METHOD OF OBTAINING A BINDER TO PREPRO-VASOPRESSIN OR FRAGMENTS THEREOF
20180252732 ยท 2018-09-06
Inventors
Cpc classification
G01N33/74
PHYSICS
C07K2317/34
CHEMISTRY; METALLURGY
International classification
G01N33/74
PHYSICS
C07K16/26
CHEMISTRY; METALLURGY
Abstract
Method of obtaining and/or verifying a binder to prepro-Vasopressin (SEQ ID NO. 1) or fragments thereof of at least 6 amino acids in length, including Copeptin (SEQ ID NO. 2), comprising at least one of the steps of: a) generating the binder using a developer comprising an amino acid sequence of at least 6 amino acids in length contained in an amino acid sequence corresponding to the C-terminal part but lacking amino acid 164 of prepro-Vasopressin (SEQ ID NO. 1); b) determining whether the binder is capable of binding to an amino acid sequence of at least 4 amino acids in length contained in an amino acid sequence corresponding to the C-terminal part but lacking amino acid 164 of prepro-Vasopressin (SEQ ID NO. 1); c) selecting and optionally isolating the binder from a plurality of binders which is capable of binding to an amino acid sequence contained in an amino acid sequence corresponding to the C-terminal part but lacking amino acid 164 of prepro-Vasopressin (SEQ ID NO. 1); d) carrying out binding assays with the binder in order to determine the ex vivo stability of prepro-Vasopressin or fragments thereof of at least 6 amino acids in length, including Copeptin, in a biological sample; e) carrying out binding assays with the binder and another binder for comparison purposes in order to determine the concentration of prepro-Vasopressin or fragments thereof of at least 6 amino acids in length, including Copeptin, in a biological sample; wherein the C-terminal part consists of amino acids 138 to 164 of prepro-Vasopressin (SEQ ID NO. 1), in order to obtain a binder or a mixture of binders capable of binding to an epitope contained in an amino acid sequence corresponding to amino acids 138 to 163 but lacking amino acid 164 of prepro-Vasopressin (SEQ ID NO. 1).
Claims
1. A monoclonal antibody capable of binding to an epitope contained in an amino acid sequence of the C-terminal part of prepro-vasopressin (SEQ ID NO. 1) comprising amino acids 146-163, but lacking amino acid 164, the monoclonal antibody being 429/F4.
2. A cell line producing a monoclonal antibody capable of binding to an epitope contained in an amino acid sequence of the C-terminal part of prepro-vasopressin (SEQ ID NO. 1) comprising amino acids 146-163, but lacking amino acid 164, the cell line producing monoclonal antibody 429/F4.
Description
DRAWINGS
[0042]
[0043]
[0044]
[0045]
[0046]
EXAMPLES
Peptides
[0047] The following Copeptin (SEQ ID NO. 2)-related peptides were chemically synthesized, purified, and quality controlled employing standard procedures:
TABLE-US-00002 Aminoacidpositionof Peptide Sequence SEQIDNO. prepro-Vasopressin(SEQIDNO.1) PAY16 CAGAPEPFEPAQPDAY 4 150-164(+ N-terminalCystein) PAY14 CAPEPFEPAQPDAY 3 152-164(+ N-terminalCystein) P146-164 LVQLAGAPEPFEPAQPDAY 6 146-164 P146-163 LVQLAGAPEPFEPAQPDA 7 146-163 P146-162 LVQLAGAPEPFEPAQPD 8 146-162 P146-161 LVQLAGAPEPFEPAQP 9 146-161 P146-159 LVQLAGAPEPFEPA 11 146-159 P146-158 LVQLAGAPEPFEP 12 146-158 P146-157 LVQLAGAPEPFE 13 146-157
Antibodies
[0048] Monoclonal antibodies directed against the peptides PAY16 (SEQ ID NO. 4) and PAY14 (SEQ ID NO. 3) were generated by standard procedures (Harlow E, Lane D. AntibodiesA Laboratory Manual. Cold Spring Harbor: Cold Spring Harbor Laboratory, 1988; Lane RD. A short-duration polyethylene glycol fusion technique for increasing production of monoclonal antibody-secreting hybridomas. J Immunol Methods 1985; 81:223-8.):
[0049] Briefly, peptides were conjugated to BSA by using Sulfo-MBS (m-maleimidobenzoyl-N-hydroxysuccinimid ester). With these conjugates Balb/c mice were immunized and boostered, and spleen cells were fused with SP2/0 myeloma cells to generate hybridoma cell lines. Cell lines were screened for their ability to secrete antibodies that would bind to the immunogenic peptides, which were coated on a solid polystyrene phase.
[0050] With this approach, cell lines secreting monoclonal antibodies 429/F4 (against PAY16 (SEQ ID NO. 4)) and 423/F10 (against PAY14 (SEQ ID NO. 3)) were generated. For further experiments, monoclonal antibodies were purified from culture supernatant by Protein G affinity chromatography.
[0051] Sheep antiserum and corresponding affinity purified polyclonal sheep antibodies developed against peptide PLAY17 (pc anti-PLAY), used in chemiluminescence/coated tube assays to detect Copeptin (SEQ ID NO. 2) (CT-proAVP) as described [4, 7] were from BRAHMS GmbH, Hennigsdorf, Germany.
Epitope Mapping
[0052] The epitopes of the antibodies were mapped as follows:
a) Coating of Peptides
[0053] Coating was done by standard procedures (EP 1488209 A1, EP 1738178 A1): Polystyrene startubes (Greiner) were coated with peptides P146-164 (SEQ ID NO. 6), P146-163 (SEQ ID NO. 7), P146-162 (SEQ ID NO. 8), P146-161 (SEQ ID NO. 9), P146-159 (SEQ ID NO. 11), P146-158 (SEQ ID NO. 12) and P146-157 (SEQ ID NO. 13) (per tube, 1.5 g of peptide in 300 l of PBS, pH 7.8) overnight at 22 C. Tubes were then blocked with 10 mmol/L Na-phosphate (pH 6.5) containing 3% Karion FP (Merck), 0.5% BSA protease free (Sigma) and lyophilized.
b) Labeling of Donkey-Anti-Sheep IgG and Goat-Anti-Mouse IgG Antibodies
[0054] Labeling was done by standard procedures (EP 1488209 A1, EP 1738178 A1): The concentration of the donkey-anti-sheep (Scantibodies Laboratory Inc., USA) and goat-anti-mouse antibody (BiosPacific, USA) was adjusted to 1 g/L, and the antibodies were labeled by incubation with the chemiluminescent label MACN-Acridinium-NHS-Ester (1 g/L; InVent GmbH, Hennigsdorf, Germany) in a 1:4 molar ratio for 20 min at room temperature. The reactions were stopped by addition of 1/10 volume of 1 mol/L Tris for 10 min at room temperature. Labeled antibodies were separated from free label by size-exclusion chromatography on a NAP-5 column (GE Healthcare, Freiburg, Germany) and a Thermo BioBasic 300 5 m HPLC column (Thermo Scientific).
c) Pc Anti-PLAY17 Antiserum/Affinity Purified Antibody
[0055] Tracer was produced by diluting the labeled donkey-anti-sheep IgG antibody in assay buffer PBS, 0.5% bovine serum albumin protease free (Sigma) containing 106 relative light units (RLU) of MACN-labeled antibody per 200 l. Pc anti-PLAY17 sheep antiserum (B.R.A.H.M.S GmbH, Hennigsdorf, Germany) was diluted with PBS, 0.5% bovine serum albumin (protease free) at a ratio of 1:1000, 1:3000, 1:9000, 1:27000 and 1:81000. Affinity purified pc anti-PLAY17 sheep antibodies were diluted with PBS, 0.5% bovine serum albumin protease free to following concentrations: 972, 324, 108, 36 and 12 ng/200 l. In the first incubation step 50 l of the dilutions of pc anti-PLAY17 sheep antiserum/purified antibodies and 200 l PBS, 0.5% bovine serum albumin (protease free) were pipetted in tubes, coated with peptides P146-164 (SEQ ID NO. 6), P146-163 (SEQ ID NO. 7), P146-162 (SEQ ID NO. 8), P146-161 (SEQ ID NO. 9), P146-159 (SEQ ID NO. 11), P146-158 (SEQ ID NO. 12) and P146-157 (SEQ ID NO. 13). For calculation of non-specific binding (NSB) only 250 l PBS with 0.5% bovine serum albumin (protease free) were pipetted in tubes, coated with peptides P146-164 (SEQ ID NO. 6), P146-163 (SEQ ID NO. 7), P146-162 (SEQ ID NO. 8), P146-161 (SEQ ID NO. 9), P146-159 (SEQ ID NO. 11), P146-158 (SEQ ID NO. 12) and P146-157 (SEQ ID NO. 13). The tubes were incubated over night at 22 C. under agitation. Then, the tubes were washed 5 times with 1 mL of B.R.A.H.M.S washing solution (B.R.A.H.M.S GmbH). In the second incubation step 200 l of donkey-anti-sheep IgG tracer were added and the tubes were incubated for 2 hours at 22 C. under agitation. Then, the tubes were washed 5 times with 1 mL of B.R.A.H.M.S washing solution and bound chemiluminescence was measured for 1 s per tube with an LB 952T luminometer (Berthold).
d) mAb 429/F4 and mAb 423/F10
[0056] Tracer was produced by diluting the labeled antibody goat-anti-mouse IgG into assay buffer (PBS, 0.5% protease free bovine serum albumin) containing 106 relative light units (RLU) of MACN-labeled antibody per 200 l. Monoclonal antibodies 429/F4 and 423/F10 were diluted with PBS, 0.5% bovine serum albumin (protease free) to the following concentrations: 972, 324, 108, 36 and 12 ng/200 l.
[0057] In the first incubation step 50 l of the dilutions of mAb 429/F4/mAb 423/F10 and 200 l PBS, 0.5% bovine serum albumin (protease free) were pipetted in tubes, which were coated with peptides P146-164 (SEQ ID NO. 6), P146-163 (SEQ ID NO. 7), P146-162 (SEQ ID NO. 8), P146-161 (SEQ ID NO. 9), P146-159 (SEQ ID NO. 11), P146-158 (SEQ ID NO. 12) and P146-157 (SEQ ID NO. 13). For calculation of NSB, only 250 l PBS, 0.5% bovine serum albumin (protease free) were pipetted in tubes, coated with peptides P146-164 (SEQ ID NO. 6), P146-163 (SEQ ID NO. 7), P146-162 (SEQ ID NO. 8), P146-161 (SEQ ID NO. 9), P146-159 (SEQ ID NO. 11), P146-158 (SEQ ID NO. 12) and P146-157 (SEQ ID NO. 13). The tubes were incubated over night at 22 C. under agitation. Then, the tubes were washed 5 times with 1 mL of B.R.A.H.M.S washing solution (B.R.A.H.M.S GmbH, Hennigsdorf, Germany). In the second incubation step 200 l of goat-anti-mouse tracer were added and the tubes were incubated for 2 hours at 22 C. under agitation. Then, the tubes were washed 5 times with 1 mL of B.R.A.H.M.S washing solution and bound chemiluminescence was measured for 1 s per tube with an LB 952T luminometer (Berthold).
[0058] In
Immunoassays
Labeling of Monoclonal Antibodies
[0059] Labeling was done by standard procedures (EP 1488209 A1, EP 1738178 A1): The concentration of the purified antibodies 429/F4 and 423/F10 was adjusted to 1 g/L, and the antibodies were labeled by incubation with the chemiluminescent label MACN-Acridinium-NHS-Ester (1 g/L; InVent GmbH, Hennigsdorf, Germany) in a 1:5 molar ratio for 20 min at room temperature. The reactions were stopped by addition of 1/10 volume of 1 mol/L Tris for 10 min at room temperature. Labeled antibodies were separated from free label by size-exclusion chromatography on an NAP-5 column (GE Healthcare, Freiburg, Germany) and a Thermo BioBasic 300 5 m HPLC column (Thermo Scientific).
[0060] Three sandwich immunoassays were utilized or developed as follows:
A. Pc Anti-PLAY17/Mc Anti-PATV17
[0061] CT-proAVP LIA (B.R.A.H.M.S GmbH, Hennigsdorf, Germany) as described in [7].
B. mAb 429/F4/Mc Anti-PATV17
[0062] Tracer was produced by diluting the labeled antibody 429/F4 into assay buffer (300 mmol/L potassium phosphate, 100 mmol/L NaCl, 10 mmol/L sodium EDTA, 5 g/L protease free bovine serum albumin, 1 g/L nonspecific sheep IgG, 1 g/L nonspecific bovine IgG, 1 g/L nonspecific mouse IgG, 0.9 g/L sodium azide, pH 7.0) containing 106 relative light units (RLU) of MACN-labeled antibody per 200 l. 50 l CT pro-AVP standards (B.R.A.H.M.S GmbH, Hennigsdorf, Germany)/samples and 200 l of tracer were pipetted in CT pro-AVP coated tubes (B.R.A.H.M.S GmbH). The tubes were incubated for 2 hours at 22 C. under agitation. Then, the tubes were washed 5 times with 1 mL of washing solution (B.R.A.H.M.S GmbH), and bound chemiluminescence was measured for 1 s per tube with an LB 952T luminometer (Berthold).
C. mAb 423/F10/Mc Anti-PATV17
[0063] Tracer was produced by diluting the labeled antibodies 423/F10 into assay buffer (300 mmol/L potassium phosphate, 100 mmol/L NaCl, 10 mmol/L sodium EDTA, 5 g/L protease free bovine serum albumin, 1 g/L nonspecific sheep IgG, 1 g/L nonspecific bovine IgG, 1 g/L nonspecific mouse IgG, 0.9 g/L sodium azide, pH 7.0) containing 106 relative light units (RLU) of MACN-labeled antibody per 200 l. 50 l CT pro-AVP standards (B.R.A.H.M.S GmbH, Hennigsdorf, Germany)/samples and 200 l of tracer were pipetted in CT pro-AVP coated tubes (B.R.A.H.M.S GmbH). The tubes were incubated for 2 hours at 22 C. under agitation. Then, the tubes were washed 5 times with 1 mL of washing solution (B.R.A.H.M.S GmbH), and bound chemiluminescence was measured for 1 s per tube with an LB 952T luminometer (Berthold).
[0064] Typical dose response curves for the three assays are shown in
Method Comparison
[0065] With the three assays described above, various clinical samples were measured, including samples from healthy individuals, patients with cardiological diseases and patients from the ICU. Graphical method comparisons are shown in
Analyte Stability
[0066] A subset of serum samples used in the method comparisons was stored for different periods at 22 C. and then measured with the three assays. By using the mAb 423/F10/mc anti-PATV17 assay, the recovery dropped drastically, already after 1 day storage at 22 C. The epitope of mAb 423/F10 contains amino acid position 164 of prepro-Vasopressin (SEQ ID NO. 1). In contrast, the analyte appeared much more stable when either the pc anti-PLAY17/mc anti-PATV17 or mAb 429/F4/mc anti-PATV17 assay was used. The epitopes of pc anti-PLAY17 and mAb 429/F4 do not contain amino acid positions 161-164 of prepro-Vasopressin (SEQ ID NO. 1).
TABLE-US-00003 Sequences SEQIDNO.1(prepro-Vasopressin) 102030405060 MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCA 708090100110120 DELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGF 130140150160 HRRARASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY SEQIDNO.2(Copeptin) ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY (representingaminoacidpositions126-164ofprepro-Vasopressin(SEQIDNO.1)) SEQIDNO.3(PeptidePAY14) CAPEPFEPAQPDAY (representingaminoacidpositions152-164ofprepro-Vasopressin(SEQIDNO.1)plus anN-terminalcysteine) SEQIDNO.4(PeptidePAY16) CAGAPEPFEPAQPDAY (representingaminoacidpositions150-164ofprepro-Vasopressin(SEQIDNO.1)plus anN-terminalcysteine) SEQIDNO.5(PeptidePAY33) ATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY (representingaminoacidpositions132-164ofprepro-Vasopressin(SEQIDNO.1)) SEQIDNO.6(PeptideP146-164) LVQLAGAPEPFEPAQPDAY (representingaminoacidpositions146-164ofprepro-Vasopressin(SEQIDNO.1)) SEQIDNO.7(PeptideP146-163) LVQLAGAPEPFEPAQPDA (representingaminoacidpositions146-163ofprepro-Vasopressin(SEQIDNO.1)) SEQIDNO.8(PeptideP146-162) LVQLAGAPEPFEPAQPD (representingaminoacidpositions146-162ofprepro-Vasopressin(SEQIDNO.1)) SEQIDNO.9(PeptideP146-161) LVQLAGAPEPFEPAQP (representingaminoacidpositions146-161ofprepro-Vasopressin(SEQIDNO.1)) SEQIDNO.10(PeptideP146-160) LVQLAGAPEPFEPAQ (representingaminoacidpositions146-160ofprepro-Vasopressin(SEQIDNO.1)) SEQIDNO.11(PeptideP146-159) LVQLAGAPEPFEPA (representingaminoacidpositions146-159ofprepro-Vasopressin(SEQIDNO.1)) SEQIDNO.12(PeptideP146-158) LVQLAGAPEPFEP (representingaminoacidpositions146-158ofprepro-Vasopressin(SEQIDNO.1)) SEQIDNO.13(PeptideP146-157) LVQLAGAPEPFE (representingaminoacidpositions146-157ofprepro-Vasopressin(SEQIDNO.1)) SEQIDNO.14(Anti-PATV17Immunogen) CATQLDGPAGALLLRLV (representingpositions132-147ofpre-pro-Vasopressin(SEQIDNO.1)plusan N-terminalcysteinresidue) SEQIDNO.15(Anti-PLAY17Immunogen) CLAGAPEPFEPAQPDAY (representingpositions149-164ofpre-pro-Vasopressin(SEQIDNO.1)plusan N-terminalcysteinresidue) SEQIDNO.16(294/1A7Immunogen) ATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY (representingpositions132-164ofpre-pro-Vasopressin(SEQIDNO.1)plusan N-terminalcysteinresidue) SEQIDNO.17(H-065-32Immunogen) ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY (representingpositions126-164ofprepro-Vasopressin(SEQIDNO.1)) SEQIDNO.18(MAB6077(clone579021)Immunogen) ASDRSNATQLDGPAG (representingpositions126-140ofpre-pro-Vasopressin(SEQIDNO.1)) SEQIDNO.19(MAG-1Immunogen) QLAGAPEPFEPAQPDAY (representingpositions148-164ofpre-pro-Vasopressin(SEQIDNO.1)) SEQIDNO.20(294/1A7Epitope) GPAGAL (representingpositions137-144ofpre-pro-Vasopressin(SEQIDNO.1)) SEQIDNO.21 GALLLRLVQLAGAPEPFEPAQPDA (representingpositions140-163ofpre-pro-Vasopressin(SEQIDNO.1)) SEQIDNO.22 LLLRLVQLAGAPEPFEPAQPDA (representingpositions142-163ofpre-pro-Vasopressin(SEQIDNO.1)) SEQIDNO.23 LRLVQLAGAPEPFEPAQPDA (representingpositions144-163ofpre-pro-Vasopressin(SEQIDNO.1))
LITERATURE
[0067] 1. Kluge M, Riedl S, Erhart-Hofmann B, Hartmann J, Waldhauser F. Improved extraction procedure and RIA for determination of arginine-8-vasopressin in plasma: role of premeas-urement sample treatment and reference values in children. Clin Chem 1999; 45:98-103. [0068] 2. Preibisz J J, Sealey J E, Laragh J H, Cody R J, Weksler B B. Plasma and platelet vasopressin in essential hypertension and congestive heart failure. Hypertension 1983; 5:1129-38. [0069] 3. Robertson G L, Mahr E A, Athar S, Sinha T. Development and clinical application of a new method for the radioimmunoassay of arginine vasopressin in human plasma. J Clin Invest 1973; 52:2340-52. [0070] 4. Morgenthaler N G, Struck J, Alonso C, Bergmann A. Assay for the measurement of co-peptin, a stable peptide derived from the precursor of vasopressin. Clin Chem 2006; 52:112-9. [0071] 5. Morgenthaler N G, Struck J, Jochberger S, Dunser M W. Copeptin: clinical use of a new biomarker. Trends Endocrinol Metab 2008; 19:43-9. [0072] 6. Struck J, Morgenthaler N G, Bergmann A. Copeptin, a stable peptide derived from the vasopressin precursor, is elevated in serum of sepsis patients. Peptides 2005; 26:2500-4. [0073] 7. Fenske W, Stork S, Blechschmidt A, Maier S G, Morgenthaler N G, Allolio B. Copeptin in the differential diagnosis of hyponatremia. J Clin Endocrinol Metab 2009; 94:123-9.