CRISPR locus; 2. span from 20 to 50 bp; and 3. interspaced by 20 to 50 bp. In some embodiments, 2 of these criteria may be used, for instance 1 and 2, 2 and 3, or 1 and 3. In some embodiments, all 3 criteria may be used.
[0141] In embodiments of the invention the terms guide sequence and guide RNA are used interchangeably as in foregoing cited documents such as WO 2014/093622 (PCT/US2013/074667). In general, a guide sequence is any polynucleotide sequence having sufficient complementarity with a target polynucleotide sequence to hybridize with the target sequence and direct sequence-specific binding of a CRISPR complex to the target sequence. In some embodiments, the degree of complementarity between a guide sequence and its corresponding target sequence, when optimally aligned using a suitable alignment algorithm, is about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more. Optimal alignment may be determined with the use of any suitable algorithm for aligning sequences, non-limiting example of which include the Smith-Waterman algorithm, the Needleman-Wunsch algorithm, algorithms based on the Burrows-Wheeler Transform (e.g. the Burrows Wheeler Aligner), ClustalW, Clustal X, BLAT, Novoalign (Novocraft Technologies; available at www.novocraft.com), ELAND (Illumina, San Diego, Calif.), SOAP (available at soap.genomics.org.cn), and Maq (available at maq.sourceforge.net). In some embodiments, a guide sequence is about or more than about 5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 75, or more nucleotides in length. In some embodiments, a guide sequence is less than about 75, 50, 45, 40, 35, 30, 25, 20, 15, 12, or fewer nucleotides in length. The ability of a guide sequence to direct sequence-specific binding of a CRISPR complex to a target sequence may be assessed by any suitable assay. For example, the components of a CRISPR system sufficient to form a CRISPR complex, including the guide sequence to be tested, may be provided to a host cell having the corresponding target sequence, such as by transfection with vectors encoding the components of the CRISPR sequence, followed by an assessment of preferential cleavage within the target sequence, such as by Surveyor assay as described herein. Similarly, cleavage of a target polynucleotide sequence may be evaluated in a test tube by providing the target sequence, components of a CRISPR complex, including the guide sequence to be tested and a control guide sequence different from the test guide sequence, and comparing binding or rate of cleavage at the target sequence between the test and control guide sequence reactions. Other assays are possible, and will occur to those skilled in the art.
[0142] A guide sequence may be selected to target any target sequence. In some embodiments, the target sequence is a sequence within a genome of a cell. Exemplary target sequences include those that are unique in the target genome. In some embodiments, the target sequence is comprised in a gene expressed in leukocytes, particularly a gene associated with leukocyte responses or a leukocyte-associated disease. In some embodiments, a guide sequence is selected to reduce the degree of secondary structure within the guide sequence. In some embodiments, about or less than about 75%, 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 1%, or fewer of the nucleotides of the guide sequence participate in self-complementary base pairing when optimally folded. Optimal folding may be determined by any suitable polynucleotide folding algorithm. Some programs are based on calculating the minimal Gibbs free energy. An example of one such algorithm is mFold, as described by Zuker and Stiegler (Nucleic Acids Res. 9 (1981), 133-148). Another example folding algorithm is the online webserver RNAfold, developed at Institute for Theoretical Chemistry at the University of Vienna, using the centroid structure prediction algorithm (see e.g. A. R. Gruber et al., 2008, Cell 106(1): 23-24; and P A Carr and G M Church, 2009, Nature Biotechnology 27(12): 1151-62).
[0143] In general, a tracr mate sequence includes any sequence that has sufficient complementarity with a tracr sequence to promote one or more of: (1) excision of a guide sequence flanked by tracr mate sequences in a cell containing the corresponding tracr sequence; and (2) formation of a CRISPR complex at a target sequence, wherein the CRISPR complex comprises the tracr mate sequence hybridized to the tracr sequence. In general, degree of complementarity is with reference to the optimal alignment of the tracr mate sequence and tracr sequence, along the length of the shorter of the two sequences. Optimal alignment may be determined by any suitable alignment algorithm, and may further account for secondary structures, such as self-complementarity within either the tracr sequence or tracr mate sequence. In some embodiments, the degree of complementarity between the tracr sequence and tracr mate sequence along the length of the shorter of the two when optimally aligned is about or more than about 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97.5%, 99%, or higher. In some embodiments, the tracr sequence is about or more than about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, or more nucleotides in length. In some embodiments, the tracr sequence and tracr mate sequence are contained within a single transcript, such that hybridization between the two produces a transcript having a secondary structure, such as a hairpin. In an embodiment of the invention, the transcript or transcribed polynucleotide sequence has at least two or more hairpins. In preferred embodiments, the transcript has two, three, four or five hairpins. In a further embodiment of the invention, the transcript has at most five hairpins. In a hairpin structure the portion of the sequence 5 of the final N and upstream of the loop corresponds to the tracr mate sequence, and the portion of the sequence 3 of the loop corresponds to the tracr sequence Further non-limiting examples of single polynucleotides comprising a guide sequence, a tracr mate sequence, and a tracr sequence are as follows (listed 5 to 3), where N represents a base of a guide sequence, the first block of lower case letters represent the tracr mate sequence, and the second block of lower case letters represent the tracr sequence, and the final poly-T sequence represents the transcription terminator: (1) NNNNNNNNNNNNNNNNNNNNgtttttgtactctcaagatttaGAAAtaaatcttgcagaagctacaaagataa ggcttcatgccgaaatcaacaccctgtcattttatggcagggtgttttcgttatttaaTTTTTT (SEQ ID NO: 1); (2) NNNNNNNNNNNNNNNNNNNNgtttttgtactctcaGAAAtgcagaagctacaaagataaggcttcatgccg aaatcaacaccctgtcattttatggcagggtgttttcgttatttaaTTTTTT (SEQ ID NO: 2); (3) NNNNNNNNNNNNNNNNNNNNgtttttgtactctcaGAAAtgcagaagctacaaagataaggcttcatgccg aaatcaacaccctgtcattttatggcagggtgtTTTTTT (SEQ ID NO: 3); (4) NNNNNNNNNNNNNNNNNNNNgtttagagctaGAAAtagcaagttaaaataaggctagtccgttatcaactt gaaaaagtggcaccgagtcggtgcTTTTTT (SEQ ID NO: 4); (5) NNNNNNNNNNNNNNNNNNNNgttttagagctaGAAATAGcaagttaaaataaggctagtccgttatcaac ttgaaaaagtgTTTTTTT (SEQ ID NO: 5); and (6) NNNNNNNNNNNNNNNNNNNNgttttagagctagAAATAGcaagttaaaataaggctagtccgttatcaTT TTTTTT (SEQ ID NO: 6). In some embodiments, sequences (1) to (3) are used in combination with Cas9 from S. thermophilus CRISPR1. In some embodiments, sequences (4) to (6) are used in combination with Cas9 from S. pyogenes. In some embodiments, the tracr sequence is a separate transcript from a transcript comprising the tracr mate sequence.
[0144] In some embodiments, candidate tracrRNA may be subsequently predicted by sequences that fulfill any or all of the following criteria: 1. sequence homology to direct repeats (motif search in Geneious with up to 18-bp mismatches); 2. presence of a predicted Rho-independent transcriptional terminator in direction of transcription; and 3. stable hairpin secondary structure between tracrRNA and direct repeat. In some embodiments, 2 of these criteria may be used, for instance 1 and 2, 2 and 3, or 1 and 3. In some embodiments, all 3 criteria may be used.
[0145] In some embodiments, chimeric synthetic guide RNAs (sgRNAs) designs may incorporate at least 12 bp of duplex structure between the direct repeat and tracrRNA.
[0146] For minimization of toxicity and off-target effect, it will be important to control the concentration of CRISPR enzyme mRNA and guide RNA delivered. Optimal concentrations of CRISPR enzyme mRNA and guide RNA can be determined by testing different concentrations in a cellular or non-human eukaryote animal model and using deep sequencing the analyze the extent of modification at potential off-target genomic loci. For example, for the guide sequence targeting 5-GAGTCCGAGCAGAAGAAGAA-3 (SEQ ID NO: 7) in the EMX1 gene of the human genome, deep sequencing can be used to assess the level of modification at the following two off-target loci, 1: 5-GAGTCCTAGCAGGAGAAGAA-3 (SEQ ID NO: 8) and 2: 5-GAGTCTAAGCAGAAGAAGAA-3 (SEQ ID NO: 9). The concentration that gives the highest level of on-target modification while minimizing the level of off-target modification should be chosen for in vivo delivery. Alternatively, to minimize the level of toxicity and off-target effect, CRISPR enzyme nickase mRNA (for example S. pyogenes Cas9 with the D10A mutation) can be delivered with a pair of guide RNAs targeting a site of interest. The two guide RNAs need to be spaced as follows. Guide sequences and strategies to mimize toxicity and off-target effects can be as in WO 2014/093622 (PCT/US2013/074667).
[0147] The CRISPR system is derived advantageously from a type II CRISPR system. In some embodiments, one or more elements of a CRISPR system is derived from a particular organism comprising an endogenous CRISPR system, such as Streptococcus pyogenes. In preferred embodiments of the invention, the CRISPR system is a type II CRISPR system and the Cas enzyme is Cas9, which catalyzes DNA cleavage. Non-limiting examples of Cas proteins include Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cash, Cas7, Cas8, Cas9 (also known as Csn1 and Csx12), Cas10, Csy1, Csy2, Csy3, Cse1, Cse2, Csc1, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csx1, Csx15, Csf1, Csf2, Csf3, Csf4, homologues thereof, or modified versions thereof.
[0148] In some embodiments, the unmodified CRISPR enzyme has DNA cleavage activity, such as Cas9. In some embodiments, the CRISPR enzyme directs cleavage of one or both strands at the location of a target sequence, such as within the target sequence and/or within the complement of the target sequence. In some embodiments, the CRISPR enzyme directs cleavage of one or both strands within about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 50, 100, 200, 500, or more base pairs from the first or last nucleotide of a target sequence. In some embodiments, a vector encodes a CRISPR enzyme that is mutated to with respect to a corresponding wild-type enzyme such that the mutated CRISPR enzyme lacks the ability to cleave one or both strands of a target polynucleotide containing a target sequence. For example, an aspartate-to-alanine substitution (D10A) in the RuvC I catalytic domain of Cas9 from S. pyogenes converts Cas9 from a nuclease that cleaves both strands to a nickase (cleaves a single strand). Other examples of mutations that render Cas9 a nickase include, without limitation, H840A, N854A, and N863A. As a further example, two or more catalytic domains of Cas9 (RuvC I, RuvC II, and RuvC III or the HNH domain) may be mutated to produce a mutated Cas9 substantially lacking all DNA cleavage activity. In some embodiments, a D10A mutation is combined with one or more of H840A, N854A, or N863A mutations to produce a Cas9 enzyme substantially lacking all DNA cleavage activity. In some embodiments, a CRISPR enzyme is considered to substantially lack all DNA cleavage activity when the DNA cleavage activity of the mutated enzyme is about no more than 25%, 10%, 5%, 1%, 0.1%, 0.01%, or less of the DNA cleavage activity of the non-mutated form of the enzyme; an example can be when the DNA cleavage activity of the mutated form is nil or negligible as compared with the non-mutated form. Where the enzyme is not SpCas9, mutations may be made at any or all residues corresponding to positions 10, 762, 840, 854, 863 and/or 986 of SpCas9 (which may be ascertained for instance by standard sequence comparison tools). In particular, any or all of the following mutations are preferred in SpCas9: D10A, E762A, H840A, N854A, N863A and/or D986A; as well as conservative substitution for any of the replacement amino acids is also envisaged. The same (or conservative substitutions of these mutations) at corresponding positions in other Cas9s are also preferred. Particularly preferred are D10 and H840 in SpCas9. However, in other Cas9s, residues corresponding to SpCas9 D10 and H840 are also preferred. Orthologs of SpCas9 can be used in the practice of the invention. A Cas enzyme may be identified Cas9 as this can refer to the general class of enzymes that share homology to the biggest nuclease with multiple nuclease domains from the type II CRISPR system. Most preferably, the Cas9 enzyme is from, or is derived from, spCas9 (S. pyogenes Cas9) or saCas9 (S. aureus Cas9). StCas9 refers to wild type Cas9 from S. thermophilus, the protein sequence of which is given in the SwissProt database under accession number G3ECR1. Similarly, S. pyogenes Cas9 or spCas9 is included in SwissProt under accession number Q99ZW2. By derived, Applicants mean that the derived enzyme is largely based, in the sense of having a high degree of sequence homology with, a wildtype enzyme, but that it has been mutated (modified) in some way as described herein. It will be appreciated that the terms Cas and CRISPR enzyme are generally used herein interchangeably, unless otherwise apparent. As mentioned above, many of the residue numberings used herein refer to the Cas9 enzyme from the type II CRISPR locus in Streptococcus pyogenes. However, it will be appreciated that this invention includes many more Cas9s from other species of microbes, such as SpCas9, SaCa9, St1Cas9 and so forth. Enzymatic action by Cas9 derived from Streptococcus pyogenes or any closely related Cas9 generates double stranded breaks at target site sequences which hybridize to 20 nucleotides of the guide sequence and that have a protospacer-adjacent motif (PAM) sequence (examples include NGG/NRG or a PAM that can be determined as described herein) following the 20 nucleotides of the target sequence. CRISPR activity through Cas9 for site-specific DNA recognition and cleavage is defined by the guide sequence, the tracr sequence that hybridizes in part to the guide sequence and the PAM sequence. More aspects of the CRISPR system are described in Karginov and Hannon, The CRISPR system: small RNA-guided defence in bacteria and archaea, Mole Cell 2010, January 15; 37(1): 7. The type II CRISPR locus from Streptococcus pyogenes SF370, which contains a cluster of four genes Cas9, Cas1, Cas2, and Csn1, as well as two non-coding RNA elements, tracrRNA and a characteristic array of repetitive sequences (direct repeats) interspaced by short stretches of non-repetitive sequences (spacers, about 30 bp each). In this system, targeted DNA double-strand break (DSB) is generated in four sequential steps. First, two non-coding RNAs, the pre-crRNA array and tracrRNA, are transcribed from the CRISPR locus. Second, tracrRNA hybridizes to the direct repeats of pre-crRNA, which is then processed into mature crRNAs containing individual spacer sequences. Third, the mature crRNA:tracrRNA complex directs Cas9 to the DNA target consisting of the protospacer and the corresponding PAM via heteroduplex formation between the spacer region of the crRNA and the protospacer DNA. Finally, Cas9 mediates cleavage of target DNA upstream of PAM to create a DSB within the protospacer. A pre-crRNA array consisting of a single spacer flanked by two direct repeats (DRs) is also encompassed by the term tracr-mate sequences). In certain embodiments, Cas9 may be constitutively present or inducibly present or conditionally present or administered or delivered. Cas9 optimization may be used to enhance function or to develop new functions, one can generate chimeric Cas9 proteins. And Cas9 may be used as a generic DNA binding protein.
[0149] Typically, in the context of an endogenous CRISPR system, formation of a CRISPR complex (comprising a guide sequence hybridized to a target sequence and complexed with one or more Cas proteins) results in cleavage of one or both strands in or near (e.g. within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, or more base pairs from) the target sequence. Without wishing to be bound by theory, the tracr sequence, which may comprise or consist of all or a portion of a wild-type tracr sequence (e.g. about or more than about 20, 26, 32, 45, 48, 54, 63, 67, 85, or more nucleotides of a wild-type tracr sequence), may also form part of a CRISPR complex, such as by hybridization along at least a portion of the tracr sequence to all or a portion of a tracr mate sequence that is operably linked to the guide sequence.
[0150] An example of a codon optimized sequence, is in this instance a sequence optimized for expression in a eukaryote, e.g., humans (i.e. being optimized for expression in humans), or for another eukaryote, animal or mammal as herein discussed; see, e.g., SaCas9 human codon optimized sequence in WO 2014/093622 (PCT/US2013/074667). Whilst this is preferred, it will be appreciated that other examples are possible and codon optimization for a host species other than human, or for codon optimization for specific organs is known. In some embodiments, an enzyme coding sequence encoding a CRISPR enzyme is codon optimized for expression in particular cells, such as eukaryotic cells. The eukaryotic cells may be those of or derived from a particular organism, such as a mammal, including but not limited to human, or non-human eukaryote or animal or mammal as herein discussed, e.g., mouse, rat, rabbit, dog, livestock, or non-human mammal or primate. In some embodiments, processes for modifying the germ line genetic identity of human beings and/or processes for modifying the genetic identity of animals which are likely to cause them suffering without any substantial medical benefit to man or animal, and also animals resulting from such processes, may be excluded. In general, codon optimization refers to a process of modifying a nucleic acid sequence for enhanced expression in the host cells of interest by replacing at least one codon (e.g. about or more than about 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons) of the native sequence with codons that are more frequently or most frequently used in the genes of that host cell while maintaining the native amino acid sequence. Various species exhibit particular bias for certain codons of a particular amino acid. Codon bias (differences in codon usage between organisms) often correlates with the efficiency of translation of messenger RNA (mRNA), which is in turn believed to be dependent on, among other things, the properties of the codons being translated and the availability of particular transfer RNA (tRNA) molecules. The predominance of selected tRNAs in a cell is generally a reflection of the codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codon optimization. Codon usage tables are readily available, for example, at the Codon Usage Database available at www.kazusa.orjp/codon/ (visited Jul. 9, 2002), and these tables can be adapted in a number of ways. See Nakamura, Y., et al. Codon usage tabulated from the international DNA sequence databases: status for the year 2000 Nucl. Acids Res. 28:292 (2000). Computer algorithms for codon optimizing a particular sequence for expression in a particular host cell are also available, such as Gene Forge (Aptagen; Jacobus, PA), are also available. In some embodiments, one or more codons (e.g. 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more, or all codons) in a sequence encoding a CRISPR enzyme correspond to the most frequently used codon for a particular amino acid.
[0151] In some embodiments, a vector encodes a CRISPR enzyme comprising one or more nuclear localization sequences (NLSs), such as about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs. In some embodiments, the CRISPR enzyme comprises about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the amino-terminus, about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the carboxy-terminus, or a combination of these (e.g. zero or at least one or more NLS at the amino-terminus and zero or at one or more NLS at the carboxy terminus). When more than one NLS is present, each may be selected independently of the others, such that a single NLS may be present in more than one copy and/or in combination with one or more other NLSs present in one or more copies. In a preferred embodiment of the invention, the CRISPR enzyme comprises at most 6 NLSs. In some embodiments, an NLS is considered near the N- or C-terminus when the nearest amino acid of the NLS is within about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50, or more amino acids along the polypeptide chain from the N- or C-terminus. Non-limiting examples of NLSs include an NLS sequence derived from: the NLS of the SV40 virus large T-antigen, having the amino acid sequence PKKKRKV (SEQ ID NO: 10); the NLS from nucleoplasmin (e.g. the nucleoplasmin bipartite NLS with the sequence KRPAATKKAGQAKKKK (SEQ ID NO: 11)); the c-myc NLS having the amino acid sequence PAAKRVKLD (SEQ ID NO: 12) or RQRRNELKRSP (SEQ ID NO: 13); the hRNPA1 M9 NLS having the sequence NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY (SEQ ID NO: 14); the sequence RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NO: 15) of the IBB domain from importin-alpha; the sequences VSRKRPRP (SEQ ID NO: 16) and PPKKARED (SEQ ID NO: 17) of the myoma T protein; the sequence PQPKKKPL (SEQ ID NO: 18) of human p53; the sequence SALIKKKKKMAP (SEQ ID NO: 19) of mouse c-abl IV; the sequences DRLRR (SEQ ID NO: 20) and PKQKKRK (SEQ ID NO: 21) of the influenza virus NS1; the sequence RKLKKKIKKL (SEQ ID NO: 22) of the Hepatitis virus delta antigen; the sequence REKKKFLKRR (SEQ ID NO: 23) of the mouse Mx1 protein; the sequence KRKGDEVDGVDEVAKKKSKK (SEQ ID NO: 24) of the human poly(ADP-ribose) polymerase; and the sequence RKCLQAGMNLEARKTKK (SEQ ID NO: 25) of the steroid hormone receptors (human) glucocorticoid. In general, the one or more NLSs are of sufficient strength to drive accumulation of the CRISPR enzyme in a detectable amount in the nucleus of a eukaryotic cell. In general, strength of nuclear localization activity may derive from the number of NLSs in the CRISPR enzyme, the particular NLS(s) used, or a combination of these factors. Detection of accumulation in the nucleus may be performed by any suitable technique. For example, a detectable marker may be fused to the CRISPR enzyme, such that location within a cell may be visualized, such as in combination with a means for detecting the location of the nucleus (e.g. a stain specific for the nucleus such as DAPI). Cell nuclei may also be isolated from cells, the contents of which may then be analyzed by any suitable process for detecting protein, such as immunohistochemistry, Western blot, or enzyme activity assay. Accumulation in the nucleus may also be determined indirectly, such as by an assay for the effect of CRISPR complex formation (e.g. assay for DNA cleavage or mutation at the target sequence, or assay for altered gene expression activity affected by CRISPR complex formation and/or CRISPR enzyme activity), as compared to a control no exposed to the CRISPR enzyme or complex, or exposed to a CRISPR enzyme lacking the one or more NLSs.
[0152] Aspects of the invention relate to the expression of the gene product being decreased or a template polynucleotide being further introduced into the DNA molecule encoding the gene product or an intervening sequence being excised precisely by allowing the two 5 overhangs to reanneal and ligate or the activity or function of the gene product being altered or the expression of the gene product being increased. In an embodiment of the invention, the gene product is a protein. Only sgRNA pairs creating 5 overhangs with less than 8 bp overlap between the guide sequences (offset greater than 8 bp) were able to mediate detectable indel formation. Importantly, each guide used in these assays is able to efficiently induce indels when paired with wildtype Cas9, indicating that the relative positions of the guide pairs are the most important parameters in predicting double nicking activity. Since Cas9n and Cas9H840A nick opposite strands of DNA, substitution of Cas9n with Cas9H840A with a given sgRNA pair should have resulted in the inversion of the overhang type; but no indel formation is observed as with Cas9H840A indicating that Cas9H840A is a CRISPR enzyme substantially lacking all DNA cleavage activity (which is when the DNA cleavage activity of the mutated enzyme is about no more than 25%, 10%, 5%, 1%, 0.1%, 0.01%, or less of the DNA cleavage activity of the non-mutated form of the enzyme; whereby an example can be when the DNA cleavage activity of the mutated form is nil or negligible as compared with the non-mutated form, e.g., when no indel formation is observed as with Cas9H840A in the eukaryotic system in contrast to the biochemical or prokaryotic systems). Nonetheless, a pair of sgRNAs that will generate a 5 overhang with Cas9n should in principle generate the corresponding 3 overhang instead, and double nicking. Therefore, sgRNA pairs that lead to the generation of a 3 overhang with Cas9n can be used with another mutated Cas9 to generate a 5 overhang, and double nicking. Accordingly, in some embodiments, a recombination template is also provided. A recombination template may be a component of another vector as described herein, contained in a separate vector, or provided as a separate polynucleotide. In some embodiments, a recombination template is designed to serve as a template in homologous recombination, such as within or near a target sequence nicked or cleaved by a CRISPR enzyme as a part of a CRISPR complex. A template polynucleotide may be of any suitable length, such as about or more than about 10, 15, 20, 25, 50, 75, 100, 150, 200, 500, 1000, or more nucleotides in length. In some embodiments, the template polynucleotide is complementary to a portion of a polynucleotide comprising the target sequence. When optimally aligned, a template polynucleotide might overlap with one or more nucleotides of a target sequences (e.g. about or more than about 1, 5, 10, 15, 20, or more nucleotides). In some embodiments, when a template sequence and a polynucleotide comprising a target sequence are optimally aligned, the nearest nucleotide of the template polynucleotide is within about 1, 5, 10, 15, 20, 25, 50, 75, 100, 200, 300, 400, 500, 1000, 5000, 10000, or more nucleotides from the target sequence.
[0153] In some embodiments, one or more vectors driving expression of one or more elements of a CRISPR system are introduced into a host cell such that expression of the elements of the CRISPR system direct formation of a CRISPR complex at one or more target sites. For example, a Cas enzyme, a guide sequence linked to a tracr-mate sequence, and a tracr sequence could each be operably linked to separate regulatory elements on separate vectors. Or, RNA(s) of the CRISPR System can be delivered to a transgenic Cas9 animal or mammal, e.g., an animal or mammal that constitutively or inducibly or conditionally expresses Cas9. Alternatively, two or more of the elements expressed from the same or different regulatory elements, may be combined in a single vector, with one or more additional vectors providing any components of the CRISPR system not included in the first vector. CRISPR system elements that are combined in a single vector may be arranged in any suitable orientation, such as one element located 5 with respect to (upstream of) or 3 with respect to (downstream of) a second element. The coding sequence of one element may be located on the same or opposite strand of the coding sequence of a second element, and oriented in the same or opposite direction. In some embodiments, a single promoter drives expression of a transcript encoding a CRISPR enzyme and one or more of the guide sequence, tracr mate sequence (optionally operably linked to the guide sequence), and a tracr sequence embedded within one or more intron sequences (e.g. each in a different intron, two or more in at least one intron, or all in a single intron). In some embodiments, the CRISPR enzyme, guide sequence, tracr mate sequence, and tracr sequence are operably linked to and expressed from the same promoter. Delivery vehicles, vectors, particles, nanoparticles, formulations and components thereof for expression of one or more elements of a CRISPR system are as used in the foregoing documents, such as WO 2014/093622 (PCT/US2013/074667). In some embodiments, a vector comprises one or more insertion sites, such as a restriction endonuclease recognition sequence (also referred to as a cloning site). In some embodiments, one or more insertion sites (e.g. about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more insertion sites) are located upstream and/or downstream of one or more sequence elements of one or more vectors. In some embodiments, a vector comprises an insertion site upstream of a tracr mate sequence, and optionally downstream of a regulatory element operably linked to the tracr mate sequence, such that following insertion of a guide sequence into the insertion site and upon expression the guide sequence directs sequence-specific binding of a CRISPR complex to a target sequence in a eukaryotic cell. In some embodiments, a vector comprises two or more insertion sites, each insertion site being located between two tracr mate sequences so as to allow insertion of a guide sequence at each site. In such an arrangement, the two or more guide sequences may comprise two or more copies of a single guide sequence, two or more different guide sequences, or combinations of these. When multiple different guide sequences are used, a single expression construct may be used to target CRISPR activity to multiple different, corresponding target sequences within a cell. For example, a single vector may comprise about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or more guide sequences. In some embodiments, about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more such guide-sequence-containing vectors may be provided, and optionally delivered to a cell. In some embodiments, a vector comprises a regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, such as a Cas protein. CRISPR enzyme or CRISPR enzyme mRNA or CRISPR guide RNA or RNA(s) can be delivered separately; and advantageously at least one of these is delivered via a nanoparticle complex. CRISPR enzyme mRNA can be delivered prior to the guide RNA to give time for CRISPR enzyme to be expressed. CRISPR enzyme mRNA might be administered 1-12 hours (preferably around 2-6 hours) prior to the administration of guide RNA. Alternatively, CRISPR enzyme mRNA and guide RNA can be administered together. Advantageously, a second booster dose of guide RNA can be administered 1-12 hours (preferably around 2-6 hours) after the initial administration of CRISPR enzyme mRNA+guide RNA. Additional administrations of CRISPR enzyme mRNA and/or guide RNA might be useful to achieve the most efficient levels of genome modification.
[0154] In one aspect, the invention provides methods for using one or more elements of a CRISPR system. The CRISPR complex of the invention provides an effective means for modifying a target polynucleotide. The CRISPR complex of the invention has a wide variety of utility including modifying (e.g., deleting, inserting, translocating, inactivating, activating) a target polynucleotide in a multiplicity of cell types. As such the CRISPR complex of the invention has a broad spectrum of applications in, e.g., gene therapy, gene screening, drug screening, disease diagnosis, and prognosis. An exemplary CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within the target polynucleotide. The guide sequence is linked to a tracr mate sequence, which in turn hybridizes to a tracr sequence. In one embodiment, this invention provides a method of cleaving a target polynucleotide. The method comprises modifying a target polynucleotide using a CRISPR complex that binds to the target polynucleotide and effect cleavage of said target polynucleotide. Typically, the CRISPR complex of the invention, when introduced into a cell, creates a break (e.g., a single or a double strand break) in the genome sequence. For example, the method can be used to cleave a disease gene in a cell. The break created by the CRISPR complex can be repaired by a repair processes such as the error prone non-homologous end joining (NHEJ) pathway or the high fidelity homology-directed repair (HDR). During these repair process, an exogenous polynucleotide template can be introduced into the genome sequence. In some methods, the HDR process is used to modify genome sequence. For example, an exogenous polynucleotide template comprising a sequence to be integrated flanked by an upstream sequence and a downstream sequence is introduced into a cell. The upstream and downstream sequences share sequence similarity with either side of the site of integration in the chromosome. Where desired, a donor polynucleotide can be DNA, e.g., a DNA plasmid, a bacterial artificial chromosome (BAC), a yeast artificial chromosome (YAC), a viral vector, a linear piece of DNA, a PCR fragment, a naked nucleic acid, or a nucleic acid complexed with a delivery vehicle such as a liposome or poloxamer. The exogenous polynucleotide template comprises a sequence to be integrated (e.g., a mutated gene). The sequence for integration may be a sequence endogenous or exogenous to the cell. Examples of a sequence to be integrated include polynucleotides encoding a protein or a non-coding RNA (e.g., a microRNA). Thus, the sequence for integration may be operably linked to an appropriate control or regulatory sequence or sequences. Alternatively, the sequence to be integrated may provide a regulatory function. The upstream and downstream sequences in the exogenous polynucleotide template are selected to promote recombination between the chromosomal sequence of interest and the donor polynucleotide. The upstream sequence is a nucleic acid sequence that shares sequence similarity with the genome sequence upstream of the targeted site for integration. Similarly, the downstream sequence is a nucleic acid sequence that shares sequence similarity with the chromosomal sequence downstream of the targeted site of integration. The upstream and downstream sequences in the exogenous polynucleotide template can have 75%, 80%, 85%, 90%, 95%, or 100% sequence identity with the targeted genome sequence. Preferably, the upstream and downstream sequences in the exogenous polynucleotide template have about 95%, 96%, 97%, 98%, 99%, or 100% sequence identity with the targeted genome sequence. In some methods, the upstream and downstream sequences in the exogenous polynucleotide template have about 99% or 100% sequence identity with the targeted genome sequence. An upstream or downstream sequence may comprise from about 20 bp to about 2500 bp, for example, about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, or 2500 bp. In some methods, the exemplary upstream or downstream sequence have about 200 bp to about 2000 bp, about 600 bp to about 1000 bp, or more particularly about 700 bp to about 1000 bp. In some methods, the exogenous polynucleotide template may further comprise a marker. Such a marker may make it easy to screen for targeted integrations. Examples of suitable markers include restriction sites, fluorescent proteins, or selectable markers. The exogenous polynucleotide template of the invention can be constructed using recombinant techniques (see, for example, Sambrook et al., 2001 and Ausubel et al., 1996). In a method for modifying a target polynucleotide by integrating an exogenous polynucleotide template, a double stranded break is introduced into the genome sequence by the CRISPR complex, the break is repaired via homologous recombination of an exogenous polynucleotide template such that the template is integrated into the genome. The presence of a double-stranded break facilitates integration of the template. In other embodiments, this invention provides a method of modifying expression of a polynucleotide in a eukaryotic cell. The method comprises increasing or decreasing expression of a target polynucleotide by using a CRISPR complex that binds to the polynucleotide. In some methods, a target polynucleotide can be inactivated to effect the modification of the expression in a cell. For example, upon the binding of a CRISPR complex to a target sequence in a cell, the target polynucleotide is inactivated such that the sequence is not transcribed, the coded protein is not produced, or the sequence does not function as the wild-type sequence does. For example, a protein or microRNA coding sequence may be inactivated such that the protein or microRNA or pre-microRNA transcript is not produced. In some methods, a control sequence can be inactivated such that it no longer functions as a control sequence. As used herein, control sequence refers to any nucleic acid sequence that effects the transcription, translation, or accessibility of a nucleic acid sequence. Examples of a control sequence include, a promoter, a transcription terminator, and an enhancer. The target polynucleotide of a CRISPR complex can be any polynucleotide endogenous or exogenous to the eukaryotic cell. For example, the target polynucleotide can be a polynucleotide residing in the nucleus of the eukaryotic cell. The target polynucleotide can be a sequence coding a gene product (e.g., a protein) or a non-coding sequence (e.g., a regulatory polynucleotide or a junk DNA). Examples of target polynucleotides include a sequence associated with a signaling biochemical pathway, e.g., a signaling biochemical pathway-associated gene or polynucleotide. Examples of target polynucleotides include a disease associated gene or polynucleotide. A disease-associated gene or polynucleotide refers to any gene or polynucleotide which is yielding transcription or translation products at an abnormal level or in an abnormal form in cells derived from a disease-affected tissues compared with tissues or cells of a non disease control. It may be a gene that becomes expressed at an abnormally high level; it may be a gene that becomes expressed at an abnormally low level, where the altered expression correlates with the occurrence and/or progression of the disease. A disease-associated gene also refers to a gene possessing mutation(s) or genetic variation that is directly responsible or is in linkage disequilibrium with a gene(s) that is responsible for the etiology of a disease. The transcribed or translated products may be known or unknown, and may be at a normal or abnormal level. The target polynucleotide of a CRISPR complex can be any polynucleotide endogenous or exogenous to the eukaryotic cell. For example, the target polynucleotide can be a polynucleotide residing in the nucleus of the eukaryotic cell. The target polynucleotide can be a sequence coding a gene product (e.g., a protein) or a non-coding sequence (e.g., a regulatory polynucleotide or a junk DNA). Without wishing to be bound by theory, it is believed that the target sequence should be associated with a PAM (protospacer adjacent motif); that is, a short sequence recognized by the CRISPR complex. The precise sequence and length requirements for the PAM differ depending on the CRISPR enzyme used, but PAMs are typically 2-5 base pair sequences adjacent the protospacer (that is, the target sequence). Examples of PAM sequences are given in the examples section below, and the skilled person will be able to identify further PAM sequences for use with a given CRISPR enzyme. In some embodiments, the method comprises allowing a CRISPR complex to bind to the target polynucleotide to effect cleavage of said target polynucleotide thereby modifying the target polynucleotide, wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said target polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence. In one aspect, the invention provides a method of modifying expression of a polynucleotide in a eukaryotic cell. In some embodiments, the method comprises allowing a CRISPR complex to bind to the polynucleotide such that said binding results in increased or decreased expression of said polynucleotide; wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence. Similar considerations and conditions apply as above for methods of modifying a target polynucleotide. In fact, these sampling, culturing and re-introduction options apply across the aspects of the present invention. In one aspect, the invention provides for methods of modifying a target polynucleotide in a leukocyte, which may be in vivo, ex vivo or in vitro. In some embodiments, the method comprises sampling a leukocyte or population of leukocytes from a human or non-human animal, and modifying the leukocytes. Culturing may occur at any stage ex vivo. The leukocytes may even be re-introduced into the non-human animal or mammal.
[0155] Indeed, in any aspect of the invention, the CRISPR complex may comprise a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence, wherein said guide sequence may be linked to a tracr mate sequence which in turn may hybridize to a tracr sequence.
[0156] Transgenic non-human eukaryotic organisms, e.g., animals are also provided in an aspect of practice of the instant invention. Preferred examples include animals comprising Cas9, in terms of polynucleotides encoding Cas9 or the protein itself. In certain aspects, the invention involves a constitutive or conditional or inducible Cas9 non-human eukaryotic organism, such as an animal, e.g., a primate, rodent, e.g., mouse, rat and rabbit, are preferred; and can include a canine or dog, livestock (cow/bovine, sheep/ovine, goat or pig), fish, fowl or poultry, e.g., chicken with it mentioned that it is advantageous if the animal is a model as to a human or animal genetic disease or condition, such as a disease associated with leukocytes, as use of the non-human eukaryotic organisms in genetic disease or condition modeling, e.g., via inducing a plurality, e.g., 1 or more, e.g., a plurality or multiple, such as 3 or more, e.g., 3 to 50 mutations correlated or associated with a genetic disease or condition, such as a disease associated with leukocytes, are preferred. To generate transgenic mice with the constructs, as exemplified herein one may inject pure, linear DNA into the pronucleus of a zygote from a pseudo pregnant female, e.g. a CB56 female. Founders may then be identified, genotyped, and backcrossed to CB57 mice. The constructs may then be cloned and optionally verified, for instance by Sanger sequencing. Knock ins are envisaged (alone or in combination). Example 1 provides a knockin Cas9 mouse and to generate a Cas9 knock in mice one may target the same constitutive and conditional constructs to the Rosa26 locus, reference is made to WO 2014/093622 (PCT/US13/74667), incorporated herein by reference. Methods of US Patent Publication Nos. 20120017290 and 20110265198 assigned to Sangamo BioSciences, Inc. directed to targeting the Rosa locus may be modified to utilize the CRISPR Cas system of the present invention. Methods of US Patent Publication No. 20130236946 assigned to Cellectis directed to targeting the Rosa locus may also be modified to utilize the CRISPR Cas system of the present invention. In a particular embodiment Applicants disclose herein a novel in vivo CRISPR approach with a combination of novel Cas9 reagents, as well as demonstrate application in modeling the dynamics of leukocyte responses such as activation and differentiation; and, that this system can be used to model three and even more than three genetic mutations, such as any number between three (3) and thirty (30) or more. And, this can include modeling in post-mitotic cells. In 293 cells the Cas9 conditional expression construct can be activated by co-expression with Cre. Correctly targeted R1 mESCs can have active Cas9 when Cre is expressed. Because Cas9 is followed by the P2A peptide cleavage sequence and then EGFP Applicants identify successful expression by observing EGFP. Applicants have shown Cas9 activation in mESCs. The conditional Cas9 mouse can be crossed with a mouse that ubiquitously expresses Cre (ACTB-Cre line) and may arrive at a mouse that expresses Cas9 in every cell. The delivery of RNA(s) to guide Cas9, e.g. CRISPR RNA and transactivating (tracr) RNA or a single guide RNA (sgRNA) (chimeric RNA) can induce genome editing in embryonic or adult mice. Interestingly, when the conditional Cas9 mouse is crossed with a mouse expressing Cre under a tissue specific promoter, there should only be Cas9 in the tissues that also express Cre. This approach may be used to edit the genome in only precise tissues (e.g. in leukocytes) by delivering chimeric RNA to the same tissue. Further, the conditional Cas9 mouse is broadly applicable for many areas of biology and its uses as described herein provides many utilities. More generally, while Cas9 provides an effective way to model multiple genetic changes, Cas9 delivery has challenges, including limitations due to the significant size of Cas9, and possible extra biosafety practices. The Cas9 transgenic eukaryote, e.g., mouse provides a most effective method for modeling of aberrant leukocyte responses, leukocyte-associated diseases and other areas of tissue-specific biological studies. Applicants' approach provides a substantial packaging capacity for both sgRNAs as well as reporters and other modulators, etc. These features include efficient editing of cellular subtypes (e.g. leukocyte subtypes) using Cre driver lines, hard to transfect/transduce primary cells (especially primary leukocytes), and delivery of sgRNA using viral or non-viral, nanotechnology-based methods. Applicants used a U6-sgRNA lentiviral vector in their study disclosed herein in Example 2.
[0157] Accordingly, the invention involves a non-human eukaryote, animal, mammal, primate, rodent, etc or leukocyte thereof that may be used as a disease model or a model of aberrant leukocyte responses. As used herein, disease refers to a disease, disorder, or indication in a subject. For example, a method of the invention may be used to create a non-human eukaryote, e.g., an animal, mammal, primate, rodent or leukocyte that comprises a modification, e.g., 3-50 or more modifications, in one or more nucleic acid sequences associated or correlated with a leukocyte response or disease, e.g., a leukocyte associated disease. Such a mutated nucleic acid sequence may be associated or correlated with a disease or expressed in leukocytes and may encode a disease associated protein sequence or may be a disease associated or correlated control sequence. The leukocyte may be in vivo or ex vivo. In the instance where the leukocyte is in culture, a cell line may be established if appropriate culturing conditions are met and preferably if the cell is suitably adapted for this purpose (for instance a stem cell). Hence, cell lines are also envisaged. In some methods, the model can be used to study the effects of mutations on the animal or leukocyte and the leukocyte response, as well as development and/or progression of the disease using measures commonly used in the study of the disease. Alternatively, such a model is useful for studying the effect of a putatively pharmaceutically active compound or gene therapy on the disease or leukocyte response. A response- or disease-associated gene or polynucleotide can be modified to give rise to the aberrant response or disease in the model, and then putatively pharmaceutically active compound and/or gene therapy can be administered so as to observe whether the response or disease development and/or progression is inhibited or reduced. In particular, the method comprises modifying so as to produce, one or more, advantageously 3-50 or more response- or disease-associated or correlated gene(s) or polynucleotide(s). Accordingly, in some methods, a genetically modified animal or leukocyte may be compared with an animal predisposed to development of the disease, such that administering putative gene therapy, or pharmaceutically acceptable compound(s), or any combination thereof can be performed to assess how such putative therapy(ies) or treatment(s) may perform in a human. The invention can involve contacting a test compound with a leukocyte or administering to a eukaryote a test compound, wherein the eukaryote or leukocyte comprises one or more, e.g., 3-50 or more mutations from the CRISPR-Cas system, e.g., in an animal that expresses Cas9 and to which RNA(s) generating the mutations has/have been administered; and detecting a reduction or an augmentation of a cell signaling event associated with the mutation(s) or lack thereof. Screening of such putative pharmaceutically active compound(s) and/or gene therapy(ies) can be by cellular function change and/or intracellular signaling or extracellular signaling or change in intracellular expression or change in expression of protein on the cell surface. Such screening can involve evaluating for dosages or dose curves, as well as combinations of potential drugs and/or therapies. An altered expression of one or more genome sequences associated with a signaling biochemical pathway can be determined by assaying for a difference in the mRNA levels of the corresponding genes between the disease model eukaryote or animal or leukocyte thereof and a normal eukaryote, animal, or leukocyte, and to ascertain whether when the disease model is administered or contacted with a candidate chemical agent or gene therapy it reverts to or towards normal. An assay can be for mutation(s)-induced alteration in the level of mRNA transcripts or corresponding polynucleotides or polypeptides in comparison with such level(s) in a normal eukaryote or animal and whether such level(s) are placed towards or to normal when a therapy or treatment or agent is employed. Accordingly, the invention comprehends delivery of multiple RNA(s), e.g., sgRNA(s), e.g., 3-50 or more, e.g., 3, 16, 32, 48, 50 or more to the transgenic Cas9 eukaryote and thereafter screening cells, tissue, tumors or the eukaruote for fibers or formation of fibers (with it understood that eukaryote is as herein discussed to include animal, mammal, etc). Inducing multiple mutations also enables the skilled person to divine new combinations of mutations that give rise to aberrant leukocyte responses or diseases associated with leukocytes such as immune system disorders or cancer. The ability to induce multiple mutations that accelerate or change the rate of a leukocyte-associated disease, e.g., an immune system disorder or cancer accordingly provides many advantages heretofore unknown in research and development of pharmaceuticals, therapies and treatments for such disorders.
[0158] In an aspect the invention can involve leukocytes, e.g., non-human, e.g., animal, such as mammal, e.g., primate, rodent, mouse, rat, rabbit, etc., or even human leukocytes, transformed to contain Cas9, e.g., by a vector that contains nucleic acid molecule(s) encoding a Cas9, e.g., with nucleic acid(s) encoding a promoter and at least one NLS, advantageously two or more NLSs, or leukocytes that have had their genome altered, e.g., through the vector being an integrating virus or through such leukocytes being stem cells or cells that give rise to a cell line or a living organism (but wherein such an organism is advantageously non-human), that contains and expresses nucleic acid molecule(s) encoding Cas9. Such leukocytes are then transplanted into or onto an animal suitable for being a leukocyte-associated disease, e.g., immune system or cancer, model, e.g., fish, a rodent such as a mouse, chickens or chicken embryo or chicken embryo membrane. The leukocytes proliferate on or in the non-human eukaryote, e.g., animal model. The non-human eukaryote, e.g., animal model, having the proliferated heterologous transplanted Cas9-containing cells, is then administered RNA(s) or vector(s), e.g., AAV, adenovirus, lentivirus containing or providing RNA(s), e.g., under the control of a promoter such as a U6 promoter and/or particle(s) and/or nanoparticle(s) containing the RNA(s) and/or vector(s), whereby the RNA(s) direct the Cas9 in the cells to provide mutation, e.g., a plurality of mutation(s) such as from 3 to 30 mutations, advantageously mutation(s) associated or correlated with a a leukocyte-associated disease, whereby the non-human eukaryote, e.g., animal model is transformed into being a non-human eukaryote, e.g., animal model for the leukocyte-associated disease. The non-human eukaryote, e.g., animal model can then be used for testing, e.g., as to potential therapy and/or putative treatment via a possibly pharmaceutically active compound. The administering can be at or to or for body delivery to the proliferated heterologous transplanted Cas9-containing leukocytes, e.g., direct injection at or near such proliferated heterologous transplanted Cas9-containing leukocytes, or injection or other administration in such a way that the RNA(s) are delivered into the proliferated heterologous transplanted Cas9-containing leukocytes, e.g., injection into the bloodstream whereby bodily functions transport to the proliferated heterologous transplanted Cas9-containing leukocytes. In an aspect of the invention, barcoding techniques of WO/2013/138585 A1 can be adapted or integrated into the practice of the invention. WO/2013/138585 A1 provides methods for simultaneously determining the effect of a test condition on viability or proliferation of each of a plurality of genetically heterogeneous cell types. The methods include: providing a unitary sample comprising a plurality of, e.g., five, ten, twenty, twenty-five, or more, genetically heterogeneous cell types (each individual cell type is genetically homogeneous within itself, but differs from the others in the plurality), wherein each cell type further comprises: (i) an exogenous nucleic acid tag stably integrated into the genome of the cells, e.g., a tag comprising a core sequence that is unique to each cell type, and flanking amplification primer binding sequences that are the same in all of the cells of the plurality, and (ii) optionally, a marker, e.g., a selectable or detectable marker; and a known number of cells of each cell type is present in the sample; exposing the sample to a test condition for a selected time; and detecting a level of the exogenous nucleic acid tag in each cell type, wherein the level of the exogenous nucleic acid tag is proportional to the number of living cells in the sample after exposure to the test condition; and comparing the number of living cells in the sample after exposure to the test condition to a reference number of cells. The number of living cells in the sample after exposure to the test condition as compared to the reference number of cells indicates the effect of the test condition on viability or proliferation of each cell type. WO/2013/138585 A1 also provides methods for simultaneously determining the effect of a test condition on viability or proliferation of each of a plurality of genetically heterogeneous cell types, wherein the methods include providing a unitary sample comprising a plurality of, e.g., five, ten, twenty, twenty-five, or more, genetically heterogeneous cell types, wherein each cell type further comprises: (i) an exogenous nucleic acid tag stably integrated into the genome of the cells, e.g., comprising a core sequence that is unique to each cell type, and flanking amplification primer binding sequences that are the same in all of the cells of the plurality, and (ii) optionally, a selectable or detectable marker; and a known number of cells of each cell type is present in the sample; implanting the sample into a living animal; exposing the sample to a test condition for a selected time; harvesting the sample from the animal; and detecting a level of the exogenous nucleic acid tag in each cell type of the sample, wherein the level of the exogenous nucleic acid tag correlates to the number of living cells in the sample after exposure to the test condition; and comparing the number of living cells in the sample after exposure to the test condition to a reference number of cells. The number of living cells in the sample after exposure to the test condition as compared to the reference number of cells indicates the effect of the test condition on viability or proliferation of each cell type. The tag can be Cas9 or another TAG or marker that is integrated into the genome of cells to be transplanted into or onto a non-human eukaryote, e.g., animal model, or that is integrated into the genome of the non-human transgenic eukaryote, e.g., animal, mammal, primate, rodent, mouse, rat, rabbit, etc (along with coding for Cas9). The test condition can be the administration or delivery of the RNA(s) to guide the Cas9 to induce one or more or a plurality, e.g., 3-50 or more, mutations. The test condition can be the administration, delivery or contacting with a putative chemical agent treatment and/or gene therapy treatment. The tag can also be the one or more or a plurality, e.g., 3-50 or more mutations, and the test condition can be the administration, delivery or contacting with a putative chemical agent treatment and/or gene therapy treatment.
[0159] The invention comprehends delivering the CRISPR-Cas system and/or component(s) thereof to the transgenic non-human eukaryote, e.g., mammal; for instance, to leukocytes of a mammal, e.g., a non-human mammal. In general, delivery of the CRISPR-Cas system and/or component(s) thereof and/or coding for component(s) thereof can be as in WO 2014/093622 (PCT/US2013/074667), with AAV, lentivirus, and adenovirus vectors or particles or nanoparticles (including particle bombardment techniques that can include gold or other elemental, e.g., tungsten particles) preferred, and use thereof in the practice of the invention is within the ambit of the skilled artisan from this disclosure and the knowledge in the art, e.g., WO 2014/093622 (PCT/US2013/074667), incorporated herein by reference. The invention involves at least one component of the CRISPR complex, e.g., RNA, delivered via at least one vector or particle or nanoparticle complex. In some aspects, the invention provides methods comprising delivering one or more polynucleotides, such as or one or more vectors as described herein, one or more transcripts thereof, and/or one or proteins transcribed therefrom, to a host leukocyte. In some aspects, the invention further provides leukocytes produced by such methods, and animals comprising such leukocytes. In some embodiments, a CRISPR enzyme in combination with (and optionally complexed with) a guide sequence is delivered to a leukocyte. Conventional viral and non-viral based gene transfer methods can be used to introduce nucleic acids in mammalian leukocytes. Such methods can be used to administer nucleic acids encoding components of a CRISPR system to leukocytes in culture, or in a host organism. Non-viral vector delivery systems include DNA plasmids, RNA (e.g. a transcript of a vector described herein), naked nucleic acid, and nucleic acid complexed with a delivery vehicle, such as a liposome. Viral vector delivery systems include DNA and RNA viruses, which have either episomal or integrated genomes after delivery to the cell. For a review of gene therapy procedures, see Anderson, Science 256:808-813 (1992); Nabel & Felgner, TIBTECH 11:211-217 (1993); Mitani & Caskey, TIBTECH 11:162-166 (1993); Dillon, TIBTECH 11:167-175 (1993); Miller, Nature 357:455-460 (1992); Van Brunt, Biotechnology 6(10):1149-1154 (1988); Vigne, Restorative Neurology and Neuroscience 8:35-36 (1995); Kremer & Perricaudet, British Medical Bulletin 51(1):31-44 (1995); Haddada et al., in Current Topics in Microbiology and Immunology Doerfler and Bhm (eds) (1995); and Yu et al., Gene Therapy 1:13-26 (1994). Methods of non-viral delivery of nucleic acids include lipofection, microinjection, biolistics, virosomes, liposomes, immunoliposomes, polycation or lipid:nucleic acid conjugates, naked DNA, artificial virions, cell-penetrating peptides and agent-enhanced uptake of DNA. Cell-penetrating peptides are described in, for example, Stalmans et al. PLoS One. 2013; 8(8): e71752 and Milletti et al. (2012), Drug Discov Today 17: 850-860. Lipofection is described in e.g., U.S. Pat. Nos. 5,049,386, 4,946,787; and 4,897,355) and lipofection reagents are sold commercially (e.g., Transfectam and Lipofectin). Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides include those of Felgner, WO 91/17424; WO 91/16024. Delivery can be to leukocytes in culture (e.g. in vitro or ex vivo administration) or leukocytes in an animal (e.g. in vivo administration). The preparation of lipid:nucleic acid complexes, including targeted liposomes such as immunolipid complexes, is well known to one of skill in the art (see, e.g., Crystal, Science 270:404-410 (1995); Blaese et al., Cancer Gene Ther. 2:291-297 (1995); Behr et al., Bioconjugate Chem. 5:382-389 (1994); Remy et al., Bioconjugate Chem. 5:647-654 (1994); Gao et al., Gene Therapy 2:710-722 (1995); Ahmad et al., Cancer Res. 52:4817-4820 (1992); U.S. Pat. Nos. 4,186,183, 4,217,344, 4,235,871, 4,261,975, 4,485,054, 4,501,728, 4,774,085, 4,837,028, and 4,946,787). The use of RNA or DNA viral based systems for the delivery of nucleic acids take advantage of highly evolved processes for targeting a virus to specific cells in the body and trafficking the viral payload to the nucleus. Viral vectors can be administered directly to patients (in vivo) or they can be used to treat leukocytes in vitro, and the modified leukocytes may optionally be administered to patients (ex vivo). Conventional viral based systems could include retroviral, lentivirus, adenoviral, adeno-associated and herpes simplex virus vectors for gene transfer. Integration in the host genome is possible with the retrovirus, lentivirus, and adeno-associated virus gene transfer methods, often resulting in long term expression of the inserted transgene. Additionally, high transduction efficiencies have been observed in many different cell types and target tissues.
[0160] Adeno-associated virus (AAV) vectors may also be used to transduce cells with target nucleic acids, e.g., in the in vitro production of nucleic acids and peptides, and for in vivo and ex vivo gene therapy procedures (see, e.g., West et al., Virology 160:38-47 (1987); U.S. Pat. No. 4,797,368; WO 93/24641; Kotin, Human Gene Therapy 5:793-801 (1994); Muzyczka, J. Clin. Invest. 94:1351 (1994). Construction of recombinant AAV vectors are described in a number of publications, including U.S. Pat. No. 5,173,414; Tratschin et al., Mol. Cell. Biol. 5:3251-3260 (1985); Tratschin, et al., Mol. Cell. Biol. 4:2072-2081 (1984); Hermonat & Muzyczka, PNAS 81:6466-6470 (1984); and Samulski et al., J. Virol. 63:03822-3828 (1989). Packaging cells are typically used to form virus particles that are capable of infecting a host cell. Such cells include 293 cells, which package adenovirus, and 2 cells or PA317 cells, which package retrovirus. Viral vectors used in gene therapy are usually generated by producer a cell line that packages a nucleic acid vector into a viral particle. The vectors typically contain the minimal viral sequences required for packaging and subsequent integration into a host, other viral sequences being replaced by an expression cassette for the polynucleotide(s) to be expressed. The missing viral functions are typically supplied in trans by the packaging cell line. For example, AAV vectors used in gene therapy typically only possess ITR sequences from the AAV genome which are required for packaging and integration into the host genome. Viral DNA is packaged in a cell line, which contains a helper plasmid encoding the other AAV genes, namely rep and cap, but lacking ITR sequences. The cell line may also be infected with adenovirus as a helper. The helper virus promotes replication of the AAV vector and expression of AAV genes from the helper plasmid. The helper plasmid is not packaged in significant amounts due to a lack of ITR sequences. Contamination with adenovirus can be reduced by, e.g., heat treatment to which adenovirus is more sensitive than AAV. Accordingly, AAV is considered an ideal candidate for use as a transducing vector. Such AAV transducing vectors can comprise sufficient cis-acting functions to replicate in the presence of adenovirus or herpesvirus or poxvirus (e.g., vaccinia virus) helper functions provided in trans. Recombinant AAV (rAAV) can be used to carry exogenous genes into cells of a variety of lineages. In these vectors, the AAV cap and/or rep genes are deleted from the viral genome and replaced with a DNA segment of choice. Current AAV vectors may accommodate up to 4300 bases of inserted DNA. There are a number of ways to produce rAAV, and the invention provides rAAV and methods for preparing rAAV. For example, plasmid(s) containing or consisting essentially of the desired viral construct are transfected into AAV-infected cells. In addition, a second or additional helper plasmid is cotransfected into these cells to provide the AAV rep and/or cap genes which are obligatory for replication and packaging of the recombinant viral construct. Under these conditions, the rep and/or cap proteins of AAV act in trans to stimulate replication and packaging of the rAAV construct. Two to Three days after transfection, rAAV is harvested. Traditionally rAAV is harvested from the cells along with adenovirus. The contaminating adenovirus is then inactivated by heat treatment. In the instant invention, rAAV is advantageously harvested not from the cells themselves, but from cell supernatant. Accordingly, in an initial aspect the invention provides for preparing rAAV, and in addition to the foregoing, rAAV can be prepared by a method that comprises or consists essentially of: infecting susceptible cells with a rAAV containing exogenous DNA including DNA for expression, and helper virus (e.g., adenovirus, herpesvirus, poxvirus such as vaccinia virus) wherein the rAAV lacks functioning cap and/or rep (and the helper virus (e.g., adenovirus, herpesvirus, poxvirus such as vaccinia virus) provides the cap and/or rev function that the rAAV lacks); or infecting susceptible cells with a rAAV containing exogenous DNA including DNA for expression, wherein the recombinant lacks functioning cap and/or rep, and transfecting said cells with a plasmid supplying cap and/or rep function that the rAAV lacks; or infecting susceptible cells with a rAAV containing exogenous DNA including DNA for expression, wherein the recombinant lacks functioning cap and/or rep, wherein said cells supply cap and/or rep function that the recombinant lacks; or transfecting the susceptible cells with an AAV lacking functioning cap and/or rep and plasmids for inserting exogenous DNA into the recombinant so that the exogenous DNA is expressed by the recombinant and for supplying rep and/or cap functions whereby transfection results in an rAAV containing the exogenous DNA including DNA for expression that lacks functioning cap and/or rep. The rAAV can be from an AAV as herein described, and advantageously can be an rAAV1, rAAV2, AAV5 or rAAV having hybrid or capsid which may comprise AAV1, AAV2, AAV5 or any combination thereof. One can select the AAV of the rAAV with regard to the cells to be targeted by the rAAV. In addition to 293 cells, other cells that can be used in the practice of the invention and the relative infectivity of certain AAV serotypes in vitro as to these cells; see Grimm, D. et al, J. Virol. 82: 5887-5911 (2008). The invention provides rAAV that contains or consists essentially of an exogenous nucleic acid molecule encoding a CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) system or component(s) or coding therefor, e.g., a plurality of cassettes comprising or consisting a first cassette comprising or consisting essentially of a promoter, a nucleic acid molecule encoding a CRISPR-associated (Cas) protein (putative nuclease or helicase proteins), e.g., Cas9 and a terminator, and a two, or more, advantageously up to the packaging size limit of the vector, e.g., in total (including the first cassette) five, cassettes comprising or consisting essentially of a promoter, nucleic acid molecule encoding guide RNA (gRNA) and a terminator (e.g., each cassette schematically represented as Promoter-gRNA1-terminator, Promoter-gRNA2-terminator Promoter-gRNA(N)-terminator (where N is a number that can be inserted that is at an upper limit of the packaging size limit of the vector), or two or more individual rAAVs, each containing one or more than one cassette of a CRISPR system, e.g., a first rAAV containing the first cassette comprising or consisting essentially of a promoter, a nucleic acid molecule encoding Cas, e.g., Cas9 and a terminator, and a second rAAV containing a plurality, four, cassettes comprising or consisting essentially of a promoter, nucleic acid molecule encoding guide RNA (gRNA) and a terminator (e.g., each cassette schematically represented as Promoter-gRNA1-terminator, Promoter-gRNA2-terminator Promoter-gRNA(N)-terminator (where N is a number that can be inserted that is at an upper limit of the packaging size limit of the vector). As rAAV is a DNA virus, the nucleic acid molecules in the herein discussion concerning AAV or rAAV are advantageously DNA. The promoter is in some embodiments advantageously human Synapsin I promoter (hSyn).
[0161] In some embodiments, a leukocyte transiently transfected with the components of a CRISPR system as described herein (such as by transient transfection of one or more vectors, or transfection with RNA), and modified through the activity of a CRISPR complex, is used to establish a new leukocyte cell line comprising leukocytes containing the modification but lacking any other exogenous sequence. In some embodiments, leukocytes transiently or non-transiently transfected with one or more vectors described herein, or cell lines derived from such cells are used in assessing one or more test compounds.
[0162] If a Cas9-expressing model provided for herein is used, then only delivery of guide(s) is necessary. In some embodiments, one or more vectors described herein are used to produce a non-human transgenic Cas9 eukaryote, e.g., animal, mammal, primate, rodent, mouse, rat, rabbit. In some embodiments, the transgenic animal is a mammal, such as a mouse, rat, or rabbit. Guides or RNA(s) can be delivered via the same vector types as Cas9. When both guides or RNA(s) and Cas9 are being delivered a dual-vector system where the Cas9 is delivered via in vivo expression from an AAV vector and the guide(s) are delivered by a separate AAV vector. This can be done substantially contemporaneously (i.e. co-delivery), but it could also be done at separate points in time, separated even by weeks or months. Of course, the ultimate separation is where the transgenic Cas9 eukaryote is generated and thereafter the guide(s) or RNA(s) are delivered. Alternatively a first round of CRISPR-Cas9 systems can be delivered, and subsequently further guides or RNA(s) are delivered as the original Cas9 is still functional in the target cells may be re-used. If the Cas9 is under the control of an inducible promoter, then induction of transcription of new CAs9 in the target cells is preferred.
[0163] Aerosolized delivery is preferred for AAV or adenovirus delivery in general. An adenovirus or an AAV particle may be used for delivery. Suitable gene constructs, each operably linked to one or more regulatory sequences, may be cloned into the delivery vector. In this instance, Cbh or EF1a promoter for Cas9, U6 or H1 promoter for chimeric guide RNA may be advantageous. Cas9 and/or RNA(s) can be delivered using particles, adeno associated virus (AAV), lentivirus, adenovirus or other plasmid or viral vector types, in particular, using formulations and doses from, for example, U.S. Pat. No. 8,454,972 (formulations, doses for adenovirus), U.S. Pat. No. 8,404,658 (formulations, doses for AAV) and U.S. Pat. No. 5,846,946 (formulations, doses for DNA plasmids) and from clinical trials and publications regarding the clinical trials involving lentivirus, AAV and adenovirus. For examples, for AAV, the route of administration, formulation and dose can be as in U.S. Pat. No. 8,454,972 and as in clinical trials involving AAV. For Adenovirus, the route of administration, formulation and dose can be as in U.S. Pat. No. 8,404,658 and as in clinical trials involving adenovirus. For plasmid delivery, the route of administration, formulation and dose can be as in U.S. Pat. No. 5,846,946 and as in clinical studies involving plasmids. Doses may be based on or extrapolated to an average 70 kg individual, and can be adjusted for patients, subjects, mammals of different weight and species. Frequency of administration is within the ambit of the medical or veterinary practitioner (e.g., physician, veterinarian), depending on usual factors including the age, sex, general health, other conditions of the patient or subject and the particular condition or symptoms being addressed. The vectors can be injected into the tissue of interest. For cell-type specific genome modification, the expression of Cas9 can be driven by a cell-type specific promoter.
[0164] Among vectors that may be used in the practice of the invention, integration in the host genome is possible with the retrovirus, lentivirus, and adeno-associated virus gene transfer methods, often resulting in long term expression of the inserted transgene. Additionally, high transduction efficiencies have been observed in many different cell types and target tissues. The tropism of a retrovirus can be altered by incorporating foreign envelope proteins, expanding the potential target population of target cells. Lentiviral vectors are retroviral vectors (and hence both lentiviral and retroviral vectors may be used in the practice of the invention). Moreover, lentiviral vectors are preferred as they are able to transduce or infect non-dividing cells and typically produce high viral titers. Selection of a retroviral gene transfer system may therefore depend on the target tissue. Retroviral vectors are comprised of cis-acting long terminal repeats with packaging capacity for up to 6-10 kb of foreign sequence. The minimum cis-acting LTRs are sufficient for replication and packaging of the vectors, which are then used to integrate the therapeutic gene into the target cell to provide permanent transgene expression. Widely used retroviral vectors that may be used in the practice of the invention include those based upon murine leukemia virus (MuLV), gibbon ape leukemia virus (GaLV), Simian Immuno deficiency virus (SIV), human immuno deficiency virus (HIV), and combinations thereof (see, e.g., Buchscher et al., J. Virol. 66:2731-2739 (1992); Johann et al., J. Virol. 66:1635-1640 (1992); Sommnerfelt et al., Virol. 176:58-59 (1990); Wilson et al., J. Virol. 63:2374-2378 (1989); Miller et al., J. Virol. 65:2220-2224 (1991); PCT/US94/05700). Zou et al. administered about 10 l of a recombinant lentivirus having a titer of 110.sup.9 transducing units (TU)/ml by an intrathecal catheter. These sort of dosages can be adapted or extrapolated to use of a retroviral or lentiviral vector in the present invention.
[0165] Also useful in the practice of the invention is a minimal non-primate lentiviral vector, such as a lentiviral vector based on the equine infectious anemia virus (EIAV) (see, e.g., Balagaan, J Gene Med 2006; 8: 275-285, Published online 21 Nov. 2005 in Wiley InterScience (www.interscience.wiley.com). DOI: 10.1002/jgm.845). The vectors may have cytomegalovirus (CMV) promoter driving expression of the target gene. Intracameral, subretinal, intraocular and intravitreal injections are all within the ambit of the instant invention (see, e.g., Balagaan, J Gene Med 2006; 8: 275-285, Published online 21 Nov. 2005 in Wiley InterScience (www.interscience.wiley.com). DOI: 10.1002/jgm.845). In this regard, mention is made of RetinoStat, an equine infectious anemia virus-based lentiviral gene therapy vector that expresses angiostatic proteins endostain and angiostatin that is delivered via a subretinal injection for the treatment of the web form of age-related macular degeneration is also contemplated (see, e.g., Binley et al., HUMAN GENE THERAPY 23:980-991 (September 2012)). Such a vector may be modified for practice of the present invention. Dosing of RetinoStat (e.g., 1.110.sup.5 transducing units per eye (TU/eye) in a total volume of 100 l) can be applied or extrapolated from in practicing the present invention with a lentivirus.
[0166] The invention also can be practiced with an adenovirus vector, e.g., an E1-, partial E3-, E4-deleted adenoviral vector may be used in the practice of the invention. Such vectors are safe as twenty-eight patients with advanced neovascular age-related macular degeneration (AMD) were given a single intravitreous injection of an E1-, partial E3-, E4-deleted adenoviral vector expressing human pigment epithelium-derived factor (AdPEDF.ll) (see, e.g., Campochiaro et al., Human Gene Therapy 17:167-176 (February 2006)); and previous adenovirus doses ranging from 10.sup.6 to 10.sup.9.5 particle units (PU) can be adapted to or employed in the practice of the instant invention (see, e.g., Campochiaro et al., Human Gene Therapy 17:167-176 (February 2006)). Adenoviral vector-mediated RNA transfer appears to be a viable approach for delivery of RNA(S). For adenoviral vector injections into a rat, 210.sup.9 infectious particles were injected in 3 ml of normal saline solution (NSS). This can be adapted to or extrapolated from in the practice of the present invention. For siRNA, a rat was injected into the great saphenous vein with 12.5 g of a siRNA and a primate was injected injected into the great saphenous vein with 750 g of a siRNA. This can be adapted to or extrapolated from in the practice of the present invention.
[0167] Accordingly, the invention contemplates amongst vector(s) useful in the practice of the invention: viral vectors, including retroviral vectors, lentiviral vectors, adenovirus vectors, or AAV vectors.
[0168] Several types of particle and nanoparticle delivery systems and/or formulations are known to be useful in a diverse spectrum of biomedical applications; and particle and nanoparticle delivery systems in the practice of the instant invention can be as in WO 2014/093622 (PCT/US13/74667). In general, a particle is defined as a small object that behaves as a whole unit with respect to its transport and properties. Particles are further classified according to diameter. Coarse particles cover a range between 2,500 and 10,000 nanometers. Fine particles are sized between 100 and 2,500 nanometers. Ultrafine particles, or nanoparticles, are generally between 1 and 100 nanometers in size. The basis of the 100-nm limit is the fact that novel properties that differentiate particles from the bulk material typically develop at a critical length scale of under 100 nm. As used herein, a particle delivery system/formulation is defined as any biological delivery system/formulation which includes a particle in accordance with the present invention. A particle in accordance with the present invention is any entity having a greatest dimension (e.g. diameter) of less than 100 microns (m). In some embodiments, inventive particles have a greatest dimension of less than 10 m. In some embodiments, inventive particles have a greatest dimension of less than 2000 nanometers (nm). In some embodiments, inventive particles have a greatest dimension of less than 1000 nanometers (nm). In some embodiments, inventive particles have a greatest dimension of less than 900 nm, 800 nm, 700 nm, 600 nm, 500 nm, 400 nm, 300 nm, 200 nm, or 100 nm. Typically, inventive particles have a greatest dimension (e.g., diameter) of 500 nm or less. In some embodiments, inventive particles have a greatest dimension (e.g., diameter) of 250 nm or less. In some embodiments, inventive particles have a greatest dimension (e.g., diameter) of 200 nm or less. In some embodiments, inventive particles have a greatest dimension (e.g., diameter) of 150 nm or less. In some embodiments, inventive particles have a greatest dimension (e.g., diameter) of 100 nm or less. Smaller particles, e.g., having a greatest dimension of 50 nm or less are used in some embodiments of the invention. In some embodiments, inventive particles have a greatest dimension ranging between 25 nm and 200 nm. Particle characterization (including e.g., characterizing morphology, dimension, etc.) is done using a variety of different techniques. Common techniques are electron microscopy (TEM, SEM), atomic force microscopy (AFM), dynamic light scattering (DLS), X-ray photoelectron spectroscopy (XPS), powder X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR), matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF), ultraviolet-visible spectroscopy, dual polarisation interferometry and nuclear magnetic resonance (NMR). Characterization (dimension measurements) may be made as to native particles (i.e., preloading) or after loading of the cargo (herein cargo refers to e.g., one or more components of CRISPR-Cas system e.g., CRISPR enzyme or mRNA or guide RNA, or any combination thereof, and may include additional carriers and/or excipients) to provide particles of an optimal size for delivery for any in vitro, ex vivo and/or in vivo application of the present invention. In certain preferred embodiments, particle dimension (e.g., diameter) characterization is based on measurements using dynamic laser scattering (DLS). Particles delivery systems within the scope of the present invention may be provided in any form, including but not limited to solid, semi-solid, emulsion, or colloidal particles. As such any of the delivery systems described herein, including but not limited to, e.g., lipid-based systems, liposomes, micelles, microvesicles, exosomes, or gene gun may be provided as particle delivery systems within the scope of the present invention.
[0169] In general, a nanoparticle refers to any particle having a diameter of less than 1000 nm. In certain preferred embodiments, nanoparticles of the invention have a greatest dimension (e.g., diameter) of 500 nm or less. In other preferred embodiments, nanoparticles of the invention have a greatest dimension ranging between 25 nm and 200 nm. In other preferred embodiments, nanoparticles of the invention have a greatest dimension of 100 nm or less. In other preferred embodiments, nanoparticles of the invention have a greatest dimension ranging between 35 nm and 60 nm. Nanoparticles encompassed in the present invention may be provided in different forms, e.g., as solid nanoparticles (e.g., metal such as silver, gold, iron, titanium), non-metal, lipid-based solids, polymers), suspensions of nanoparticles, or combinations thereof. Metal, dielectric, and semiconductor nanoparticles may be prepared, as well as hybrid structures (e.g., core-shell nanoparticles). Nanoparticles made of semiconducting material may also be labeled quantum dots if they are small enough (typically sub 10 nm) that quantization of electronic energy levels occurs. Such nanoscale particles are used in biomedical applications as drug carriers or imaging agents and may be adapted for similar purposes in the present invention.
[0170] Semi-solid and soft nanoparticles have been manufactured, and are within the scope of the present invention. A prototype nanoparticle of semi-solid nature is the liposome. Various types of liposome nanoparticles are currently used clinically as delivery systems for anticancer drugs and vaccines. Nanoparticles with one half hydrophilic and the other half hydrophobic are termed Janus particles and are particularly effective for stabilizing emulsions. They can self-assemble at water/oil interfaces and act as solid surfactants. Doses of about 5 mg/kg are contemplated, with single or multiple doses, depending on the target tissue. It is mentioned herein experiments involving mice involve 20 g mammals and that dosing can be scaled up to a 70 kg human. With regard to nanoparticles that can deliver RNA, see, e.g., Alabi et al., Proc Natl Acad Sci USA. 2013 Aug. 6; 110(32):12881-6; Zhang et al., Adv Mater. 2013 Sep. 6; 25(33):4641-5; Jiang et al., Nano Lett. 2013 Mar. 13; 13(3):1059-64; Karagiannis et al., ACS Nano. 2012 Oct. 23; 6(10):8484-7; Whitehead et al., ACS Nano. 2012 Aug. 28; 6(8):6922-9 and Lee et al., Nat Nanotechnol. 2012 Jun. 3; 7(6):389-93. Lipid Nanoparticles, Spherical Nucleic Acid (SNA) constructs, nanoplexes and other nanoparticles (particularly gold nanoparticles) are also contemplate as a means for delivery of CRISPR/Cas system or component(s) thereof or vector(s) to intended targets. Particles, nanoparticles, and the like and vectors are advantageous for delivering the RNA(s) of the CRISPR-Cas9 system and particles and nanoparticles and the like may be advantageous for delivery of vector containing nucleic acid(s) encoding or comprising RNA(s) of the invention. In certain instances, e.g., where Cas9 is constitutively or inducibly or conditionally expressed by an organism or cells thereof, it is useful to deliver the RNA(s) (also herein sometimes termed guides) of the CRISPR-Cas9 system separately from the Cas9. It is considered as advantageous that the Cas9 may be delivered via a viral vector or be constitutively or inducibly or conditionally expressed and that guides specific to genomic targets are delivered separately. A recent publication, entitled In vivo endothelial siRNA delivery using polymeric nanoparticles with low molecular weight by James E. Dahlman and Carmen Barnes et al. Nature Nanotechnology (2014) published online 11 May 2014, doi:10.1038/nnano.2014.84, incorporated herein in its entirety, showed that polymeric nanoparticles made of low-molecular-weight polyamines and lipids can deliver siRNA to endothelial cells with high efficiency, thereby facilitating the simultaneous silencing of multiple endothelial genes in vivo. The authors reported that unlike lipid or lipid-like nanoparticles, the nanoparticle formulation they used (termed 7C1), differed from traditional lipid-based nanoparticle formulations because it can deliver siRNA to lung endothelial cells at low doses without substantially reducing gene expression in pulmonary immune cells, hepatocytes or peritoneal immune cells. Successful in vivo use of a nanoparticle formulation in the context of CRISPR-Cas to achieve functional gene silencing is possible with the 7C1 nanoparticle. The 7C1 nanoparticle can be formulated to mediate delivery of sgRNA to constitutively active Cas9 mouse. Synthesis of the 7C1 nanoparticle is described in Dahlman et al., 2014, Nature Nanotechnology.
[0171] Kits: In an aspect, the invention provides kits containing any one or more of the elements discussed herein. Elements may be provided individually or in combinations, and may be provided in any suitable container, such as a vial, a bottle, or a tube. In some embodiments, the kit includes instructions in one or more languages, for example in more than one language. In some embodiments, a kit comprises one or more reagents for use in a process utilizing one or more of the elements described herein. Reagents may be provided in any suitable container. For example, a kit may provide one or more reaction or storage buffers. Reagents may be provided in a form that is usable in a particular assay, or in a form that requires addition of one or more other components before use (e.g. in concentrate or lyophilized form). A buffer can be any buffer, including but not limited to a sodium carbonate buffer, a sodium bicarbonate buffer, a borate buffer, a Tris buffer, a MOPS buffer, a HEPES buffer, and combinations thereof. In some embodiments, the buffer is alkaline. In some embodiments, the buffer has a pH from about 7 to about 10. In some embodiments, the kit comprises one or more oligonucleotides corresponding to a guide sequence for insertion into a vector so as to operably link the guide sequence and a regulatory element. In some embodiments, the kit comprises a homologous recombination template polynucleotide. In some embodiments, the kit comprises one or more of the vectors and/or one or more of the polynucleotides described herein. The kit may advantageously allow the provision of all elements of the systems of the invention. Kits can involve vector(s) and/or particle(s) and/or nanoparticle(s) containing or encoding RNA(s) for 3-50 or more mutations to be administered to a non-human transgenic Cas9 eukaryote, e.g., animal, mammal, primate, rodent, etc., with such a kit including instructions for administering to such a eukaryote; and such a kit can optionally include a transgenic Cas9 eukaryote, or when such a transgenic Cas9 eukaryote has Cas9 expression that is inducible or conditional, e.g., Cre-dependent, the kit may also include a mate that expresses the compound that induces or is the trigger or condition for Cas9 expression, e,g, Cre, either throughout all cells or in only certain cells or tissue, whereby offspring of the eukaryotes express of Cas9, e.g., in specific tissues or throughout most or all or nearly all cells, whereby the kit can include instructions for mating and then administering.
[0172] Nucleic acids, amino acids and proteins: The invention uses nucleic acids to bind target DNA sequences. This is advantageous as nucleic acids are much easier and cheaper to produce than proteins, and the specificity can be varied according to the length of the stretch where homology is sought. Complex 3-D positioning of multiple fingers, for example is not required. The terms polynucleotide, nucleotide, nucleotide sequence, nucleic acid and oligonucleotide are used interchangeably. They refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. Polynucleotides may have any three dimensional structure, and may perform any function, known or unknown. The following are non-limiting examples of polynucleotides: coding or non-coding regions of a gene or gene fragment, loci (locus) defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, short interfering RNA (siRNA), short-hairpin RNA (shRNA), micro-RNA (miRNA), ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers. The term also encompasses nucleic-acid-like structures with synthetic backbones, see, e.g., Eckstein, 1991; Baserga et al., 1992; Milligan, 1993; WO 97/03211; WO 96/39154; Mata, 1997; Strauss-Soukup, 1997; and Samstag, 1996. A polynucleotide may comprise one or more modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer. The sequence of nucleotides may be interrupted by non-nucleotide components. A polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component. As used herein the term wild type is a term of the art understood by skilled persons and means the typical form of an organism, strain, gene or characteristic as it occurs in nature as distinguished from mutant or variant forms. A wild type can be a base line. As used herein the term variant should be taken to mean the exhibition of qualities that have a pattern that deviates from what occurs in nature. The terms non-naturally occurring or engineered are used interchangeably and indicate the involvement of the hand of man. The terms, when referring to nucleic acid molecules or polypeptides mean that the nucleic acid molecule or the polypeptide is at least substantially free from at least one other component with which they are naturally associated in nature and as found in nature. Complementarity refers to the ability of a nucleic acid to form hydrogen bond(s) with another nucleic acid sequence by either traditional Watson-Crick base pairing or other non-traditional types. A percent complementarity indicates the percentage of residues in a nucleic acid molecule which can form hydrogen bonds (e.g., Watson-Crick base pairing) with a second nucleic acid sequence (e.g., 5, 6, 7, 8, 9, 10 out of 10 being 50%, 60%, 70%, 80%, 90%, and 100% complementary). Perfectly complementary means that all the contiguous residues of a nucleic acid sequence will hydrogen bond with the same number of contiguous residues in a second nucleic acid sequence. Substantially complementary as used herein refers to a degree of complementarity that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, or more nucleotides, or refers to two nucleic acids that hybridize under stringent conditions. As used herein, stringent conditions for hybridization refer to conditions under which a nucleic acid having complementarity to a target sequence predominantly hybridizes with the target sequence, and substantially does not hybridize to non-target sequences. Stringent conditions are generally sequence-dependent, and vary depending on a number of factors. In general, the longer the sequence, the higher the temperature at which the sequence specifically hybridizes to its target sequence. Non-limiting examples of stringent conditions are described in detail in Tijssen (1993), Laboratory Techniques In Biochemistry And Molecular Biology-Hybridization With Nucleic Acid Probes Part I, Second Chapter Overview of principles of hybridization and the strategy of nucleic acid probe assay, Elsevier, N.Y. Where reference is made to a polynucleotide sequence, then complementary or partially complementary sequences are also envisaged. These are preferably capable of hybridising to the reference sequence under highly stringent conditions. Generally, in order to maximize the hybridization rate, relatively low-stringency hybridization conditions are selected: about 20 to 25 C. lower than the thermal melting point (T.sub.m). The T.sub.m is the temperature at which 50% of specific target sequence hybridizes to a perfectly complementary probe in solution at a defined ionic strength and pH. Generally, in order to require at least about 85% nucleotide complementarity of hybridized sequences, highly stringent washing conditions are selected to be about 5 to 15 C. lower than the T.sub.m. In order to require at least about 70% nucleotide complementarity of hybridized sequences, moderately-stringent washing conditions are selected to be about 15 to 30 C. lower than the T.sub.m. Highly permissive (very low stringency) washing conditions may be as low as 50 C. below the T.sub.m, allowing a high level of mis-matching between hybridized sequences. Those skilled in the art will recognize that other physical and chemical parameters in the hybridization and wash stages can also be altered to affect the outcome of a detectable hybridization signal from a specific level of homology between target and probe sequences. Preferred highly stringent conditions comprise incubation in 50% formamide, 5SSC, and 1% SDS at 42 C., or incubation in 5SSC and 1% SDS at 65 C., with wash in 0.2SSC and 0.1% SDS at 65 C. Hybridization refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues. The hydrogen bonding may occur by Watson Crick base pairing, Hoogstein binding, or in any other sequence specific manner. The complex may comprise two strands forming a duplex structure, three or more strands forming a multi stranded complex, a single self-hybridizing strand, or any combination of these. A hybridization reaction may constitute a step in a more extensive process, such as the initiation of PCR, or the cleavage of a polynucleotide by an enzyme. A sequence capable of hybridizing with a given sequence is referred to as the complement of the given sequence. As used herein, the term genomic locus or locus (plural loci) is the specific location of a gene or DNA sequence on a chromosome. A gene refers to stretches of DNA or RNA that encode a polypeptide or an RNA chain that has functional role to play in an organism and hence is the molecular unit of heredity in living organisms. For the purpose of this invention it may be considered that genes include regions which regulate the production of the gene product, whether or not such regulatory sequences are adjacent to coding and/or transcribed sequences. Accordingly, a gene includes, but is not necessarily limited to, promoter sequences, terminators, translational regulatory sequences such as ribosome binding sites and internal ribosome entry sites, enhancers, silencers, insulators, boundary elements, replication origins, matrix attachment sites and locus control regions. As used herein, expression of a genomic locus or gene expression is the process by which information from a gene is used in the synthesis of a functional gene product. The products of gene expression are often proteins, but in non-protein coding genes such as rRNA genes or tRNA genes, the product is functional RNA. The process of gene expression is used by all known lifeeukaryotes (including multicellular organisms), prokaryotes (bacteria and archaea) and viruses to generate functional products to survive. As used herein expression of a gene or nucleic acid encompasses not only cellular gene expression, but also the transcription and translation of nucleic acid(s) in cloning systems and in any other context. As used herein, expression also refers to the process by which a polynucleotide is transcribed from a DNA template (such as into and mRNA or other RNA transcript) and/or the process by which a transcribed mRNA is subsequently translated into peptides, polypeptides, or proteins. Transcripts and encoded polypeptides may be collectively referred to as gene product. If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in a eukaryotic cell. The terms polypeptide, peptide and protein are used interchangeably herein to refer to polymers of amino acids of any length. The polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non amino acids. The terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component. As used herein the term amino acid includes natural and/or unnatural or synthetic amino acids, including glycine and both the D or L optical isomers, and amino acid analogs and peptidomimetics. As used herein, the term domain or protein domain refers to a part of a protein sequence that may exist and function independently of the rest of the protein chain. As described in aspects of the invention, sequence identity is related to sequence homology. Homology comparisons may be conducted by eye, or more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs may calculate percent (%) homology between two or more sequences and may also calculate the sequence identity shared by two or more amino acid or nucleic acid sequences. In some preferred embodiments, the capping region of the dTALEs described herein have sequences that are at least 95% identical or share identity to the capping region amino acid sequences provided herein. Sequence homologies may be generated by any of a number of computer programs known in the art, for example BLAST or FASTA, etc. A suitable computer program for carrying out such an alignment is the GCG Wisconsin Bestfit package (University of Wisconsin, U.S.A; Devereux et al., 1984, Nucleic Acids Research 12:387). Examples of other software than may perform sequence comparisons include, but are not limited to, the BLAST package (see Ausubel et al., 1999 ibidChapter 18), FASTA (Atschul et al., 1990, J. Mol. Biol., 403-410) and the GENEWORKS suite of comparison tools. Both BLAST and FASTA are available for offline and online searching (see Ausubel et al., 1999 ibid, pages 7-58 to 7-60). However it is preferred to use the GCG Bestfit program. Percentage (%) sequence homology may be calculated over contiguous sequences, i.e., one sequence is aligned with the other sequence and each amino acid or nucleotide in one sequence is directly compared with the corresponding amino acid or nucleotide in the other sequence, one residue at a time. This is called an ungapped alignment. Typically, such ungapped alignments are performed only over a relatively short number of residues. Although this is a very simple and consistent method, it fails to take into consideration that, for example, in an otherwise identical pair of sequences, one insertion or deletion may cause the following amino acid residues to be put out of alignment, thus potentially resulting in a large reduction in % homology when a global alignment is performed. Consequently, most sequence comparison methods are designed to produce optimal alignments that take into consideration possible insertions and deletions without unduly penalizing the overall homology or identity score. This is achieved by inserting gaps in the sequence alignment to try to maximize local homology or identity. However, these more complex methods assign gap penalties to each gap that occurs in the alignment so that, for the same number of identical amino acids, a sequence alignment with as few gaps as possiblereflecting higher relatedness between the two compared sequencesmay achieve a higher score than one with many gaps. Affinity gap costs are typically used that charge a relatively high cost for the existence of a gap and a smaller penalty for each subsequent residue in the gap. This is the most commonly used gap scoring system. High gap penalties may, of course, produce optimized alignments with fewer gaps. Most alignment programs allow the gap penalties to be modified. However, it is preferred to use the default values when using such software for sequence comparisons. For example, when using the GCG Wisconsin Bestfit package the default gap penalty for amino acid sequences is 12 for a gap and 4 for each extension. Calculation of maximum % homology therefore first requires the production of an optimal alignment, taking into consideration gap penalties. A suitable computer program for carrying out such an alignment is the GCG Wisconsin Bestfit package (Devereux et al., 1984 Nuc. Acids Research 12 p 387). Examples of other software than may perform sequence comparisons include, but are not limited to, the BLAST package (see Ausubel et al., 1999 Short Protocols in Molecular Biology, 4.sup.th Ed.Chapter 18), FASTA (Altschul et al., 1990 J. Mol. Biol. 403-410) and the GENEWORKS suite of comparison tools. Both BLAST and FASTA are available for offline and online searching (see Ausubel et al., 1999, Short Protocols in Molecular Biology, pages 7-58 to 7-60). However, for some applications, it is preferred to use the GCG Bestfit program. A new tool, called BLAST 2 Sequences is also available for comparing protein and nucleotide sequences (see FEMS Microbiol Lett. 1999 174(2): 247-50; FEMS Microbiol Lett. 1999 177(1): 187-8 and the website of the National Center for Biotechnology information at the website of the National Institutes for Health). Although the final % homology may be measured in terms of identity, the alignment process itself is typically not based on an all-or-nothing pair comparison. Instead, a scaled similarity score matrix is generally used that assigns scores to each pair-wise comparison based on chemical similarity or evolutionary distance. An example of such a matrix commonly used is the BLOSUM62 matrixthe default matrix for the BLAST suite of programs. GCG Wisconsin programs generally use either the public default values or a custom symbol comparison table, if supplied (see user manual for further details). For some applications, it is preferred to use the public default values for the GCG package, or in the case of other software, the default matrix, such as BLOSUM62. Alternatively, percentage homologies may be calculated using the multiple alignment feature in DNASIS (Hitachi Software), based on an algorithm, analogous to CLUSTAL (Higgins D G & Sharp P M (1988), Gene 73(1), 237-244). Once the software has produced an optimal alignment, it is possible to calculate % homology, preferably % sequence identity. The software typically does this as part of the sequence comparison and generates a numerical result. The sequences may also have deletions, insertions or substitutions of amino acid residues which produce a silent change and result in a functionally equivalent substance. Deliberate amino acid substitutions may be made on the basis of similarity in amino acid properties (such as polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues) and it is therefore useful to group amino acids together in functional groups. Amino acids may be grouped together based on the properties of their side chains alone. However, it is more useful to include mutation data as well. The sets of amino acids thus derived are likely to be conserved for structural reasons. These sets may be described in the form of a Venn diagram (Livingstone C. D. and Barton G. J. (1993) Protein sequence alignments: a strategy for the hierarchical analysis of residue conservation Comput. Appl. Biosci. 9: 745-756) (Taylor W. R. (1986) The classification of amino acid conservation J. Theor. Biol. 119; 205-218). Conservative substitutions may be made, for example according to the table below which describes a generally accepted Venn diagram grouping of amino acids.
TABLE-US-00001 Set Sub-set Hydrophobic FWYHKMILVAGC Aromatic FWYH Aliphatic ILV Polar WYHKREDCSTNQ Charged HKRED Positively HKR charged Negatively ED charged Small VCAGSPTND Tiny AGS
[0173] Embodiments of the invention include sequences (both polynucleotide or polypeptide) which may comprise homologous substitution (substitution and replacement are both used herein to mean the interchange of an existing amino acid residue or nucleotide, with an alternative residue or nucleotide) that may occur i.e., like-for-like substitution in the case of amino acids such as basic for basic, acidic for acidic, polar for polar, etc. Non-homologous substitution may also occur i.e., from one class of residue to another or alternatively involving the inclusion of unnatural amino acids such as ornithine (hereinafter referred to as Z), diaminobutyric acid ornithine (hereinafter referred to as B), norleucine ornithine (hereinafter referred to as O), pyriylalanine, thienylalanine, naphthylalanine and phenylglycine. Variant amino acid sequences may include suitable spacer groups that may be inserted between any two amino acid residues of the sequence including alkyl groups such as methyl, ethyl or propyl groups in addition to amino acid spacers such as glycine or -alanine residues. A further form of variation, which involves the presence of one or more amino acid residues in peptoid form, may be well understood by those skilled in the art. For the avoidance of doubt, the peptoid form is used to refer to variant amino acid residues wherein the -carbon substituent group is on the residue's nitrogen atom rather than the -carbon. Processes for preparing peptides in the peptoid form are known in the art, for example Simon R J et al., PNAS (1992) 89(20), 9367-9371 and Horwell D C, Trends Biotechnol. (1995) 13(4), 132-134.
[0174] For purpose of this invention, amplification means any method employing a primer and a polymerase capable of replicating a target sequence with reasonable fidelity. Amplification may be carried out by natural or recombinant DNA polymerases such as TaqGold, T7 DNA polymerase, Klenow fragment of E. coli DNA polymerase, and reverse transcriptase. A preferred amplification method is PCR.
[0175] In certain aspects the invention involves vectors. A used herein, a vector is a tool that allows or facilitates the transfer of an entity from one environment to another. It is a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment. Generally, a vector is capable of replication when associated with the proper control elements. In general, the term vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. Vectors include, but are not limited to, nucleic acid molecules that are single-stranded, double-stranded, or partially double-stranded; nucleic acid molecules that comprise one or more free ends, no free ends (e.g. circular); nucleic acid molecules that comprise DNA, RNA, or both; and other varieties of polynucleotides known in the art. One type of vector is a plasmid, which refers to a circular double stranded DNA loop into which additional DNA segments can be inserted, such as by standard molecular cloning techniques. Another type of vector is a viral vector, wherein virally-derived DNA or RNA sequences are present in the vector for packaging into a virus (e.g. retroviruses, replication defective retroviruses, adenoviruses, replication defective adenoviruses, and adeno-associated viruses (AAVs)). Viral vectors also include polynucleotides carried by a virus for transfection into a host cell. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g. bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively-linked. Such vectors are referred to herein as expression vectors. Common expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
[0176] Recombinant expression vectors can comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory elements, which may be selected on the basis of the host cells to be used for expression, that is operatively-linked to the nucleic acid sequence to be expressed. Within a recombinant expression vector, operably linked is intended to mean that the nucleotide sequence of interest is linked to the regulatory element(s) in a manner that allows for expression of the nucleotide sequence (e.g. in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell). With regards to recombination and cloning methods, mention is made of U.S. patent application Ser. No. 10/815,730, published Sep. 2, 2004 as US 2004-0171156 A1, the contents of which are herein incorporated by reference in their entirety.
[0177] Aspects of the invention relate to bicistronic vectors for chimeric RNA and Cas9. Bicistronic expression vectors for chimeric RNA and Cas9 are preferred. In general and particularly in this embodiment Cas9 is preferably driven by the CBh promoter. The chimeric RNA may preferably be driven by a Pol III promoter, such as a U6 promoter. Ideally the two are combined. The chimeric guide RNA typically consists of a 20 bp guide sequence (Ns) and this may be joined to the tracr sequence (running from the first U of the lower strand to the end of the transcript). The tracr sequence may be truncated at various positions as indicated. The guide and tracr sequences are separated by the tracr-mate sequence, which may be GUUUUAGAGCUA (SEQ ID NO: 26). This may be followed by the loop sequence GAAA as shown. Both of these are preferred examples. Applicants have demonstrated Cas9-mediated indels at the human EMX1 and PVALB loci by SURVEYOR assays. ChiRNAs are indicated by their +n designation, and crRNA refers to a hybrid RNA where guide and tracr sequences are expressed as separate transcripts. Throughout this application, chimeric RNA may also be called single guide, or synthetic guide RNA (sgRNA). The loop is preferably GAAA, but it is not limited to this sequence or indeed to being only 4 bp in length. Indeed, preferred loop forming sequences for use in hairpin structures are four nucleotides in length, and most preferably have the sequence GAAA. However, longer or shorter loop sequences may be used, as may alternative sequences. The sequences preferably include a nucleotide triplet (for example, AAA), and an additional nucleotide (for example C or G). Examples of loop forming sequences include CAAA and AAAG. In practicing any of the methods disclosed herein, a suitable vector can be introduced to a cell or an embryo via one or more methods known in the art, including without limitation, microinjection, electroporation, sonoporation, biolistics, calcium phosphate-mediated transfection, cationic transfection, liposome transfection, dendrimer transfection, heat shock transfection, nucleofection transfection, magnetofection, lipofection, impalefection, optical transfection, proprietary agent-enhanced uptake of nucleic acids, and delivery via liposomes, immunoliposomes, virosomes, or artificial virions. In some methods, the vector is introduced into an embryo by microinjection. The vector or vectors may be microinjected into the nucleus or the cytoplasm of the embryo. In some methods, the vector or vectors may be introduced into a cell by nucleofection.
[0178] The term regulatory element is intended to include promoters, enhancers, internal ribosomal entry sites (IRES), and other expression control elements (e.g. transcription termination signals, such as polyadenylation signals and poly-U sequences). Such regulatory elements are described, for example, in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). Regulatory elements include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). A tissue-specific promoter may direct expression primarily in a desired tissue of interest, such as muscle, neuron, bone, skin, blood, specific organs (e.g. liver, pancreas), or particular cell types (e.g. lymphocytes). Regulatory elements may also direct expression in a temporal-dependent manner, such as in a cell-cycle dependent or developmental stage-dependent manner, which may or may not also be tissue or cell-type specific. In some embodiments, a vector comprises one or more pol III promoter (e.g. 1, 2, 3, 4, 5, or more pol III promoters), one or more pol II promoters (e.g. 1, 2, 3, 4, 5, or more pol II promoters), one or more pol I promoters (e.g. 1, 2, 3, 4, 5, or more pol I promoters), or combinations thereof. Examples of pol III promoters include, but are not limited to, U6 and H1 promoters. Examples of pol II promoters include, but are not limited to, the retroviral Rous sarcoma virus (RSV) LTR promoter (optionally with the RSV enhancer), the cytomegalovirus (CMV) promoter (optionally with the CMV enhancer) [see, e.g., Boshart et al, Cell, 41:521-530 (1985)], the SV40 promoter, the dihydrofolate reductase promoter, the -actin promoter, the phosphoglycerol kinase (PGK) promoter, and the EF1 promoter. Also encompassed by the term regulatory element are enhancer elements, such as WPRE; CMV enhancers; the R-U5 segment in LTR of HTLV-I (Mol. Cell. Biol., Vol. 8(1), p. 466-472, 1988); SV40 enhancer; and the intron sequence between exons 2 and 3 of rabbit -globin (Proc. Natl. Acad. Sci. USA., Vol. 78(3), p. 1527-31, 1981). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression desired, etc. A vector can be introduced into host cells to thereby produce transcripts, proteins, or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., clustered regularly interspersed short palindromic repeats (CRISPR) transcripts, proteins, enzymes, mutant forms thereof, fusion proteins thereof, etc.). With regards to regulatory sequences, mention is made of U.S. patent application Ser. No. 10/491,026, the contents of which are incorporated by reference herein in their entirety. With regards to promoters, mention is made of PCT publication WO 2011/028929 and U.S. application Ser. No. 12/511,940, the contents of which are incorporated by reference herein in their entirety.
[0179] Vectors can be designed for expression of CRISPR transcripts (e.g. nucleic acid transcripts, proteins, or enzymes) in prokaryotic or eukaryotic cells. For example, CRISPR transcripts can be expressed in bacterial cells such as Escherichia coli, insect cells (using baculovirus expression vectors), yeast cells, or mammalian cells. Suitable host cells are discussed further in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). Alternatively, the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.
[0180] Vectors may be introduced and propagated in a prokaryote or prokaryotic cell. In some embodiments, a prokaryote is used to amplify copies of a vector to be introduced into a eukaryotic cell or as an intermediate vector in the production of a vector to be introduced into a eukaryotic cell (e.g. amplifying a plasmid as part of a viral vector packaging system). In some embodiments, a prokaryote is used to amplify copies of a vector and express one or more nucleic acids, such as to provide a source of one or more proteins for delivery to a host cell or host organism. Expression of proteins in prokaryotes is most often carried out in Escherichia coli with vectors containing constitutive or inducible promoters directing the expression of either fusion or non-fusion proteins. Fusion vectors add a number of amino acids to a protein encoded therein, such as to the amino terminus of the recombinant protein. Such fusion vectors may serve one or more purposes, such as: (i) to increase expression of recombinant protein; (ii) to increase the solubility of the recombinant protein; and (iii) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification. Often, in fusion expression vectors, a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protein to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein. Such enzymes, and their cognate recognition sequences, include Factor Xa, thrombin and enterokinase. Example fusion expression vectors include pGEX (Pharmacia Biotech Inc; Smith and Johnson, 1988. Gene 67: 31-40), pMAL (New England Biolabs, Beverly, Mass.) and pRIT5 (Pharmacia, Piscataway, N.J.) that fuse glutathione S-transferase (GST), maltose E binding protein, or protein A, respectively, to the target recombinant protein. Examples of suitable inducible non-fusion E. coli expression vectors include pTrc (Amrann et al., (1988) Gene 69:301-315) and pET 11d (Studier et al., GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 60-89). In some embodiments, a vector is a yeast expression vector. Examples of vectors for expression in yeast Saccharomyces cerivisae include pYepSec1 (Baldari, et al., 1987. EMBO J. 6: 229-234), pMFa (Kuijan and Herskowitz, 1982. Cell 30: 933-943), pJRY88 (Schultz et al., 1987. Gene 54: 113-123), pYES2 (Invitrogen Corporation, San Diego, Calif.), and picZ (InVitrogen Corp, San Diego, Calif.). In some embodiments, a vector drives protein expression in insect cells using baculovirus expression vectors. Baculovirus vectors available for expression of proteins in cultured insect cells (e.g., SF9 cells) include the pAc series (Smith, et al., 1983. Mol. Cell. Biol. 3: 2156-2165) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31-39).
[0181] In some embodiments, a vector is capable of driving expression of one or more sequences in mammalian cells using a mammalian expression vector. Examples of mammalian expression vectors include pCDM8 (Seed, 1987. Nature 329: 840) and pMT2PC (Kaufman, et al., 1987. EMBO J. 6: 187-195). When used in mammalian cells, the expression vector's control functions are typically provided by one or more regulatory elements. For example, commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, simian virus 40, and others disclosed herein and known in the art. For other suitable expression systems for both prokaryotic and eukaryotic cells see, e.g., Chapters 16 and 17 of Sambrook, et al., MOLECULAR CLONING: A LABORATORY MANUAL. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989.
[0182] In some embodiments, the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid). Tissue-specific regulatory elements are known in the art. Non-limiting examples of suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert, et al., 1987. Genes Dev. 1: 268-277), lymphoid-specific promoters (Calame and Eaton, 1988. Adv. Immunol. 43: 235-275), in particular promoters of T cell receptors (Winoto and Baltimore, 1989. EMBO J. 8: 729-733) and immunoglobulins (Baneiji, et al., 1983. Cell 33: 729-740; Queen and Baltimore, 1983. Cell 33: 741-748), neuron-specific promoters (e.g., the neurofilament promoter; Byrne and Ruddle, 1989. Proc. Natl. Acad. Sci. USA 86: 5473-5477), pancreas-specific promoters (Edlund, et al., 1985. Science 230: 912-916), and mammary gland-specific promoters (e.g., milk whey promoter; U.S. Pat. No. 4,873,316 and European Application Publication No. 264,166). Developmentally-regulated promoters are also encompassed, e.g., the murine hox promoters (Kessel and Gruss, 1990. Science 249: 374-379) and the -fetoprotein promoter (Campes and Tilghman, 1989. Genes Dev. 3: 537-546). With regards to these prokaryotic and eukaryotic vectors, mention is made of U.S. Pat. No. 6,750,059, the contents of which are incorporated by reference herein in their entirety. Other embodiments of the invention may relate to the use of viral vectors, with regards to which mention is made of U.S. patent application Ser. No. 13/092,085, the contents of which are incorporated by reference herein in their entirety. Tissue-specific regulatory elements are known in the art and in this regard, mention is made of U.S. Pat. No. 7,776,321, the contents of which are incorporated by reference herein in their entirety. In some embodiments, a regulatory element is operably linked to one or more elements of a CRISPR system so as to drive expression of the one or more elements of the CRISPR system. In general, CRISPRs (Clustered Regularly Interspaced Short Palindromic Repeats), also known as SPIDRs (SPacer Interspersed Direct Repeats), constitute a family of DNA loci that are usually specific to a particular bacterial species. The CRISPR locus comprises a distinct class of interspersed short sequence repeats (SSRs) that were recognized in E. coli (Ishino et al., J. Bacteriol., 169:5429-5433 [1987]; and Nakata et al., J. Bacteriol., 171:3553-3556 [1989]), and associated genes. Similar interspersed SSRs have been identified in Haloferax mediterranei, Streptococcus pyogenes, Anabaena, and Mycobacterium tuberculosis (See, Groenen et al., Mol. Microbiol., 10:1057-1065 [1993]; Hoe et al., Emerg. Infect. Dis., 5:254-263 [1999]; Masepohl et al., Biochim. Biophys. Acta 1307:26-30 [1996]; and Mojica et al., Mol. Microbiol., 17:85-93 [1995]). The CRISPR loci typically differ from other SSRs by the structure of the repeats, which have been termed short regularly spaced repeats (SRSRs) (Janssen et al., OMICS J. Integ. Biol., 6:23-33 [2002]; and Mojica et al., Mol. Microbiol., 36:244-246 [2000]). In general, the repeats are short elements that occur in clusters that are regularly spaced by unique intervening sequences with a substantially constant length (Mojica et al., [2000], supra). Although the repeat sequences are highly conserved between strains, the number of interspersed repeats and the sequences of the spacer regions typically differ from strain to strain (van Embden et al., J. Bacteriol., 182:2393-2401 [2000]). CRISPR loci have been identified in more than 40 prokaryotes (See e.g., Jansen et al., Mol. Microbiol., 43:1565-1575 [2002]; and Mojica et al., [2005]) including, but not limited to Aeropyrum, Pyrobaculum, Sulfolobus, Archaeoglobus, Halocarcula, Methanobacterium, Methanococcus, Methanosarcina, Methanopyrus, Pyrococcus, Picrophilus, Thermoplasma, Corynebacterium, Mycobacterium, Streptomyces, Aquifex, Porphyromonas, Chlorobium, Thermus, Bacillus, Listeria, Staphylococcus, Clostridium, Thermoanaerobacter, Mycoplasma, Fusobacterium, Azarcus, Chromobacterium, Neisseria, Nitrosomonas, Desulfovibrio, Geobacter, Myxococcus, Campylobacter, Wolinella, Acinetobacter, Erwinia, Escherichia, Legionella, Methylococcus, Pasteurella, Photobacterium, Salmonella, Xanthomonas, Yersinia, Treponema, and Thermotoga.
[0183] In some embodiments, the CRISPR enzyme is part of a fusion protein comprising one or more heterologous protein domains (e.g. about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more domains in addition to the CRISPR enzyme). A CRISPR enzyme fusion protein may comprise any additional protein sequence, and optionally a linker sequence between any two domains. Examples of protein domains that may be fused to a CRISPR enzyme include, without limitation, epitope tags, reporter gene sequences, and protein domains having one or more of the following activities: methylase activity, demethylase activity, transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, RNA cleavage activity and nucleic acid binding activity. Non-limiting examples of epitope tags include histidine (His) tags, V5 tags, FLAG tags, influenza hemagglutinin (HA) tags, Myc tags, VSV-G tags, and thioredoxin (Trx) tags. Examples of reporter genes include, but are not limited to, glutathione-S-transferase (GST), horseradish peroxidase (HRP), chloramphenicol acetyltransferase (CAT) beta-galactosidase, beta-glucuronidase, luciferase, green fluorescent protein (GFP), HcRed, DsRed, cyan fluorescent protein (CFP), yellow fluorescent protein (YFP), and autofluorescent proteins including blue fluorescent protein (BFP). A CRISPR enzyme may be fused to a gene sequence encoding a protein or a fragment of a protein that bind DNA molecules or bind other cellular molecules, including but not limited to maltose binding protein (MBP), S-tag, Lex A DNA binding domain (DBD) fusions, GAL4 DNA binding domain fusions, and herpes simplex virus (HSV) BP16 protein fusions. Additional domains that may form part of a fusion protein comprising a CRISPR enzyme are described in US20110059502, incorporated herein by reference. In some embodiments, a tagged CRISPR enzyme is used to identify the location of a target sequence.
[0184] In some embodiments, a CRISPR enzyme may form a component of an inducible system. The inducible nature of the system would allow for spatiotemporal control of gene editing or gene expression using a form of energy. The form of energy may include but is not limited to electromagnetic radiation, sound energy, chemical energy and thermal energy. Examples of inducible system include tetracycline inducible promoters (Tet-On or Tet-Off), small molecule two-hybrid transcription activations systems (FKBP, ABA, etc), or light inducible systems (Phytochrome, LOV domains, or cryptochrome). In one embodiment, the CRISPR enzyme may be a part of a Light Inducible Transcriptional Effector (LITE) to direct changes in transcriptional activity in a sequence-specific manner. The components of a light may include a CRISPR enzyme, a light-responsive cytochrome heterodimer (e.g. from Arabidopsis thaliana), and a transcriptional activation/repression domain. Further examples of inducible DNA binding proteins and methods for their use are provided in U.S. 61/736,465 and U.S. 61/721,283, which is hereby incorporated by reference in its entirety.
[0185] Embodiments of the present invention involve modulating leukocyte activity, as well as identifying genes associated with leukocyte responses and modeling of aberrant leukocyte activation and diseases associated with leukocytes. In general, the leukocyte(s) may be any subtype or population of leukocytes, e.g. dendritic cells, monocytes, macrophages, lymphocytes (e.g. T cells or B cells or Natural Killer cells), neutrophils, eosinophils, or basophils, or any combination or subgroup of the above. Precursors of mature leukocytes are also encompassed by the term leukocytes, e.g. hematopoietic stem and progenitor cells. Leukocyte subtypes may be identified by characteristic morphology and/or cell surface markers, as is well known in the art.
[0186] In some embodiments the leukocyte(s) may comprise a subtype of dendritic cells, monocytes, macrophages, lymphocytes (e.g. T cells or B cells or Natural Killer cells), neutrophils, eosinophils, or basophils, e.g. defined by one or more cell surface markers. In one embodiment, the leukocytes comprise bone marrow-derived dendritic cells (BMDCs). In other embodiments, the leukocytes may comprise helper, cytotoxic, memory and/or regulatory T cells, e.g. CD4+, CD8+, CD45RO+ and/or Foxp3+ T cells.
[0187] In embodiments of the present invention, various types of leukocyte response may be modeled or investigated, e.g. depending on the type of leukocyte or subtype thereof. For instance, in some embodiments the leukocyte response may comprise activation, inhibition, migration, exhaustion, adhesion, differentiation and/or proliferation.
[0188] In one preferred embodiment, the leukocytes are dendritic cells and the response comprises activation. For instance, dendritic cells may be activated by stimulation with bacterial lipopolysaccharide (LPS). In some embodiments dendritic cell activation may be measured by determining expression of one or more products or cell surface markers associated with dendritic cell activation, e.g. tumor necrosis factor alpha (TNF-) or CD86. Activation of dendritic cells may be suppressed by anti-inflammatory cytokines such as interleukin-10. Thus stimulation of dendritic cells with LPS in the presence of IL-10 allows the identification of mutations that overcome the suppression of dendritic cell activation by IL-10.
[0189] In another preferred embodiment, the leukocytes are T cells and the response comprises differentiation, for instance towards a Th1, Th2, Treg or Th17 phenotype, or maintenance of each phenotype. Differentiation of T cells towards particular phenotypes may be stimulated by specific cytokines. For instance, interleukin-12 (IL-12) may stimulate a Th1 response, whereas interleukin-4 (IL-4) may be used to stimulate a Th2 response. Stimulation with transforming growth factor beta (TGF) may induce differentiation towards a Treg response, whereas TGF in combination with interleukin-6 (IL-6) may induce a Th17 response. Differentiation towards particular responses may be measured by determining expression of particular markers characteristic of each response type. For instance, interferon- (IFN ) may be measured to indicate a Th1 response, IL-4 may be measured to indicate a Th2 response, TGF may be measured to indicate a T reg response and IL-17 may be measured to indicate a Th17 response.
[0190] In some embodiments, the T cells are from a transgenic mouse having cells that express Cas9 and an ovalbumin-specific -T cell receptor. Such transgenic mice may be obtained, for example, by crossing Cas9 transgenic mice as described above (e.g. having a Cas9 transgene knocked into the Rosa26 locus) with e.g. OT-II transgenic mice. OT-II transgenic mice express the mouse alpha-chain and beta-chain T cell receptor that pairs with the CD4 coreceptor and is specific for chicken ovalbumin 323-339 in the context of I-A b. In OT-II mice there is a four-fold increase in the CD4 to CD8 peripheral T cell ratio, and lymph node T cells demonstrate a dose-dependent proliferative response to the specific ovalbumin ligand. OT-II mice are described, for example, in Barnden et al. (1998) Defective TCR expression in transgenic mice constructed using cDNA-based alpha- and beta-chain genes under the control of heterologous regulatory elements, Immunol Cell Biol 76(1):34-40, incorporated by reference.
[0191] In embodiments of the present invention, a decreased response in a leukocyte is typically indicative that a gene mutated in the leukocyte by delivery of the vector is a positive regulator of the response. For instance, where delivery of the vector introduces one or more loss-of-function mutations into a gene that normally promotes the response, the response is expected to be decreased. Conversely an increased response in a leukocyte is typically indicative that a gene mutated in the leukocyte by delivery of the vector is a negative regulator of the response, i.e. delivery of the vector introduces one or more loss-of-function mutations into a gene expression that normally suppresses the response.
[0192] Embodiments of the present invention may involve modeling of any of the above responses, and in particular aberrant leukocyte responses. By aberrant leukocyte responses it is typically meant a leukocyte response that is deficient or excessive, for instance deficient or excess activation, differentiation or proliferation. In particular, where a gene has been identified as being associated with a leukocyte response by the method described above, leukocytes in which that gene is inactivated may be used to model such aberrant responses. For instance, where a gene expressed in dendritic cells is identified as a positive regulator of dendritic cell activation, dendritic cells in which the gene contains one or more loss-of-function mutations may be used as a model of deficient dendritic cell activation. Such a model may be used to identify agents which promote dendritic cell activation, e.g. for use in immunotherapy for cancer.
[0193] Further embodiments of the invention may involve modeling diseases associated with leukocytes. By diseases associated with leukocytes it is typically meant any disorder or condition in which leukocytes or a subtype thereof influence the disease pathology, especially conditions where deficient or excessive leukocyte responses are associated with the disease. Leukocyte-associated diseases include, e.g. immune system disorders and cancer. For instance, the disease may be an autoimmune disease, a chronic persistent infection, leukemia, leukopenia or transplant rejection.
[0194] Autoimmune diseases involve the generation of an immunogenic response against one or more self tissues or cells. Examples of autoimmune diseases include rheumatoid arthritis, multiple sclerosis, lupus erythematosis, myasthenia gravis, scleroderma, Crohn's disease, ulcerative colitis, Hashimoto's disease, Graves' disease, Sjogren's syndrome, Addison's disease, insulin-dependent diabetes mellitus (IDDM), inflammatory bowel disease and thyroiditis.
[0195] Infections may be considered to be chronic and persistent if, for example, the infection persists for at least 3 months, more preferably at least 6 months. Examples of chronic persistent infections include tuberculosis, the hepatitis B, hepatitis C or HIV.
[0196] Transplant rejection may be either chronic or acute, including rejection of allogeneic or xenogeneic transplants. The disease may also be graft-versus-host disease, i.e. in which leukocytes from a donor attack cells of a transplant recipient.
[0197] Cancer may be defined as a condition involving uncontrolled cell growth. Examples of cancers breast cancer, prostate cancer, colon cancer, lung cancer, ovarian cancer, cervical cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, liver cancer, bladder cancer, hepatoma, kidney cancer, thyroid cancer, skin cancer, melanoma, brain cancer, neuroblastoma, myeloma, include carcinoma, lymphoma and leukemia.
[0198] The models of the present invention may be used to model the aberrant leukocyte responses occurring in such diseases. For instance, excessive leukocyte responses may underlie the pathology in conditions such as autoimmune diseases and transplant rejection. Targeting a negative regulator of leukocyte responses (e.g. the mouse A20 locus in dendritic cells, see Example 2) may serve as a model for such excessive leukocyte responses. In contrast, the suppression of immune responses against tumor antigens is important in the pathogenesis of many types of cancer. Targeting a positive regulator of leukocyte responses (e.g. the mouse MyD88 locus in dendritic cells, see Example 2) may be used to model deficient leukocyte responses in conditions such as cancer.
[0199] In some embodiments, the method of the present invention involves delivering a plurality of different vectors, each expressing different guide RNAs, to a plurality of leukocytes. In this way, a plurality of different genes expressed in the leukocytes may be targeted, in order to screen for genes involved in leukocyte responses. Preferably the method may involve delivering at least 100, at least 1000 or at least 10,000 vectors, wherein each vector expresses one or more guide RNAs. For instance, at least 100, at least 1000, at least 10,000 or at least 100,000 guide RNAs may be expressed in the method.
[0200] In one embodiment the method involves a genome-wide screen, e.g. in which all genes in the genome of the leukocytes are targeted. For instance, in one embodiment a library of vectors is delivered to the leukocytes, each vector in the library expressing one or more RNAs targeted to a gene in a genome of the leukocytes, and wherein the library comprises at least one vector expressing an RNA targeted to each gene in the genome of the leukocytes. Preferably the library comprises more than one RNA targeted to each gene in the genome, e.g. the library comprises two, three, four, five or six or more RNAs targeted to each gene in the genome. In these embodiments, the library may comprise, for example, at least 10,000, at least 50,000 or at least 100,000 guide RNAs. In one embodiment the library comprises a genome-wide lentiviral sgRNA library as described in Sanjana et al. (2014), Improved vectors and genome-wide libraries for CRISPR screening, Nature Methods 11, 783-784, incorporated herein by reference.
[0201] The practice of the present invention employs, unless otherwise indicated, conventional techniques of immunology, biochemistry, chemistry, molecular biology, microbiology, cell biology, genomics and recombinant DNA, which are within the skill of the art. See Sambrook, Fritsch and Maniatis, MOLECULAR CLONING: A LABORATORY MANUAL, 2nd edition (1989); CURRENT PROTOCOLS IN MOLECULAR BIOLOGY (F. M. Ausubel, et al. eds., (1987)); the series METHODS IN ENZYMOLOGY (Academic Press, Inc.): PCR 2: A PRACTICAL APPROACH (M. J. MacPherson, B. D. Hames and G. R. Taylor eds. (1995)), Harlow and Lane, eds. (1988) ANTIBODIES, A LABORATORY MANUAL, and ANIMAL CELL CULTURE (R. I. Freshney, ed. (1987)).
[0202] The practice of the present invention employs, unless otherwise indicated, conventional techniques for generation of genetically modified mice. See Marten H. Hofker and Jan van Deursen, TRANSGENIC MOUSE METHODS AND PROTOCOLS, 2nd edition (2011).
EXAMPLES
[0203] The following examples are given for the purpose of illustrating various embodiments of the invention and are not meant to limit the present invention in any fashion. The present examples, along with the methods described herein are presently representative of preferred embodiments, are exemplary, and are not intended as limitations on the scope of the invention. Changes therein and other uses which are encompassed within the spirit of the invention as defined by the scope of the claims will occur to those skilled in the art.
Example 1: Cas9 Transgenic and Knock in Mice
[0204] Reference is made to WO 2014/093622 (PCT/US13/74667), incorporated herein by reference. To generate a mouse that expresses the Cas9 nuclease Applicants submit two general strategies, transgenic and knock in. These strategies may be applied to generate any other model organism of interest, for e.g. Rat. For each of the general strategies Applicants made a constitutively active Cas9 and a Cas9 that is conditionally expressed (Cre recombinase dependent). The constitutively active Cas9 nuclease is expressed in the following context: pCAG-NLS-Cas9-NLS-P2A-EGFP-WPRE-bGHpolyA. pCAG is the promoter, NLS is a nuclear localization signal, P2A is the peptide cleavage sequence, EGFP is enhanced green fluorescent protein, WPRE is the woodchuck hepatitis virus posttranscriptional regulatory element, and bGHpolyA is the bovine growth hormone poly-A signal sequence. The conditional version has one additional stop cassette element, loxP-SV40 polyAx3-loxP, after the promoter and before NLS-Cas9-NLS (i.e. pCAG-loxP-SV40polyAx3-loxP-NLS-Cas9-NLS-P2A-EGFP-WPRE-bGHpolyA). The constitutive construct should be expressed in all cell types throughout development, whereas, the conditional construct will only allow Cas9 expression when the same cell is expressing the Cre recombinase. This latter version will allow for tissue specific expression of Cas9 when Cre is under the expression of a tissue specific promoter. Moreover, Cas9 expression could be induced in adult mice by putting Cre under the expression of an inducible promoter such as the TET on or off system.
[0205] Validation of Cas9 constructs: Each plasmid was functionally validated in three ways: 1) transient transfection in 293 cells followed by confirmation of GFP expression; 2) transient transfection in 293 cells followed by immunofluorescence using an antibody recognizing the P2A sequence; and 3) transient transfection followed by Surveyor nuclease assay. The 293 cells may be 293FT or 293 T cells depending on the cells that are of interest. In a preferred embodiment the cells are 293FT cells. The results of the Surveyor were run out on the top and bottom row of the gel for the conditional and constitutive constructs, respectively. Each was tested in the presence and absence of chimeric RNA targeted to the hEMX1 locus (chimeric RNA hEMX1.1). The results indicate that the construct can successfully target the hEMX1 locus only in the presence of chimeric RNA (and Cre in the conditional case). The gel was quantified and the results are presented as average cutting efficiency and standard deviation for three samples.
[0206] Transgenic Cas9 mouse: To generate transgenic mice with constructs, Applicants inject pure, linear DNA into the pronucleus of a zygote from a pseudo pregnant CB56 female. Founders are identified, genotyped, and backcrossed to CB57 mice. The constructs were successfully cloned and verified by Sanger sequencing.
[0207] Knock in Cas9 mouse: To generate Cas9 knock in mice Applicants target the same constitutive and conditional constructs to the Rosa26 locus. Applicants did this by cloning each into a Rosa26 targeting vector with the following elements: Rosa26 short homology armconstitutive/conditional Cas9 expression cassettepPGK-Neo-Rosa26 long homology armpPGK-DTA. pPGK is the promoter for the positive selection marker Neo, which confers resistance to neomycin, a 1 kb short arm, a 4.3 kb long arm, and a negative selection diphtheria toxin (DTA) driven by PGK.
[0208] The two constructs were electroporated into R1 mESCs and allowed to grow for 2 days before neomycin selection was applied. Individual colonies that had survived by days 5-7 were picked and grown in individual wells. 5-7 days later the colonies were harvested, half were frozen and the other half were used for genotyping. Genotyping was done by genomic PCR, where one primer annealed within the donor plasmid (AttpF) and the other outside of the short homology arm (Rosa26-R) Of the 22 colonies harvested for the conditional case, 7 were positive (Left). Of the 27 colonies harvested for the constitutive case, zero were positive (Right). It is likely that Cas9 causes some level of toxicity in the mESC and for this reason there were no positive clones. To test this Applicants introduced a Cre expression plasmid into correctly targeted conditional Cas9 cells and found very low toxicity after many days in culture. The reduced copy number of Cas9 in correctly targeted conditional Cas9 cells (1-2 copies per cell) is enough to allow stable expression and relatively no cytotoxicity. Moreover, this data indicates that the Cas9 copy number determines toxicity. After electroporation each cell should get several copies of Cas9 and this is likely why no positive colonies were found in the case of the constitutive Cas9 construct. This provides strong evidence that utilizing a conditional, Cre-dependent strategy should show reduced toxicity. Applicants inject correctly targeted cells into a blastocyst and implant into a female mouse. Chimerics are identified and backcrossed. Founders are identified and genotyped.
[0209] Utility of the conditional Cas9 mouse: Applicants have shown in 293 cells that the Cas9 conditional expression construct can be activated by co-expression with Cre. Applicants also show that the correctly targeted R1 mESCs can have active Cas9 when Cre is expressed. Because Cas9 is followed by the P2A peptide cleavage sequence and then EGFP Applicants identify successful expression by observing EGFP. This same concept is what makes the conditional Cas9 mouse so useful. Applicants may cross their conditional Cas9 mouse with a mouse that ubiquitously expresses Cre (ACTB-Cre line) and may arrive at a mouse that expresses Cas9 in every cell. It should only take the delivery of chimeric RNA to induce genome editing in embryonic or adult mice. Interestingly, if the conditional Cas9 mouse is crossed with a mouse expressing Cre under a tissue specific promoter, there should only be Cas9 in the tissues that also express Cre. This approach may be used to edit the genome in only precise tissues by delivering chimeric RNA to the same tissue.
Example 2: Ex Vivo Genome Editing in Primary Dendritic Cells by Lentiviral-Mediated sgRNA Expression
[0210] To determine whether the Rosa26 knock-in construct provided functional levels of Cas9 expression, Applicants set out to test whether a previously described U6-sgRNA lentiviral vector (Sanjana et al., 2014) could mediate indel formation ex vivo in primary immune cells. Several types of immune cells, such as innate immune dendritic cells (DCs), are often not accessible for genetic manipulation due to delivery challenges, short viability terms in culture, or both. Moreover, since existing cell lines do not mimic DC biology well, many studies are performed with primary cells derived ex vivo from precursors isolated from the bone marrow (BMDCs) (
Methods
Mouse Dendritic Cells
[0211] 6-8 week old constitutive Cas9-expressing female mice were used for all DC experiments. Bone marrow cells were collected from femora and tibiae and plated at concentration of 210.sup.5/ml on non-treated tissue culture dishes in RPMI medium (Gibco, Carlsbad, Calif., Invitrogen, Carlsbad, Calif.), supplemented with 10% FBS (Invitrogen), L-glutamine (Cellgro), penicillin/streptomycin (Cellgro), MEM non-essential amino acids (Cellgro), HEPES (Cellgro), sodium pyruvate (Cellgro), -mercaptoethanol (Gibco), and GM-CSF (20 ng/mL; Peprotech). SgRNAs targeting Myd88 and A20 were cloned into a guide-only lentiviral vector (Sanjana et al., 2014). At day 2, cells were infected with lentiviruses encoding guide RNAs. Cells were expanded in the presence of GM-CSF. At day 7, infected cells were selected by adding puromycin (Invitrogen) at 5 g/mL. At day 9, 100 ng/ml LPS (Invivogen) was added 30 min prior to protein analysis or 3 hours prior to mRNA expression profiling. Flow cytometry for GFP detection was performed with BD Accuri C6. Western blot was done using anti-Myd88 (R&D Systems AF3109) and anti-actin (Abcam, ab6276) antibodies.
Nanostring nCounter Expression Measurement
[0212] DCs were processed and analyzed as previously described (Amit et al., 2009). Briefly, 510.sup.4 cells were lysed in TCL buffer (Qiagen) supplemented with -mercaptoethanol. 5% of the lysate was hybridized for 16 hours with a previously described Nanostring Gene Expression CodeSet (Geiss et al., 2008) and loaded into the nCounter Prep Station followed by quantification using the nCounter Digital Analyzer. Counts were normalized using control genes as previously described (Amit et al., 2009) and fold changes were calculated relative to cells transduced with sgRNA targeting GFP and non-targeted controls. Heat maps were created using GENE-E (http://www.broadinstitute.org/cancer/software/GENE-E/).
Results
[0213] Applicants first verified the expression of Cas9 in bone marrow from constitutive Cas9-expressing mice (
[0214] DCs specialize in pathogen detection and initiation of appropriate immune responses (Mellman and Steinman, 2001). Therefore, Applicants measured the expression of 276 representative genes of the LPS response, using the Nanostring nCounter, in cells targeted for Myd88 or A20 as compared to controls (
Example 3: Genome-Wide CRISPR Screens in Primary Mouse Dendritic Cells
[0215] In this example, Applicants establish a genome wide screen for positive and negative regulators of the LPS response in primary mouse dendritic cells (DCs). Bone marrow cells from Cas-9 expressing transgenic mice are infected with a library of lenti-virus that contains six guide RNAs for each mouse gene (including miRNAs), plus negative control guides that do not target any sequence in the mouse genome. A mixture of mouse primary cells is created and grown in condition that promote differentiation towards DCs. In this cell mixture each cell contains on average one mutation in one of the targeted genes. The next stage is to stimulate DCs with LPS (a bacterial component) and then isolate cells that fail to respond (indication of a mutation in a positive regulator of the LPS response) or that have a stronger than normal response (indication of a mutation in a negative regulator of the response). The stimulation step is performed in the presence or absence of IL-10. The readout for DC activation upon LPS is based on staining for the anti-inflammatory cytokine TNF- or the cell surface receptor CD-86. The last stage is to identify the guide RNAs present at higher levels in cells that show the desired phenotype (especially high or especially low expression of the readout marker CD-86 or TNF-), and verify the results. The method is shown schematically in
[0216] Three screens were done as presented in
[0217] In three repeats on the screen (using 200 million cells in each repeat) Applicants reproducibly found many of the known regulators of the LPS response including Tlr4, Myd88, CD14, Ticam1, Ticam2 and many new potential regulators to be verified individually. The large scale screen has high potential to find new regulators of the LPS response in BMDCs and therefore new targets for drug therapy.
Example 4: Genome-Wide CRISPR Screens in T Cells
[0218] In this example, Applicants establish a genome wide screen for positive and negative regulators of CD4+ T cell differentiation. OT-II mice (which express the mouse alpha-chain and beta-chain T cell receptor that pairs with the CD4 coreceptor and is specific for chicken ovalbumin 323-339 in the context of I-A b, see Barnden et al. (1998), Immunol Cell Biol 76(1):34-40) are crossed with Cas9 transgenic mice to generate a transgenic mouse having cells that express Cas9 and an ovalbumin-specific -T cell receptor. T cells from the progeny of such mice are are infected with a library of lenti-virus that contains six guide RNAs for each mouse gene (including miRNAs), plus negative control guides. Guide libraries are used to knock out genes involved in T cell differentiation to 4 subsets: Th1, Th2, Th17 and Treg. For each subset, T cells are sorted for high or low differentiation signal and the guides in those cells are sequenced to find positive and negative regulators of differenciation. The method is shown schematically in
Example 5: A System for Cell-Autonomous, Pooled Genetic Screens in BMDCs Derived from Cas9-Expressing Mice
[0219] Applicants describe efficient knockout of genes when using the CRISPR system in primary bone marrow derived dendritic cells (BMDCs) isolated from Cas9-expressing mice (Platt et al., 2014). Given the efficacy of this approach compared to RNAi, Applicants reasoned that it should be possible to conduct improved genome-wide genetic screens in primary cells, with significant increases in on-target efficacy and reduction in off-target effects compared to RNAi screens (Shalem et al., 2014).
[0220] To enable genome-wide pooled genetic screens, Applicants developed a cell autonomous readout of innate immune activation by intracellular staining of a central inflammatory cytokine, Tnf. To test the assay, Applicants individually transduced BMDCs with lentiviruses expressing short guide RNAs (sgRNAs) that target each of three genes: (1) Tlr4, the cell membrane receptor that senses bacterial LPS; (2) Myd88, a key component required for Tlr4 signaling to induce Tnf; and (3) Zfp36 (TTP), an RNA binding protein that destabilizes Tnf mRNA (Carballo et al., 1998; Rabani et al., 2014). Applicants isolated bone marrow cells from transgenic mice that constitutively express spCAS-9, transduced cells with lentiviruses targeting these 3 control genes, and differentiated DCs for an additional seven days using GM-CSF (Experimental Procedures) (Platt et al., 2014). Applicants then activated BMDCs with LPS, in the presence of Brefeldin to block Tnf secretion, and at 8 hours post-activation detected Tnf with a fluorescent antibody using flow cytometry. Compared to a non-targeting sgRNA control, sgRNAs targeting Myd88 or Tlr4 strongly reduced Tnf, whereas sgRNAs targeting Zfp36 increased Tnf (
Example 6: A Genome-Wide Pooled sgRNA Library Screen in Primary BMDCs
[0221] Applicants performed three independent, pooled genome-wide screens using a library of lentiviruses harboring 125,793 sgRNAs targeting 21,501 protein-coding and miRNA genes annotated in the mouse genome (Sanjana et al., 2014), as well as 1,000 non-targeting sgRNA as negative controls (
A Computational Strategy to Identify Enriched or Depleted sgRNAs
[0222] To perform such comparisons, Applicants determined the relative enrichment of sgRNAs across the 4 sources (Tnf.sup.hi, Tnf.sup.lo, pre-LPS and Input). First, Applicants considered technical sources of noise. Given that each Tnf bin consists of 5 million cells, it is likely that some of the 120,000 sgRNAs are undersampled by chance. Indeed, while matched bins are fairly well correlated between replicates (Pearson r=0.45-0.54,
[0223] The top ranked genes substantially overlap between the two approaches (50/100 for positive regulators, 30/100 for negative regulators, P<10.sup.10, Hypergeometric test), and their rankings are well correlated (Spearman p=0.67 for positive regulators, 0.44 for negative regulators;
[0224] The screen correctly identifies known regulators of cell viability, differentiation, Tnf expression and Tlr4 signaling.
[0225] To assess the initial quality of the screen and scoring scheme, Applicants first determined that, as expected, sgRNAs against genes required for essential cell processes were depleted in pre-LPS samples compared to Input (
TABLE-US-00002 TABLE S1 Ranked genes based on the enrichment in day 9 compare to the plasmid library Vmn1r95 Hist1h2br Tbc1d10b Mup9 Gm14501 mmu-mir-3473c Rps13 Pcdhac2 Gm10377 Basp1 Rps2 Slc44a3 BC018507 Mdm2 Cflar Nxf1 Rps7 Zscan4f Gm21119 Hist1h4n Gab2 Lce3f Psmc5 Mblac1 Rpl7 Arcn1 Rbm25 Uba1 Rps17 Psma4 Npy Hmgb1 Rps8 Pnrc1 Gm8764 Hist3h2a Supt6 Thoc2 Usp5 H2-L Zfp781 Vmn2r49 Fxyd6 Hist1h3i
[0226] Next, a comparison of sgRNAs between Tnfhi and Tnflo was also consistent with the predictions, with sgRNAs targeting known positive regulators of the response (e.g., Tlr4 and Myd88) enriched in Tnflo compared to Tnfhi, and those targeting negative regulators (e.g., Zfp36) depleted in Tnflo (ZS analysis:
TABLE-US-00003 TABLE S2 Positive regulator Negative regulators Tnf Zfp36 Ly96 Atxn7l3 Cd14 Rc3h1 Myd88 Yy1 Ticam2 Dnttip1 Dad1 Rara Ddost Dusp1 Ticam1 Eif5 Tirap Stat5b Tlr4 Atp10b Rela Olfr1497 Ctcf Rfwd2 Traf6 Polq Rpn1 Nlrp4e Rbx1 Cypt3 Pabpc1 Ppp2r1a Srp54c B4galt5 Xab2 Pla2g7 Rbck1 Comtd1 Tmem258 Cxcl1 Cebpb Gja8 Ikzf1 Crygs Ikbkb Olfr1253 Ddx39b Becn1 Ctr9 Strap Olfr187 Klhdc7a Paf1 Lcp2 Gtf2b Hspa5 Polr2g Ncor2 Midn Mycbp2 Tipin Mmp14 Leo1 Pdcd10 Rpl10 Pak6 Actb Caprin2 Rpl35 Eif2s1 Mapkapk2 Kidins220 Sgms1 Hmg20a Gabpb1 Gpt Akirin2 Nf1
TABLE-US-00004 TABLE S4 Rank Rank according according Rank mean to positive to negative according Z score DE score geneID expression regulator z score z score to DE secondary secondary Crygs 0 neg 22 1172 993 1677 Cypt3 0 neg 15 71 1913 2409 Klhdc7a 0 neg 26 44 2763 2558 Lce3a 0 neg 939 82 797 1114 Prol1 0 pos 421 75 1577 1574 Sox2 0 neg 534 90 2600 1714 Steap4 0.0114586 pos 60 651 843 1472 Fam155a 0.0278761 pos 54 1301 1744 1049 Scube3 0.0289997 pos 674 39 1418 1953 Kcnc1 0.0455174 neg 3846 97 1624 2168 Cyp2c40 0.0555593 neg 1345 25 1804 918 Rimbp3 0.0566486 neg 56 85 1221 445 4921511H03Rik 0.0739165 pos 48 156 811 1213 Chrm1 0.0870416 neg 565 65 1610 2304 Dmrta1 0.1088845 neg 981 66 1459 2108 Olfr187 0.1175577 pos 26 133 2789 1779 4932429P05Rik 0.1307935 pos 45 1130 2142 1420 Gja8 0.1370485 neg 21 982 2244 2435 Vmn1r212 0.1538853 pos 80 215 120 116 Cd7 0.1566941 neg 168 38 648 860 Atp10b 0.1753225 neg 10 1877 1218 538 Csta 0.1948054 pos 279 58 Pak6 0.198052 neg 33 3141 Caprin2 0.2385725 neg 34 17 2783 1887 Vmn2r2 0.2662511 pos 91 1489 2245 2593 Vmn1r71 0.3612206 pos 79 175 2180 1248 Olfr1253 0.3729281 neg 23 619 2313 2359 Nlrp4e 0.3933181 neg 14 190 1798 1965 Olfrl497 0.4414086 neg 11 458 2518 1787 Bex1 0.4946157 pos 97 994 1343 473 Polq 0.5050873 neg 13 15 2071 1218 Kctd1 0.5727475 neg 194 80 1660 1730 Amotl1 0.6152932 neg 40 35 1130 405 Prrg4 0.6311149 neg 103 91 1317 835 D3Bwg0562e 0.6727203 pos 81 96 937 1070 Lrrc17 0.7831777 pos 71 520 2373 2505 Hist1h2bh 0.952299 pos 1205 79 107 161 Arap2 1.0569792 pos 72 315 590 828 Suz12 1.2113286 neg 171 55 716 912 Invs 1.2868174 neg 1732 88 2166 2686 Gtf2ird1 1.2930437 neg 159 53 1002 1024 Atxn7l3 1.599496 neg 2 13 25 40 Lims2 1.6820134 neg 188 78 1980 2140 Dnttip1 1.6829178 neg 5 24 93 121 Rfwd2 1.8615258 neg 12 37 33 49 Pcf11 1.9287589 pos 68 511 1995 1959 Enox2 2.0973271 pos 102 40 2346 1776 Fdxacb1 2.1791234 pos 921 93 1812 2167 Rtf1 2.2229473 pos 57 63 1853 822 N4bp2l2 2.293882 pos 61 47 1387 1276 Ctcf 2.4944746 pos 12 10 14 13 Limk1 2.5045586 pos 64 333 927 1231 Rbm27 2.6238947 pos 65 216 1135 744 Yy1 2.624785 neg 4 36 32 45 Nipbl 2.7207485 pos 163 30 63 72 Ndor1 2.7604428 pos 265 57 2737 2459 Ncor2 2.794435 neg 29 265 1622 1081 Akirin2 2.8015294 pos 39 74 55 59 Fgd6 2.846561 pos 44 3528 Traf3 2.8761111 pos 89 2218 130 112 Tti2 2.8802275 pos 47 247 2614 1937 2610301B20Rik 2.8823901 pos 77 2999 Hmgn5 2.9097861 pos 92 690 1959 1525 Mycbp2 3.0889873 neg 30 72 95 107 Prps1l3 3.0940418 neg 101 50 636 924 B4galt5 3.1184623 neg 17 415 1026 2280 Ddx10 3.2385877 pos 40 536 2618 1449 Cul3 3.2608225 pos 46 22 108 82 C230052l12Rik 3.270432 neg 123 18 783 1610 Ankrd10 3.3380866 pos 342 94 2114 2122 Ctr9 3.3595824 pos 25 917 47 35 Rara 3.428654 neg 6 32 129 111 Mamld1 3.4559478 neg 136 59 302 272 Orc6 3.472132 pos 49 405 176 233 Eny2 3.4925085 neg 52 41 975 1074 Midn 3.5320036 pos 30 525 19 21 Tirap 3.6314516 pos 9 16 6 6 Ikbkg 3.634915 pos 84 168 314 185 Tubgcp3 3.6735153 neg 155 46 313 508 Leo1 3.6903327 pos 32 275 70 63 Snip1 3.6937478 pos 99 1501 1431 1007 Rc3h1 3.7525108 neg 3 23 24 38 Alg2 3.8175829 pos 269 87 91 67 Stat5b 3.8915391 neg 9 48 41 60 Ticam1 3.9907575 pos 8 4 12 12 Gabpb1 4.0809531 pos 38 69 173 131 Tipin 4.1237736 pos 31 590 1150 2059 Ube3a 4.1248275 pos 93 563 719 1285 Ash2l 4.3523026 pos 41 81 74 55 Gpkow 4.4343094 pos 53 1440 236 157 Rnf31 4.4432453 pos 42 61 90 65 Comtd1 4.4834476 neg 19 42 428 502 Traf6 4.5088665 pos 13 64 31 41 Ly96 4.5530913 pos 2 2 1 3 Wasf2 4.5534458 pos 85 488 203 325 Zfp36 4.5864576 neg 1 6 9 10 BC023829 4.5949364 pos 58 98 676 883 Ikzf1 4.6416247 pos 22 51 97 78 Ticam2 4.6788326 pos 5 3 7 7 Xab2 4.7360399 pos 18 825 1923 886 Traf2 4.8029788 pos 96 1171 193 190 Map3k8 4.8837956 pos 52 492 20 22 Traf5 4.8850542 neg 192 49 738 1332 Mapkapk2 4.944774 pos 36 2075 36 27 Sgms1 4.9819627 pos 37 105 11 11 Paf1 5.0227227 pos 27 29 40 34 Prpf40a 5.0238077 pos 50 1076 475 1088 Fam50a 5.0268849 neg 71 27 77 98 Ruvbl2 5.1008998 pos 83 1255 384 725 Dr1 5.1128304 pos 90 1150 137 100 Ikbkb 5.189822 pos 23 638 46 43 Vps41 5.2563794 pos 78 1527 163 99 Gtf2h1 5.2863726 pos 75 3245 Dusp1 5.5754287 neg 7 286 94 95 Fam96b 5.5833555 pos 69 1151 1637 1724 Pitpnb 5.5942627 neg 308 43 507 271 Irf9 5.7146257 neg 95 28 1141 832 Dhx15 5.7329351 pos 70 163 56 53 Wdr61 5.7932784 pos 51 34 54 48 Nans 5.8843053 neg 5678 56 1432 596 Strap 5.9195968 neg 25 479 115 148 Pdcd10 5.957733 neg 32 2484 79 87 Polr2j 5.9933101 pos 192 45 409 236 0610009D07Rik 6.0487871 pos 87 339 Tlr4 6.0828205 pos 10 8 3 2 Srpr 6.1576415 pos 55 1283 18 17 Rbck1 6.1623505 pos 19 92 38 37 Eif5 6.1717398 neg 8 106 269 200 Becn1 6.1995961 neg 24 107 1774 2714 Srp54c 6.2094334 pos 17 19 145 120 Polr2g 6.2287455 pos 29 33 1331 2099 Cebpb 6.230226 pos 21 183 37 29 Eif2s1 6.2619052 neg 35 86 178 332 Cd69 6.2908584 pos 100 140 921 1816 Rela 6.3060629 pos 11 70 29 26 Brd2 6.3398195 pos 67 988 22 19 Rpl26 6.3680742 pos 62 678 870 2486 Rbx1 6.3778141 pos 15 130 35 50 Gtf2b 6.4532102 pos 28 77 111 94 Rbms1 6.7376793 pos 82 248 188 141 Fkbp8 6.8721672 pos 74 60 1241 1701 Napa 6.9841007 pos 43 259 243 321 Lcp2 6.9993322 neg 27 408 1225 2241 Ddx39b 7.1022769 pos 24 84 102 91 Mmp14 7.1973532 neg 31 238 2337 1869 Rpn1 7.244059 pos 14 12 45 42 Myd88 7.293524 pos 4 7 5 5 Sec13 7.3392971 pos 86 241 1094 1837 Rap1b 7.3583281 neg 80 67 2400 2764 Copz1 7.4459878 pos 59 52 312 575 Pabpc1 7.5733642 pos 16 11 26 25 Tmem258 7.7332655 pos 20 20 59 56 Rpn2 7.7429485 pos 73 21 16 15 Ppp2r1a 7.8447585 neg 16 89 60 73 Ddost 7.8512283 pos 7 9 27 20 Pla2g7 7.851729 neg 18 31 2744 2441 Psma1 7.9129454 pos 98 491 350 419 Dad1 7.951084 pos 6 14 21 23 Cyc1 8.0641757 pos 76 836 254 577 Cxcl1 8.0704161 neg 20 119 1366 1272 Hsp90b1 8.3326208 pos 63 371 8 8 Hspa5 9.1655412 neg 28 199 1894 1462 Cd14 9.2997102 pos 3 5 2 1 Tnf 9.5646516 pos 1 1 4 4 Rpl23a 10.030421 pos 56 116 401 709 Rpl35 10.140576 pos 35 984 656 1258 Bcl2a1d 10.233762 pos 66 54 385 138 Rpl10 10.551308 pos 33 62 1217 2240 Actb 12.886427 pos 34 26 157 124
TABLE-US-00005 TABLE S5 Gene T0 T2 T4 T6 2610301B20Rik 3.59876844 3.25468716 2.14134 2.84581507 Akirin2 1.6192359 2.86345589 3.36476434 3.03855652 Ankrd10 4.27960239 3.43453893 2.79383714 3.1409302 Bcl2a1d 9.20384008 10.2458505 10.4774568 10.7170906 Cd14 7.08060949 9.31056935 9.6927011 10.4840348 Cd69 2.69085118 5.55296277 7.71699892 7.96321992 Cebpb 2.33457117 5.28970561 7.34979222 8.56507076 Comtd1 5.12234817 4.75737235 4.37097649 3.94390077 Cxcl1 1.69661341 10.3080308 10.018053 9.07719912 Dusp1 4.39095914 6.34739988 5.45492375 5.9905752 Fam50a 5.46711418 5.28607528 5.10204733 4.4521369 Hist1h2bh 2.20278126 0 0.6972268 0.99438314 Hspa5 8.13358536 8.48434499 9.0473677 10.5073946 Ikzf1 3.83148641 4.59111207 4.95848369 4.93951629 Lcp2 6.20277561 7.02550143 7.31363177 7.23530939 Mamld1 2.5721264 3.08617137 4.0226817 3.78464096 Map3k8 3.87949528 5.30199185 5.28981525 4.89642164 Mapkapk2 3.94479949 4.82187436 5.37761792 5.3139832 Mmp14 5.11800801 6.85111462 7.86396703 8.26329919 Orc6 4.13341473 3.88486879 3.41557055 2.76153649 Polr2j 6.56600865 6.09343076 5.95384903 5.55218587 Rap1b 6.01668665 6.8397286 7.86032221 8.18507744 Rara 4.59846846 3.4938824 3.26283613 2.71229852 Rc3h1 2.87911131 3.89289845 4.3435479 3.68505367 Rela 5.48314301 6.42518513 6.56259762 6.55224096 Rfwd2 1.3978399 1.51327281 1.80142272 2.50158524 Rnf31 3.82081029 3.83809782 4.76436352 4.99897175 Rpl26 6.0476079 5.74366969 7.26668418 6.14437196 Ruvbl2 5.67150918 5.51888681 4.8716344 4.62402482 Sgms1 4.66284182 5.72875332 4.90355104 4.75489607 Tipin 4.75098412 4.93786879 3.98640209 3.23164093 Tnf 5.48222936 11.1409658 10.9011026 10.0182778 Traf3 1.81688289 3.29774043 3.02805346 3.17959655 Traf5 3.74527722 4.92651491 5.32673695 5.22788295 Yy1 1.99748107 2.0793673 2.82227287 3.2649555
[0227] Strikingly, the top-10 ranking positive regulator genes (ZS analysis) are almost exclusively populated by the hallmark members of TLR signaling, with many others among the top-100, showing that an unbiased, genome-wide screen can decipher near-complete pathways (
Dozens of Positive Regulators Identified by the Screen Validated Using Individually-Cloned sgRNAs
While the top-ranking genes are highly enriched for known regulators, they also include genes that were not previously associated with either Tlr4 signaling, the LPS response, or regulation of Tnf. For example, within the top-10 ranking genes, eight are bone-fide members of the Tlr4 signaling pathway, whereas the other two genes are subunits of the oligosaccharyltransferase complex (OSTc), a complex responsible for protein glycosylation (discussed below). Some of these highly ranked genes could be novel regulators, but others may be false positives.
[0228] To distinguish these possibilities and empirically determine the true positive rate in the top hits, Applicants next individually tested the top-100 putative positive regulators and top 35 putative negative regulators based on the Z score ranking, and the 98 top putative regulators (52 positive and 46 negative) based on the differential abundance analysis (57 genes overlap between the two sets). In this strategy Applicants took all positive regulators within a relatively permissive FDR in the initial screen (112 top positive regulators, an estimated FDR of 50%), but extensively test each of those genes, to find as many validated regulators as possible within the limits of scale for testing. In total, Applicants tested 176 hit genes (112 putative positive regulators; 64 putative negative regulators, the latter not considered in the FDR above) with individual, rather than pooled, targeting of each gene with each of 2-3 independent sgRNAs, to a total of 400 individual targeting sgRNA assays (245 and 155 sgRNAs for positive and negative regulators, respectively), and 53 non-targeting controls. Applicants tested the effect of each of the 453 sgRNA by measuring intracellular Tnf levels by flow cytometry (
[0229] Approximately half of the sgRNAs that target putative positive regulator genes (111 sgRNAs, 45%,
TABLE-US-00006 TABLE S6 true positive true positive genes based on genes based more than one all positive guides tested genes tested true positive guides on one guide guide 0610009D07Rik%%MGLibA_00009 0610009D07Rik 0610009D07Rik%%MGLibA_00009 Fdxacb1 0610009D07Rik 0610009D07Rik%%MGLibB_00008 2610301B20Rik 0610009D07Rik%%MGLibB_00008 Lrrc17 Akirin2 2610301B20Rik%%MGLibA_00936 4921511H03Rik Akirin2%%MGLibA_03653 Mapkapk2 Alg2 2610301B20Rik%%MGLibB_00936 4932429P05Rik Akirin2%%MGLibB_03652 mmu-mir- Ash2l 106a 4921511H03Rik%%MGLibB_01150 Actb Alg2%%MGLibA_03837 mmu-mir- Cd14 466c-2 4921511H03Rik%%MGLibB_01151 Akirin2 Alg2%%MGLibB_03837 Ruvbl2 Cebpb 4932429P05Rik%%MGLibA_01501 Alg2 Ash2I%%MGLibA_05467 Srp54c Ctcf 4932429P05Rik%%MGLibA_01502 Ankrd10 Ash2I%%MGLibB_05467 Traf2 Ctr9 Actb%%MGLibB_02796 Arap2 Cd14%%MGLibA_08997 Traf3 Dad1 Actb%%MGLibB_02797 Ash2I Cd14%%MGLibB_08997 Tti2 Ddost Akirin2%%MGLibA_03653 BC023829 Cd14%%MGLibB_08998 Ube3a Ddx39b Akirin2%%MGLibB_03652 Bcl2a1d Cebpb%%MGLibA_09728 Vmn1r71 Gpkow Guides that cause reduction Low cell number (virus in cell viability production) inconsistant phenotype Actb%%MGLibB_02796 Fgd6%%MGLibB_18286 4921511H03Rik%%MGLibB_01150 Actb%%MGLibB_02797 Limk1%%MGLibA_28954 Copz1%%MGLibA_11492 BC023829%%MGLibA_06281 Napa%%MGLibA_33247 Copz1%%MGLibB_11490 CuI3%%MGLibA_12475 Napa%%MGLibB_33238 Dhx15%%MGLibA_14101 CuI3%%MGLibA_12476 Orc6%%MGLibA_38964 Gabpb1%%MGLibB_19241 CuI3%%MGLibB_12472 Psma1%%MGLibB_43357 Hist1h2bh%%MGLibA_24282 Ddx10%%MGLibB_13564 Rpl10%%MGLibB_46136 Hist1h2bh%%MGLibB_24272 Rbm27%%MGLibA_44791 Rpl26%%MGLibB_46188 Mapkapk2%%MGLibB_30381 Rbx1%%MGLibB_44894 Srp54c%%MGLibB_51302 Pcf11%%MGLibB_39906 Ruvbl2%%MGLibB_46746 Traf3%%MGLibA_55551 Prpf40a%%MGLibA_43020 Snip1%%MGLibB_50292 Rbx1%%MGLibB_44896 Tipin%%MGLibA_53942 Rpl23a%%MGLibA_46191 Tipin%%MGLibB_53927 Snip1%%MGLibA_50308 Xab2%%MGLibB_59663 Steap4%%MGLibB_51716 Xab2%%MGLibB_59664 Tti2%%MGLibA_56492 Vmn2r2%%MGLibA_58692
Table S7
[0230] Applicants also explored the basis for false negatives among the positive regulators by examining known regulators of LPS activation that were not among the top-100 ranked genes in the screen. False negatives may arise simply from the limited number of cells relative to number of sgRNAs screened, affecting their ranking, or from sgRNAs that are less efficient at targeting (Doench et al., 2014). To address the latter possibility, Applicants used a different algorithm (Doench et al., 2014) to design 28 additional sgRNAs to target 15 known regulators in the LPS activation pathway that did not rate in the top hits (as chosen above) in the screen. Of these, 12 sgRNA targeting 8/15 genes affected Tnf expression: Irak1 (ranked 992), Irak2 (not scored in the initial library given due to low guide abundance), Irak4 (ranked 187), Tab2 (ranked 1,077), Nfkb2 (ranked 490), Nfkbia (ranked 1,753), Nfkbib (ranked 4,451) and Chuk (ranked 1,948) (
[0231] Overall, Applicants conclude that for the predicted 112 positive regulators of Tnf the false positive rate is 55% and the estimation for the false negatives in the screen based on the known genes that are not in the top 100 ranks is around 53%.
Optimized Characterization of Novel Negative Regulators by Analysis at Unsaturated Levels of Tnf
[0232] Only four of the 64 (
[0233] The small proportion of validated negative regulators and their relatively subtle phenotype (
A Secondary Pooled Screen Uncovers Additional Regulators with Greater Sensitivity and Specificity
[0234] The analysis shows that a genome-wide screen can successfully recover known and novel regulators, and suggests that (for the positive regulators), noise in the screen may arise primarily from the large number of sgRNAs screened in a pool in a limited number of cells. In particular, 6 out of 7 of the false negative genes above (defined as known positive regulators that did not hit in the top-0.5% (i.e. top 100; FDR=50%, ZS analysis) in the genome-wide screen but were verified with individual sgRNAs), were rated in the top 10% of genes in the screen (FDR=96% for the positive ZS analysis). Applicants reasoned that the relatively low ranking of these false negatives may result from low sampling of the sgRNA due to the size of the library relative to the limited number of primary cells and the need for sorting cells to select for low vs. high TNF levels. In addition, the false negative analysis suggested that additional sgRNAs with improved design can improve the assay's sensitivity.
[0235] To address these complexity challenges, and uncover additional regulators, Applicants performed a secondary pooled screen targeting 2,569 genes based on the top ranked genes from the genome-wide screen with each of 10 different sgRNAs (with the improved design of (Doench et al., 2014)). The new library contained 28,010 sgRNA (1.66-fold more sgRNAs per gene than the primary screen), including 2,500 non-targeting sgRNAs controls. Applicants used the same number of cells (200106), resulting in 4.9-fold more cells per sgRNA.
[0236] The secondary screen yielded more specific and sensitive results. On the one hand, a greater proportion of the known regulators were even more highly enriched in the Tnf-Low vs. Tnf-high libraries, (
Positive Tnf Regulators are Organized in Functional Modules by their Impact on RNA and Protein Expression
[0237] While all the validated regulators affect Tnf levels, the pathways and mechanisms through which they act may be distinct. To help determine those, Applicants first measured the impact of the validated positive regulators on the expression of four additional protein markers at 8 hours post-LPS (Experimental Procedures), each reflecting distinct facets of BMDCs biology: Cd11c (the defining surface marker of BMDCs), Cd14 (a Tlr4 co-receptor), Mip1 (an induced chemokine), and Il6 (an induced inflammatory cytokine). For each sgRNA, Applicants assessed with a statistical test its effect on each protein's expression compared to a set of 6-8 non-targeting controls (Experimental Procedures), and then grouped genes based on the similarity of their effects (
[0238] The genes are largely partitioned into several major modules (
[0239] These findings suggests that regulators in each of the Modules I-III may affect Tnf levels through mechanisms that are shared by members of the same module, but distinct from those of the other modules. However, measuring only select protein markers, many of which are expressed only by a relatively late time point, limits the ability to distinguish these pathways. Applicants hypothesized that measuring the effect on global mRNA expression, at early time points, would allow us to further refine and elaborate these pathways.
[0240] Applicants therefore next measured the global effect of each regulator on mRNA levels at 0, 2, 4 and 6 hours post-LPS using RNA-Seq (Experimental Procedures). Applicants assessed the effect of each sgRNA on the level of each mRNA at each time point by comparing it to a set of 12-14 non-targeting guides per time point as controls with a statistical test, and then combined these sgRNA scores into a gene-level score, and correlated the regulators by their global effect (
[0241] Applicants found that the regulator modules change over timewith the distinctions sharpened earlier in the response, and diminishing at later time points, as they converge through likely indirect effects. At time zero (pre-LPS,
[0242] The modules are further supported by their organization in the context of the known LPS/TLR4 circuit and overall protein interaction network (
[0243] Taken together, the data suggests up to four modules that impact Tnf levels in distinct ways: the key TLR signaling pathway, the effects of two complexes: OST and PAF and possibly associated processes, and the function of diverse RNA regulatory proteins. Applicants next explored these functions, focusing on the modules of the OST and PAF complexes.
Components of the OST Complex and the ER Folding and Translocation Pathway are Important for Tnf Expression in Response to LPS Sensing
[0244] Four of the nine structural subunits of the oligosaccharyltransferase complex (OSTc) are among the top 100 ranked positive regulators: Dad1, Ddost/OST48, Rpn1, and Rpn2 in ranks 6 7, 14 and 73, respectively, with each validated individually (
[0245] The ER-resident OSTc tags asparagine residues of newly-translated proteins with oligosaccharide chains that are critical for protein folding and transport through the ER. Consistent with the identification of OSTc, many other genes that are essential for the ER transport pathway (upstream or downstream of OSTc) were also among the top-ranking validated positive regulators (although not necessarily the OSTc module), including: (1) Srp54c (rank 17,
[0246] Over 2,300 proteins are known to be N-glycosylated (Zielinska et al., 2010) and knocking out subunits of OSTc may affect Tnf levels directly or indirectly, andin either casecould reflect a more global effect on N-glycosylated proteins and cell phenotype in LPS-stimulated BMDCs (Notably, there are no discernable differences in viability in the OSTc targeted cells pre-LPS). In particular, both LY96 and Tlr4 are N-glycosylated, and Tlr4 transport to the membrane is disrupted in the absence of tagged asparagines (da Silva Correia and Ulevitch, 2002). Furthermore, HSP90b (above) was shown to be important for Tlr4 folding and trafficking, with Tnf levels reduced in response to LPS in HSP90b-null macrophages (Lee et al., 2013; Randow and Seed, 2001; Yang et al., 2007). Thus, Applicants hypothesized that OSTc (and additional components of the broader pathway, such as Alg2) could affect Tnf levels by impacting Tlr4 and/or its signaling.
[0247] Supporting this hypothesis, targeting any of the four OSTc structural subunits or Alg2 (
[0248] To distinguish between these hypotheses, Applicants examined the specific genes whose expression is affected in OSTc-targeted cells, compared to cells targeted by known regulators from the TLR pathway (which do not affect Cd11c expression), or in cells with non-targeting sgRNA controls, either before or after LPS stimulation (
[0249] Pre-LPS (
[0250] Conversely, after LPS stimulation, sgRNAs targeting OSTc led to a reduction in LPS-responsive genes (
[0251] Additional regulators with the same profile as OSTc may regulate Tnf through related pathways. These include Hsp90b and Alg2, both of which are known members of the protein folding and secretion pathways (above), and Tmem258 (
[0252] Taken together, the finding of an ER stress response in resting DCs supports a model by which OSTc perturbation affects protein folding and stability in the secretory pathway, consistent with previous studies (Aebi, 2013). While mutations in OSTc do not substantially affect BMDC differentiation, they do impact the expression and localization of membrane or secreted proteins in the LPS pathway. Furthermore, in addition to affecting the ER stress response, OSTc regulates specific inflammatory pathways, rather than merely differentiation or the global LPS response to exert its effect on Tnf and other factors.
[0253] The PAF complex and its physical interactors form a module that positively regulates Tnf protein expression
[0254] Five of six known subunits of the PAF complex (PAFc; Paf1, Ctr9, Wdr61, Rtf1, and Leo1), a regulator of transcription elongation (Jaehning, 2010) and 3 mRNA processing (Jaehning, 2010), were identified as positive regulators of Tnf expression among the top-100 ranked genes in the primary screen; each was validated individually (
[0255] PAFc is known to interact with RNA polymerase II with roles in transcription elongation and 3 mRNA processing (Jaehning, 2010), and regulation of transcription elongation was previously shown to be an important key step in the DC transcriptional response (Beaudoin and Jaffrin, 1989; Hargreaves et al., 2009). Prior studies have implicated Paf-1 or PAFc in regulation of antiviral gene expression either as an activator (Marazzi et al., 2012) following viral infection, or as a suppressor (Fonseca et al., 2013), with (Fonseca et al., 2013) or without (Kim et al., 2013a) viral infection. Although PAFc was not previously implicated in Tnf or inflammatory gene expression, LPS is known to induce the expression of both anti-viral and pro inflammatory genes (Amit et al., 2009).
[0256] To decipher the specific impact of PAFc, Applicants examined its transcriptional effect on each of the Antiviral, Peaked Inflammatory and Sustained Inflammatory Modules. Targeting the subunits of PAFc significantly reduces the expression of genes in the Anti-Viral Module (1.9 shift in the mean of the Z scores,
[0257] In order to get a better mechanistic insight into PAFc's function Applicants aimed to identify additional PAFc interactors by immunoprecipitation of Paf1 from BMDCs followed by Mass Spectrometry (MS) (
[0258] Although Rtf1 interacts with Paf1 in lower organisms (Mueller and Jaehning, 2002), Applicants did not observe a direct interaction between PAFc and Rtf1, when immunoprecipitating on either Paf1 (
[0259] Finally, using individual sgRNA assays for each of the putative PAFc interactors, Applicants determined that at least two additional proteins that physically interact with PAFc also regulate Tnf expression: AUH and Xab2. Targeting Auh (
Example 7: Ex Vivo Genome Editing in Primary Cells by Lentiviral-Mediated sgRNA Expression
[0260] The CRISPR-CAS9 screen in primary cells described herein can be used in different primary cell types, including, but not limited to macrophages and T cells. The primary cells may be immune cells, endocrine cells, nervous system cells, muscle cells, exocrine secretory epithelial cells, hormone secreting cells, or metabolism and storage cells. Primary cells refer to any cells that are cultured directly from a subject. Different conditions can be used, such as, activation with another pathogenic signal or in the presence of cytokines. In addition, Applicants use other markers in addition to TNF as a phenotypic readout, including, but not limited to transcription factors, cell surface molecules, secreted cytokines, and secreted hormones.
[0261] The invention is further described by the following numbered paragraphs:
[0262] 1. A method for modulating leukocyte activity, comprising delivering to a leukocyte a vector containing nucleic acid molecule(s), whereby the leukocyte contains or expresses or is able to be induced to express or conditionally expresses Cas9 and the vector expresses one or more RNAs to guide the Cas9 and optionally delivers donor template(s) to introduce mutations in one or more target genetic loci in the leukocyte, thereby modulating expression of one or more genes in the leukocyte.
[0263] 2. The method of any paragraph 1 wherein the RNAs to guide Cas9 comprise chimeric single guide RNA (sgRNA).
[0264] 3. The method of paragraph 2, wherein each sgRNA is driven by a U6 promoter.
[0265] 4. The method of any one of paragraphs 1-3, wherein the vector is a lentiviral vector.
[0266] 5. The method of paragraph 4, wherein the vector is a U6-sgRNA lentiviral vector.
[0267] 6. The method of any one of paragraphs 2-5, wherein the sgRNAs target one or more genes expressed in the leukocyte so as to introduce loss-of-function or gain-of-function mutations.
[0268] 7. The method of any one of paragraphs 1-6 wherein the leukocyte is a mammalian leukocyte.
[0269] 8. The method of paragraph 7 wherein the leukocyte is derived from a non-human transgenic animal, such as a humanized mouse, having cells that contain or express or are able to be induced to express or conditionally express Cas9, and the vector is delivered to the leukocyte ex vivo.
[0270] 9. The method of paragraph 8 wherein the non-human transgenic animal having cells that contain or express or are able to be induced to express or conditionally express Cas9 is a mammal or a primate, or a rodent, or a mouse, or a rat or a rabbit, or a canine or dog, or a cow or bovine, or a sheep or ovine or a goat or a pig, or fowl or poultry, or a chicken, or a fish.
[0271] 10. The method of paragraph 7 wherein the mammalian leukocyte is a mouse leukocyte.
[0272] 11. The method of paragraph 10 wherein the mouse leukocyte is from a transgenic mouse having cells that contain or express or are able to be induced to express or conditionally express Cas9.
[0273] 12. The method of paragraph 11, wherein the transgenic mouse having cells that contain or express or are able to be induced to express or conditionally express Cas9 comprises a mouse that has had a Cas9 transgene knocked into the Rosa26 locus.
[0274] 13. The method of any of paragraphs 1 to 7, wherein the vector is delivered to the leukocyte in vivo.
[0275] 14. The method of any one of paragraphs 1-13, wherein the leukocyte is a dendritic cell.
[0276] 15. The method of any one of paragraphs 1-13, wherein the leukocyte is a T cell.
[0277] 16. The method of any one of paragraphs 1-13, wherein the leukocyte is a hematopoietic progenitor or stem cell.
[0278] 17. The method of any one of paragraphs 1-16, wherein the vector is delivered to the leukocyte using a cell-penetrating peptide (CPP).
[0279] 18. A method of identifying a gene associated with a leukocyte response, comprising:
[0280] (a) delivering to a plurality of leukocytes a plurality of different vectors containing nucleic acid molecule(s), whereby the leukocytes contain or express or are able to be induced to express or conditionally express Cas9 and each vector expresses one or more RNAs (i) to guide the Cas9 and optionally delivers donor template(s) to introduce mutations in different target genetic loci or (ii) to guide the Cas9 to activate or inhibit expression of a target gene in the leukocytes, thereby modulating expression of different genes expressed in the leukocytes;
[0281] (b) measuring a response in the leukocytes; and
[0282] (c) isolating leukocyte(s) in which the response is modulated following delivery of the vector, thereby identifying gene(s) or genetic elements associated with the leukocyte response.
[0283] 19. The method of paragraph 18, wherein the genes or genetic elements associated with the leukocyte response are identified by sequencing one or more nucleic acid molecules present in the isolated or sorted leukocytes.
[0284] 20. The method of paragraph 18 or paragraph 19, wherein the leukocyte response is activation, inhibition, exhaustion, differentiation, migration, adhesion, death or proliferation.
[0285] 21. The method of paragraphs 18-20, wherein the leukocytes comprise dendritic cells and the response comprises activation.
[0286] 22. The method of paragraph 21, wherein the dendritic cells are stimulated with bacterial lipopolysaccharide (LPS).
[0287] 23. The method of paragraph 22, wherein the dendritic cells are stimulated with LPS in the presence of interleukin-10 (IL-10).
[0288] 24. The method of any of paragraphs 21 to 23, wherein activation is measured by determining TNF- or CD86 expression in the dendritic cells.
[0289] 25. The method of any of paragraphs 18-24, wherein the RNAs to guide Cas9 comprise chimeric single guide RNA (sgRNA).
[0290] 26. The method of paragraph 25, wherein each sgRNA is driven by a U6 promoter.
[0291] 27. The method of any one of paragraphs 18-26, wherein the vector is a lentiviral vector.
[0292] 28. The method of paragraph 27, wherein the vector is a U6-sgRNA lentiviral vector.
[0293] 29. The method of any one of paragraphs 25-28, wherein the sgRNAs target one or more genes expressed in the leukocytes so as to introduce loss-of-function or gain-of-function mutations.
[0294] 30. The method of any one of paragraphs 18-29, wherein the vectors are delivered to the leukocytes using a cell-penetrating peptide (CPP).
[0295] 31. The method of any of paragraphs 18-30, wherein a decreased response in a leukocyte is indicative that a gene mutated in the leukocyte by delivery of the vector is a positive regulator of the response.
[0296] 32. The method of any of paragraphs 18-30, wherein an increased response in a leukocyte is indicative that a gene mutated in the leukocyte by delivery of the vector is a negative regulator of the response.
[0297] 33. The method of any one of paragraphs 18-32 wherein the leukocytes are mammalian leukocytes.
[0298] 34. The method of paragraph 33 wherein the mammalian leukocytes are mouse leukocytes.
[0299] 35. The method of paragraph 34 wherein the mouse leukocytes are from a transgenic mouse having cells that contain or express or are able to be induced to express or conditionally express Cas9.
[0300] 36. The method of paragraph 35, wherein the transgenic mouse having cells that contain or express or are able to be induced to express or conditionally express Cas9 comprises a mouse that has had a Cas9 transgene knocked into the Rosa26 locus.
[0301] 37. The method of paragraph 35, wherein the transgenic mouse having cells that contain or express or are able to be induced to express or conditionally express Cas9 comprises a mouse that has had a Cas9 transgene knocked into CRISPRa.
[0302] 38. The method of paragraph 35, wherein the transgenic mouse having cells that contain or express or are able to be induced to express or conditionally express Cas9 comprises a mouse that has had a Cas9 transgene knocked into CRISPRi.
[0303] 39. The method of any of paragraphs 18-20 or 25-38, wherein the leukocytes comprise T cells and the response comprises differentiation, exhaustion, activation, or inhibition.
[0304] 40. The method of paragraph 39, wherein the T cells are stimulated with interleukin-12 and the response comprises differentiation to a Th1 phenotype.
[0305] 41. The method of paragraph 39, wherein the T cells are stimulated with interleukin-4 and the response comprises differentiation to a Th2 phenotype.
[0306] 42. The method of paragraph 39, wherein the T cells are stimulated with TGF- and the response comprises differentiation to a Treg phenotype.
[0307] 43. The method of paragraph 39, wherein the T cells are stimulated with TGF- and interleukin-6 and the response comprises differentiation to a Th17 phenotype.
[0308] 44. The method of any one of paragraphs 39 to 43, wherein the T cells are from a transgenic mouse having cells that express Cas9 and an ovalbumin-specific -T cell receptor.
[0309] 45. The method of any one of paragraphs 18 to 44, wherein a library of vectors are delivered to the leukocytes, each vector in the library expressing one or more RNAs targeted to a gene in a genome of the leukocytes, and wherein the library comprises at least one vector expressing an RNA targeted to each gene in the genome of the leukocytes.
[0310] 46. The method of paragraph 45, wherein the library comprises vectors expressing two, three, four, five or six or more RNAs targeted to each gene in the genome of the leukocytes.
[0311] 47. The method of any one of paragraph 18 to 46, wherein the one or more RNAs guide the Cas9 to activate or inhibit expression of a target gene, and the Cas9 is a mutant Cas9 lacking nuclease activity fused to a functional domain that activates or inhibits gene expression.
[0312] 48. A method for modeling an aberrant leukocyte response or a disease associated with leukocytes, comprising delivering to leukocytes a vector containing nucleic acid molecule(s), whereby the leukocytes contain or express or are able to be induced to express or conditionally express Cas9 and the vector expresses one or more RNAs (i) to guide the Cas9 to introduce mutations in one or more target genetic loci or (ii) to guide the Cas9 to activate or inhibit expression of a target gene in the leukocytes, thereby modulating expression of one or more genes expressed in the leukocytes, and wherein expression of the one or more genes is associated with the response or disease.
[0313] 49. The method of paragraph 48, wherein the leukocytes are derived from a non-human transgenic animal having cells that contain or express or are able to be induced to express or conditionally express Cas9, and the vector is delivered to the leukocyte ex vivo.
[0314] 50. The method of paragraph 49, wherein the transgenic non-human animal is a transgenic mouse having cells that contain or express or are able to be induced to express or conditionally express Cas9.
[0315] 51. The method of paragraph 50, wherein the transgenic mouse having cells that contain or express or are able to be induced to express or conditionally express Cas9 comprises a mouse that has had a Cas9 transgene knocked into the Rosa26 locus.
[0316] 52. The method of paragraph 50, wherein the transgenic mouse having cells that contain or express or are able to be induced to express or conditionally express Cas9 comprises a mouse that has had a Cas9 transgene knocked into CRISPRa.
[0317] 53. The method of paragraph 50, wherein the transgenic mouse having cells that contain or express or are able to be induced to express or conditionally express Cas9 comprises a mouse that has had a Cas9 transgene knocked into CRISPRi.
[0318] 54. The method of any one of paragraphs 48-53, wherein the aberrant leukocyte response is deficient or excess activation, inhibition, exhaustion, migration, adhesion, differentiation or proliferation.
[0319] 55. The method of any one of paragraphs 48-54, wherein the disease is an immune system disorder.
[0320] 56. The method of any one of paragraphs 48-54, wherein the disease is cancer.
[0321] 57. An individualized or personalized treatment of a leukocyte-associated disease in a subject in need of such treatment comprising: [0322] (a) delivering to leukocytes ex vivo a vector containing nucleic acid molecule(s), whereby the leukocytes contain or express or are able to be induced to express or conditionally express Cas9 and the vector expresses one or more RNAs (i) to guide the Cas9 and optionally delivers one or more donor template(s) to introduce mutations in one or more target genetic loci or (ii) to guide the Cas9 to activate or inhibit expression of a target gene in the leukocytes, thereby modulating expression of one or more genes in the leukocytes; [0323] (b) testing treatment(s) for the disease on the leukocytes to which the vector has been delivered; and [0324] (c) treating the subject based on results from the testing of treatment(s) of step (b).
[0325] 58. The method of paragraph 57, wherein the leukocytes are derived from a non-human transgenic animal having cells that contain or express or are able to be induced to express or conditionally express Cas9, and the vector is delivered to the leukocyte ex vivo.
[0326] 59. The method of paragraph 57 or paragraph 58, wherein the disease is an immune system disorder.
[0327] 60. The method of any one of paragraphs 57-58, wherein the disease is cancer.
[0328] 61. An isolated leukocyte comprising a vector containing a nucleic acid molecule(s), wherein the leukocyte contains or expresses or is able to be induced to express or conditionally express Cas9 and the vector encodes one or more RNAs capable of (i) guiding the Cas9 and optionally delivering one or more donor template(s) to introduce mutations in one or more target genetic loci or (ii) guiding the Cas9 to activate or inhibit expression of a target gene in the leukocyte, and thereby modulating expression of one or more genes in the leukocyte.
[0329] 62. An isolated leukocyte comprising a vector containing a nucleic acid molecule(s), wherein the leukocyte contains or expresses or is able to be induced to express or conditionally express Cas9, (i) one or more target genetic loci in the leukocyte comprise mutations derived from Cas9 activity guided by one or more RNAs encoded by the vector or (ii) expression of one or more target genes in the leukocytes is activated or inhibited by Cas9 guided by one or more RNAs encoded by the vector, and wherein expression of one or more genes in the leukocyte is modulated thereby.
[0330] 63. The isolated leukocyte of paragraph 61 or paragraph 62, wherein the RNAs to guide Cas9 comprise chimeric single guide RNA (sgRNA).
[0331] 64. The isolated leukocyte of paragraph 63, wherein each sgRNA is driven by a U6 promoter.
[0332] 65. The isolated leukocyte of any one of paragraphs 61 to 64, wherein the vector is a lentiviral vector.
[0333] 66. The isolated leukocyte of paragraph 65, wherein the vector is a U6-sgRNA lentiviral vector.
[0334] 67. The isolated leukocyte of any one of paragraphs 63-66, wherein the sgRNAs target one or more genes expressed in the leukocyte so as to introduce loss-of-function or gain-of-function mutations.
[0335] 68. The isolated leukocyte of any one of paragraphs 61-67 wherein the leukocyte is a mammalian leukocyte.
[0336] 69. The isolated leukocyte of paragraph 68, wherein the leukocyte is derived from a non-human transgenic animal having cells that contain or express or are able to be induced to express or conditionally express Cas9.
[0337] 70. The isolated leukocyte of paragraph 69, wherein the non-human transgenic animal having cells that contain or express or are able to be induced to express or conditionally express Cas9 is a mammal or a primate, or a rodent, or a mouse, or a rat or a rabbit, or a canine or dog, or a cow or bovine, or a sheep or ovine or a goat or a pig, or fowl or poultry, or a chicken, or a fish.
[0338] 71. The isolated leukocyte of paragraph 68, wherein the mammalian leukocyte is a mouse leukocyte.
[0339] 72. The isolated leukocyte of paragraph 71, wherein the mouse leukocyte is from a transgenic mouse having cells that contain or express or are able to be induced to express or conditionally express Cas9.
[0340] 73. The isolated leukocyte of paragraph 72, wherein the transgenic mouse having cells that contain or express or are able to be induced to express or conditionally express Cas9 comprises a mouse that has had a Cas9 transgene knocked into the Rosa26 locus.
[0341] 74. The isolated leukocyte of paragraph 72, wherein the transgenic mouse having cells that contain or express or are able to be induced to express or conditionally express Cas9 comprises a mouse that has had a Cas9 transgene knocked into CRISPRa.
[0342] 75. The isolated leukocyte of paragraph 72, wherein the transgenic mouse having cells that contain or express or are able to be induced to express or conditionally express Cas9 comprises a mouse that has had a Cas9 transgene knocked into CRISPRi.
[0343] 76. The isolated leukocyte of any one of paragraphs 61-75, wherein the leukocyte is a dendritic cell.
[0344] 77. The isolated leukocyte of any one of paragraphs 61-76, wherein the leukocyte is a T cell.
[0345] 78. The isolated leukocyte of any one of paragraphs 61-77, wherein the one or more genes is associated with a leukocyte response or a leukocyte-associated disease.
[0346] 79. A non-human transgenic eukaryote or mammal having leukocytes that express or that are able to be induced to express or that conditionally express Cas9, and one or more mutation(s) in one or more gene(s) associated with a leukocyte response or a leukocyte-associated disease.
[0347] While preferred embodiments of the present invention have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention.
REFERENCES
[0348] Amit, I., Garber, M., Chevrier, N., Leite, A. P., Donner, Y., Eisenhaure, T., Guttman, M., Grenier, J. K., Li, W., Zuk, O., et al. (2009). Unbiased reconstruction of a mammalian transcriptional network mediating pathogen responses. Science (New York, N.Y.) 326, 257-263. [0349] Bell, C. L., Vandenberghe, L. H., Bell, P., Limberis, M. P., Gao, G. P., Van Vliet, K., Agbandje-McKenna, M., and Wilson, J. M. (2011). The AAV9 receptor and its modification to improve in vivo lung gene transfer in mice. The Journal of clinical investigation 121, 2427-2435. [0350] Chen, S., Xue, Y., Wu, X., Le, C., Bhutkar, A., Bell, E. L., Zhang, F., Langer, R., and Sharp, P. A. (2014). Global microRNA depletion suppresses tumor angiogenesis. Genes & development 28, 1054-1067. [0351] Chevrier, N., Mertins, P., Artyomov, M. N., Shalek, A. K., Iannacone, M., Ciaccio, M. F., Gat-Viks, I., Tonti, E., DeGrace, M. M., Clauser, K. R., et al. (2011). Systematic discovery of TLR signaling components delineates viral-sensing circuits. Cell 147, 853-867. [0352] Cong, L., Ran, F. A., Cox, D., Lin, S., Barretto, R., Habib, N., Hsu, P. D., Wu, X., Jiang, W., Marraffini, L. A., et al. (2013). Multiplex genome engineering using CRISPR/Cas systems. Science 339, 819-823. [0353] Deltcheva, E., Chylinski, K., Sharma, C. M., Gonzales, K., Chao, Y., Pirzada, Z. A., Eckert, M. R., Vogel, J., and Charpentier, E. (2011). CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III. Nature 471, 602-607. [0354] Dull, T., Zufferey, R., Kelly, M., Mandel, R. J., Nguyen, M., Trono, D., and Naldini, L. (1998). A third-generation lentivirus vector with a conditional packaging system. Journal of virology 72, 8463-8471. [0355] DuPage, M., Dooley, A. L., and Jacks, T. (2009). Conditional mouse lung cancer models using adenoviral or lentiviral delivery of Cre recombinase. Nature protocols 4, 1064-1072. [0356] Frese, K. K., and Tuveson, D. A. (2007). Maximizing mouse cancer models. Nature reviews Cancer 7, 645-658. [0357] Garber, M., Yosef, N., Goren, A., Raychowdhury, R., Thielke, A., Guttman, M., Robinson, J., Minie, B., Chevrier, N., Itzhaki, Z., et al. (2012). A high-throughput chromatin immunoprecipitation approach reveals principles of dynamic gene regulation in mammals. Molecular cell 47, 810-822. [0358] Garraway, L. A., and Lander, E. S. (2013). Lessons from the cancer genome. Cell 153, 17-37. [0359] Gasiunas, G., Barrangou, R., Horvath, P., and Siksnys, V. (2012). Cas9-crRNA ribonucleoprotein complex mediates specific DNA cleavage for adaptive immunity in bacteria. Proceedings of the National Academy of Sciences of the United States of America 109, E2579-2586. [0360] Geiss et al., 2008, Direct multiplexed measurement of gene expression with color-coded probe pairs, Nat Biotechnol. 2008 March; 26(3):317-25. doi: 10.1038/nbt1385. Epub 2008 Feb. 17. [0361] Govindan, R., Ding, L., Griffith, M., Subramanian, J., Dees, N. D., Kanchi, K. L., Maher, C. A., Fulton, R., Fulton, L., Wallis, J., et al. (2012). Genomic landscape of non-small cell lung cancer in smokers and never-smokers. Cell 150, 1121-1134. [0362] Halbert, C. L., Allen, J. M., and Miller, A. D. (2002). Efficient mouse airway transduction following recombination between AAV vectors carrying parts of a larger gene. Nature biotechnology 20, 697-701. [0363] Herbst, R. S., Heymach, J. V., and Lippman, S. M. (2008). Lung cancer. The New England journal of medicine 359, 1367-1380. [0364] Hsu, P. D., Scott, D. A., Weinstein, J. A., Ran, F. A., Konermann, S., Agarwala, V., Li, Y., Fine, E. J., Wu, X., Shalem, O., et al. (2013). DNA targeting specificity of RNA-guided Cas9 nucleases. Nature biotechnology 31, 827-832. [0365] Jackson, E. L., Willis, N., Mercer, K., Bronson, R. T., Crowley, D., Montoya, R., Jacks, T., and Tuveson, D. A. (2001). Analysis of lung tumor initiation and progression using conditional expression of oncogenic K-ras. Genes & development 15, 3243-3248. [0366] Ji, H., Ramsey, M. R., Hayes, D. N., Fan, C., McNamara, K., Kozlowski, P., Torrice, C., Wu, M. C., Shimamura, T., Perera, S. A., et al. (2007). LKB1 modulates lung cancer differentiation and metastasis. Nature 448, 807-810. [0367] Jinek, M., Chylinski, K., Fonfara, I., Hauer, M., Doudna, J. A., and Charpentier, E. (2012). A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity. Science 337, 816-821. [0368] Johnson, L., Mercer, K., Greenbaum, D., Bronson, R. T., Crowley, D., Tuveson, D. A., and Jacks, T. (2001). Somatic activation of the K-ras oncogene causes early onset lung cancer in mice. Nature 410, 1111-1116. [0369] Kandoth, C., McLellan, M. D., Vandin, F., Ye, K., Niu, B., Lu, C., Xie, M., Zhang, Q., McMichael, J. F., Wyczalkowski, M. A., et al. (2013). Mutational landscape and significance across 12 major cancer types. Nature 502, 333-339. [0370] Koboldt, D. C., Zhang, Q., Larson, D. E., Shen, D., McLellan, M. D., Lin, L., Miller, C. A., Mardis, E. R., Ding, L., and Wilson, R. K. (2012). VarScan 2: somatic mutation and copy number alteration discovery in cancer by exome sequencing. Genome research 22, 568-576. [0371] Lawrence, M. S., Stojanov, P., Polak, P., Kryukov, G. V., Cibulskis, K., Sivachenko, A., Carter, S. L., Stewart, C., Mermel, C. H., Roberts, S. A., et al. (2013). Mutational heterogeneity in cancer and the search for new cancer-associated genes. Nature 499, 214-218. [0372] Li, H., and Durbin, R. (2010). Fast and accurate long-read alignment with Burrows-Wheeler transform. Bioinformatics 26, 589-595. [0373] Limberis, M. P., and Wilson, J. M. (2006). Adeno-associated virus serotype 9 vectors transduce murine alveolar and nasal epithelia and can be readministered. Proceedings of the National Academy of Sciences of the United States of America 103, 12993-12998. [0374] Mali, P., Yang, L., Esvelt, K. M., Aach, J., Guell, M., DiCarlo, J. E., Norville, J. E., and Church, G. M. (2013). RNA-guided human genome engineering via Cas9. Science 339, 823-826. [0375] Mitzner, W., Brown, R., and Lee, W. (2001). In vivo measurement of lung volumes in mice. Physiological genomics 4, 215-221. [0376] Park, W. Y., Kim, M. H., Shin, D. H., Lee, J. H., Choi, K. U., Kim, J. Y., Park do, Y., Lee, C. H., and Sol, M. Y. (2012). Ciliated adenocarcinomas of the lung: a tumor of non-terminal respiratory unit origin. Modern pathology: an official journal of the United States and Canadian Academy of Pathology, Inc 25, 1265-1274. [0377] Pylayeva-Gupta, Y., Grabocka, E., and Bar-Sagi, D. (2011). RAS oncogenes: weaving a tumorigenic web. Nature reviews Cancer 11, 761-774. [0378] Sanjana, N. E., Shalem, O., and Zhang, F. (2014). Improved vectors and genome-wide libraries for CRISPR screening. Nature Methods 11, 783-784. [0379] Schneider, C. A., Rasband, W. S., and Eliceiri, K. W. (2012). NIH Image to ImageJ: 25 years of image analysis. Nature methods 9, 671-675. [0380] Shackelford, D. B., and Shaw, R. J. (2009). The LKB1-AMPK pathway: metabolism and growth control in tumour suppression. Nature reviews Cancer 9, 563-575. [0381] Shalek, A. K., Satija, R., Adiconis, X., Gertner, R. S., Gaublomme, J. T., Raychowdhury, R., Schwartz, S., Yosef, N., Malboeuf, C., Lu, D., et al. (2013). Single-cell transcriptomics reveals bimodality in expression and splicing in immune cells. Nature 498, 236-240. [0382] Shalem, O., Sanjana, N. E., Hartenian, E., Shi, X., Scott, D. A., Mikkelsen, T. S., Heckl, D., Ebert, B. L., Root, D. E., Doench, J. G., et al. (2014). Genome-scale CRISPR-Cas9 knockout screening in human cells. Science 343, 84-87. [0383] TCGA-Network (2014). Comprehensive molecular profiling of lung adenocarcinoma. Nature Published online 9 Jul. 2014. [0384] Wang, H., Yang, H., Shivalila, C. S., Dawlaty, M. M., Cheng, A. W., Zhang, F., and Jaenisch, R. (2013). One-step generation of mice carrying mutations in multiple genes by CRISPR/Cas-mediated genome engineering. Cell 153, 910-918. [0385] Weinberg, R. A. (2007). The biology of cancer (New York, Garland Science). [0386] Xue, W., Chen, S., Yin, H., Tammela, T., Papagiannakopoulos, T., Joshi, N. S., Cai, W., Yang, G., Bronson, R., Crowley, D. G., et al. (2014). CRISPR-mediated direct mutation of cancer genes in the mouse liver. Nature.