A Separation Matrix and a Method of Separating Antibodies

20180243665 ยท 2018-08-30

    Inventors

    Cpc classification

    International classification

    Abstract

    The invention discloses a separation matrix comprised of porous spherical particles to which antibody-binding protein ligands have been covalently immobilized, wherein the density of said ligands is in the range of 10.5-15 mg/ml and the volume-weighted median diameter of said particles is in the range of 30-55 m. The invention further discloses a method of separation of antibodies by affinity chromatography which employs the said separation matrix within a chromatography column.

    Claims

    1. A separation matrix comprising porous spherical particles to which antibody-binding protein ligands have been covalently immobilized, wherein the density of said ligands is above 10 mg/ml and the volume-weighted median diameter of said particles is in the range of 30-55 m.

    2. The separation matrix of claim 1, wherein the density of said ligands is in the range of 10.5-15 mg/ml, such as 11-15 mg/ml.

    3. The separation matrix of claim 1, wherein said porous spherical particles comprise a crosslinked polysaccharide.

    4. The separation matrix of claim 1, wherein said porous spherical particles comprise crosslinked agarose.

    5. The separation matrix of claim 4, wherein the agarose has been allylated before gelation.

    6. The separation matrix of claim 1, wherein said porous spherical particles have a gel phase distribution coefficient, expressed as K.sub.D for dextran of molecular weight 110 kDa, of 0.6-0.8, such as 0.6-0.7.

    7. The separation matrix of claim 1, wherein said ligands comprise an Fc-binding protein.

    8. The separation matrix of claim 7, wherein said Fc-binding protein is Protein A.

    9. The separation matrix of claim 1, wherein said ligands comprise monomers, dimers or multimers of Protein A domains.

    10. The separation matrix of claim 9, wherein one or more of said domains have been mutated.

    11. The separation matrix of claim 10, wherein one or more of said domains is derived from Protein Z or the B or C domain of Protein A and wherein the amino acid residue at position 23 is a threonine.

    12. The separation matrix of claim 9, wherein one or more of said domains comprises an amino acid sequence as defined by SEQ ID NO: 8 or 9.

    13. The separation matrix of claim 9, which after 5 hours incubation in 0.5 M NaOH at 20+/2 C. retains at least 95% of its original binding capacity.

    14. A chromatography column comprising the separation matrix according to claim 9.

    15. The chromatography column of claim 14, comprising a packed bed of said separation matrix, wherein said packed bed has a bed height of up to 5 or 10 cm, such as 2-5 cm or 2-4 cm.

    16. A chromatography system comprising a plurality of chromatography columns according to claim 14.

    17. The chromatography system of claim 16, arranged for performing continuous chromatography.

    18. The chromatography system of claim 16, comprising at least two, such as at least three, chromatography columns, packed with the same separation matrix and connected with one or more connecting lines such that liquid can flow from one column to a subsequent one and from a last column to a first column and wherein each connecting line between two columns comprises at least one on/off valve.

    19. A method of separation of antibodies by affinity chromatography, which method comprises the steps of: a) conveying a process feed through at least a first chromatography column according to claim 14, to adsorb antibodies from said feed; b) optionally washing said first chromatography column; c) conveying an eluent through said first chromatography column to elute antibodies; and d) recovering said eluent with antibodies.

    20. The method of claim 19, which is carried out in a chromatography system comprising a plurality of chromatography columns, wherein each column comprises porous spherical particles to which antibody-binding protein ligands have been covalently immobilized, wherein the density of said ligands is above 10 mg/ml and the volume-weighted median diameter of said particles is in the range of 30-55 m.

    21. The method of claim 19, wherein: in step a) an effluent from said first chromatography column is passed through a second chromatography column packed with the same separation matrix as the first column; after step a), in a step a), the process feed is redirected to the second chromatography column and an effluent from the second chromatography column is passed through a third chromatography column packed with the same separation matrix as the first and second columns; after step a), in a step a), the process feed is redirected to the third chromatography column and an effluent from the third chromatography column is passed through the first chromatography column; step c) is performed before step a); after step a), in a step c), the eluent is conveyed through the second chromatography column to elute antibodies; after step a), in a step c), the eluent is conveyed through the third chromatography column to elute antibodies; and the sequence of steps a), a), a), c), c) and c) is optionally repeated one or more times.

    22. The method of claim 19, wherein in step a), the residence time is less than 2 min, such as 0.3-1 min or 0.3-0.8 min.

    23. The method of claim 21, wherein in steps a), a) and a), the residence time is less than 2 min, such as 0.3-1 min or 0.3-0.8 min.

    24. The method of claim 19, wherein said process feed comprises at least 4 mg/ml antibodies, such as 4-15 or 4-10 mg/ml.

    25. The method of claim 21, further comprising steps e), e) and e), after steps c), c) and c) respectively, comprising conveying a cleaning liquid through said first, second and third chromatography columns.

    26. The method of claim 25, wherein said cleaning liquid comprises at least 0.1 M alkali such as NaOH.

    Description

    DRAWINGS

    [0011] FIG. 1 shows an alignment of Protein A Fc-binding domains.

    [0012] FIG. 2 shows a chromatogram from Example 1. UV Sample Pre=UV absorbance of the feed, UV Sample Post=UV absorbance of column effluent.

    [0013] FIG. 3 shows the dynamic binding capacity for a matrix of the invention, compared with a reference matrix.

    [0014] FIG. 4 shows a column according to the invention.

    [0015] FIG. 5 shows a chromatography system according to the invention.

    DETAILED DESCRIPTION OF EMBODIMENTS

    [0016] In one aspect, illustrated by FIGS. 1-3, the present invention discloses a separation matrix comprising porous, suitably spherical, particles to which antibody-binding protein ligands have been covalently immobilized. The density of these ligands is above 10 mg/ml, e.g. in the range of 10.5-15 mg/ml, such as 10.5-12 mg/ml, and the volume-weighted median diameter of the particles is in the range of 30-55 m, such as 45-55 m or 50-55 m. The density of the ligands denotes the content of coupled ligands per ml matrix sediment volume and it can be determined e.g. by amino acid analysis. The volume weighted median diameter, also denoted d50,v, can be determined by electrozone sensing (Coulter Counter), laser light diffraction or microscopy with image analysis. A preferred method is to use electrozone sensing with an instrument calibrated with a narrow sieve fraction of the matrix in question, for which the d50,v, has been determined with microscopy and image analysis.

    [0017] The porous particles may comprise a crosslinked polysaccharide, which provides a large hydrophilic surface for coupling of the ligands, with minimal risk of non-specific interactions between mAbs or contaminants and the particles. The polysaccharide suitably has zero or very low (e.g. <5 micromol/ml) content of charged groups to prevent non-specific interactions. The crosslinking increases rigidity and chemical stability and can be achieved by methods known in the art, in particular by epoxide crosslinking, using e.g. epichlorohydrin or a diepoxide as crosslinker. Examples of polysaccharides can be dextran, cellulose and agarose. Agarose has the particular advantage that highly porous, rigid gels can be achieved by thermal gelation of aqueous agarose solution. The agarose can suitably be crosslinked by the methods described in U.S. Pat. No. 6,602,990, U.S. Pat. No. 7,396,467 or U.S. Pat. No. 8,309,709, which are hereby incorporated by reference in their entireties. Agarose crosslinked by these methods, so called high flow agarose, has a particularly advantageous combination of high rigidity and high porosity/pore volume, allowing high flow rates and rapid mass transport. High rigidity is particularly important for matrices having small particle sizes, to allow high flow rates without collapse of the matrix. The agarose can e.g. be allylated with reagents like allyl glycidyl ether or allyl halides before gelation, as described in U.S. Pat. No. 6,602,990. To allow for high binding capacities and rapid mass transport, the particles can advantageously have a large volume of pores accessible to macromolecular species like IgG antibodies. This can be determined by inverse size exclusion chromatography (SEC) as described in Handbook of Process Chromatography, A Guide to Optimization, Scale-Up and Validation (1997) Academic Press, SanDiego, Gail Sofer & Lars Hagel eds. ISBN 0-12-654266-X, p. 368. A suitable parameter for the accessible pore volume is the gel phase distribution coefficient, K.sub.D, determined for a probe molecule of defined size. This is a column-independent variable calculated from the retention volume V.sub.R for the probe molecule, the interstitial void volume of the column V.sub.0 and the total liquid volume of the column Vt according to K.sub.D=(V.sub.RV.sub.0)/(V.sub.tV.sub.0). The porous particles can suitably have a K.sub.D value in the range of 0.6-0.8, such as 0.65-0.75 or 0.65-0.70, for dextran of molecular weight 110 kDa as the probe molecule.

    [0018] The ligands can e.g. be derived from antibody-binding bacterial proteins, such as SpA (Protein A), Peptostreptococcus Protein L or Streptococcus Protein G. They may bind to antibodies such that the K.sub.D value of the interaction is at most 110.sup.6 M, for example at most 110.sup.7 M, such as at most 510.sup.8 M. They can comprise an Fc-binding protein, such as SpA or and SpA variant, which binds to the Fc part of IgG molecules. They can comprise monomers, dimers or multimers of native or mutated Protein A Fc-binding domains. The native Protein A Fc-binding domains E, D, A, B and C are shown in FIG. 1, together with the mutated variants Z and Zvar. In some embodiments, one or more of the domains in the ligands is derived from Protein Z or the B or C domain of Protein A, with the amino acid residue at position 23 being a threonine. Such domains have an improved alkali stability desirable for bioprocess use (see e.g. U.S. Pat. No. 8,329,860, U.S. Pat. No. 7,834,158, U.S. Ser. No. 14/961,164 and WO2016079033, hereby incorporated by reference in their entireties), which may e.g. be assessed by incubating the separation matrix 5 h in 0.5 M NaOH at 22+/2 C. Suitably, the matrix then retains at least 90% or at least 95% of the original IgG-binding capacity before incubation. In certain embodiments, one or more of the domains comprises an amino acid sequence as defined by SEQ ID NO: 8 or 9. SEQ ID NO:8 is the Zvar domain minus the linker sequence VDAKFD and SEQ ID NO:9 is the C domain minus the linker sequence ADNKFN. One or more of the domains, such as all the domains, may also be mutated by one or more amino acid substitutions, insertions or deletions. Thus for example, there may be up to 10, 9, 8, 7, 6, 5, 4, 3 or 2 mutations, e.g. substitutions within SEQ ID NO: 8 or 9.

    TABLE-US-00001 SEQIDNO:8 KEQQNAFYEILHLPNLTEEQRNAFIQSLKDDPSQ SANLLAEAKKLNDAQAPK SEQIDNO:9 KEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSV SKEILAEAKKLNDAQAPK

    [0019] The ligands may additionally comprise one or more linker sequences of 1-10 amino acid residues, e.g. VDNKFN, ADNKFN, VDAKFD, AD or FN, suitably between the individual domains. In addition, the ligands may comprise a coupling moiety, e.g. a cysteine or a plurality of lysines at the C-terminus or N-terminus of the ligand, suitably at the C-terminus. The ligands may also comprise a leader sequence at the N-terminus, e.g. a scar or a residue after cleavage of a signal peptide and optionally also a copy of a linker sequence. Such a leader sequence may e.g. be a 1-15 amino acid (e.g. a 1-10 amino acid) peptide, e.g. AQ, AQGT, AQVDAKFD, AQGTVDAKFD or AQVDNKFN. Hence, a typical structure of a ligand may e.g. be Leader (Domain-Linker).sub.n-1-Domain Coupling moiety. n may e.g. be 1-7, such as 1, 2, 3, 4, 5, 6 or 7.

    [0020] In a second aspect, illustrated by FIG. 4, the invention discloses a chromatography column 1 comprising the separation matrix as described above. The chromatography column can e.g. be an axial packed bed column 1, where a cylindrical packed bed 2 of matrix particles is confined between two nets/frits 3,4 and two distributor structures 5,6, allowing flow of a feed through an inlet 7, an inlet distributor 5 and an inlet net/frit 3 through the packed bed 2 and then through an outlet frit/net 4, an outlet distributor 6 and an outlet 8. The height h of the packed bed may e.g. be up to 5 cm or up to 10 cm, such as 2-5 cm or 2-4 cm. The diameter d of the packed bed may e.g. be at least 1 cm, such as at least 1.5 cm or 1.5-200 cm, 1.5-100 cm, 1.5-50 cm or 1.5-30 cm.

    [0021] In a third aspect, illustrated by FIG. 5, the invention discloses a chromatography system 10 comprising a plurality of chromatography columns 11,12,13 as disclosed above. The system can suitably be arranged for performing continuous chromatography. It may e.g. comprise at least two, such as at least three chromatography columns 11,12,13 as disclosed above, packed with the same separation matrix and connected with one or more connecting lines 14,15,16 such that liquid can flow from one column 11,12 to a subsequent one 12,13 and from a last column 13 to a first column 11 and each connecting line between two columns may comprise at least one on/off valve 17,18,19, which may be three-way or four-way valves. The system may further comprise a feed pump 20, e.g. connected via a first detector 21 to a first valve block 22. A buffer pump 23 may also be connected to this first valve block 22. The first valve block 22 can further be connected to the inlet of a first column 11 via a first valve 23. An outlet end of the first column 11 may be connected to a second valve 17 through a second detector 24. The first valve block 22 can further be connected to the inlet of a second column 12 via a second valve or valve block 25. An outlet end of the second column 12 can be connected to valve 18 via a third detector 26. Furthermore, a valve 27 can be connected between valve 17 and valve 18. Valve 27 can also be connected to a valve 28 which is also connected to valve 23 and the second valve block 25. Hereby the effluent from the first column 11 can be directed to the inlet of the second column 12 through connecting line 14, valves 17, 27, 28 and 25. Furthermore the first valve block 22 can be connected to the inlet of a third column 13 via valve 29. An outlet end of the third column 13 may be connected to valve 19 via a fourth detector 30. Furthermore valve 31 can be connected between valve 18 and valve 19. Valve 31 can also be connected to valve 32 which may also connected to the second valve block 25 and valve 29. Hereby the effluent from the second column 12 can be directed to the inlet of the third column 13 through connecting line 15. The effluent from the third column 13 can be directed to the inlet of the first column 11 through connecting line 16 via valves 19 and 23. Furthermore, the first, second, third and fourth detectors 21, 24, 26, 30 may all be connected to a determining unit 32. The determining unit can be adapted to use the detected signals from the detectors to determine breakthrough and saturation points for the three different columns. The determining unit 32 and all the valve blocks, valves and pumps may further be connected to a control unit 33 (all the connections are not shown in the Figure) which is adapted to control the chromatography system in terms of when to remove or add columns from/into the loading zone, change flow rates, start new wash steps, etc. The detectors 21, 24, 26, 30 can e.g. be UV detectors. The control unit 33 may be configured to control the system according to breakthrough data obtained from the determining unit 32. Alternatively, control unit 33 can use fixed predetermined step times for the switching operations.

    [0022] In a fourth aspect, the invention discloses a method of separation of antibodies by affinity chromatography. This method comprises the steps of:

    a) conveying a process feed through at least a first chromatography column as disclosed above, to adsorb antibodies from the feed. The process feed may e.g. comprise at least 4 mg/ml antibodies, such as 4-15, 4-10, or 4-5 mg/ml and/or the residence time in this step may e.g. be less than 2 min, such as 0.3-1 min or 0.3-0.8 min;
    b) optionally washing the first chromatography column;
    c) conveying an eluent through the first chromatography column to elute antibodies; and
    d) recovering the eluent with antibodies.

    [0023] The method can suitably be carried out in the chromatography system 10 disclosed above.

    [0024] In certain embodiments of the method, in step a) an effluent from the first chromatography column 11 is passed through a second chromatography column 12 packed with the same separation matrix as the first column;

    after step a), in a step a), the process feed is redirected to the second chromatography column 12 and an effluent from the second chromatography column is passed through a third chromatography column 13 packed with the same separation matrix as the first and second columns;
    after step a), in a step a), the process feed is redirected to the third chromatography column 13 and an effluent from the third chromatography column is passed through the first chromatography column 11;
    step c) is performed before step a);
    after step a), in a step c), the eluent is conveyed through the second chromatography column 12 to elute antibodies;
    after step a), in a step c), the eluent is conveyed through the third chromatography column 13 to elute antibodies; and
    the sequence of steps a), a), a), c), c) and c) is optionally repeated one or more times.

    [0025] The residence time in steps a), a) and a) may e.g. be less than 2 min, such as 0.3-1 min or 0.3-0.8 min.

    [0026] The method may further, after steps c), c) and c) respectively, comprise steps e), e) and e), each comprising conveying a cleaning liquid through said first, second and third chromatography columns respectively. The cleaning liquid can be an aqueous alkali solution comprising at least 0.1M (e.g. 0.1-1M or 0.1-0.5 M) alkali. The alkali may e.g be NaOH, but can also be e.g. KOH. The cleaning (also called cleaning in place-CIP) step ensures that any residual feed components are removed from the columns before repetition of the binding and elution steps. Suitable, the ligands are capable of withstanding repeated alkali treatments, e.g. as discussed above where the matrix retains at least 95% of its original IgG-binding capacity after 5 h incubation with 0.5 M NaOH.

    [0027] After steps e), e) and e) respectively, the method may also comprise equilibration steps f), f) and f) to reequlibrate the columns for steps a), a) and a) respectively.

    EXAMPLES

    Example 1

    [0028] Columns: Three HiTrap 5 mL plastic columns (internal diameter 7.0 mm) packed with highly crosslinked spherical agarose beads to a bed height of 3.0 cm. The beads contained 11 mg/ml SpA variant ligands (tetramers of Zvar), covalently coupled via a C-terminal cysteine to high rigidity (crosslinked according to the procedure described in U.S. Pat. No. 6,602,990) agarose beads of 52 micrometers volume-weighted median diameter (d50,v), having a porosity corresponding to a K.sub.D value of 0.66 for dextran of Mw 110 kDa.

    [0029] Feed: Clarified CHO cell supernatant containing 4.0 g/L of a monoclonal IgG antibody, filtered through a 0.22 micrometer filter. 752 g feed was mixed with 1253 g PBS buffer pH 7.4 to give a mAb concentration of 1.5 g/L before loading on the columns. The UV absorbance (300 nm) of this mixture was 695 mAu.

    [0030] Chromatography: The columns were mounted in an AKTA PCC (GE Healthcare Bio-Sciences AB, Sweden) system with flowpaths similar to FIG. 5 and the diluted feed was continuously captured on the columns using a 3-column PCC method under the conditions as described in Table 1. Buffers: Equilibration 10 mM Phosphate 27 mM KCl 140 mM NaCl pH 7.4, Wash 1 10 mM Phosphate 27 mM KCl 140 mM NaCl pH 7.4, Wash 2 50 mM Acetate buffer pH 6, Elution 50 mM Acetate buffer pH 3.5, CIP 100 mM NaOH. The system was run with predetermined fixed step times.

    TABLE-US-00002 TABLE 1 PCC steps of Example 1. Column Flow rate Residence time Step duration Step volumes (CV) (ml/min) (RT) (min) time (min) Load 28.9 (32.3 CV 10 0.5 14.5 (16.2 first load) first load) Wash 1 2 10 0.5 1 Wash 2 1 10 0.5 0.5 Elution 3 5.0 1 3 Cleaning in 1 1.0 5 5 place (CIP) Equilibration 5 10 0.5 2.5

    [0031] The column turn-around time, including pump washes, was 14.5 min. The mAb concentration in the eluate was determined by measuring the 280 nm UV absorbance in cuvettes and calculating from a predetermined calibration curve.

    [0032] Chromatograms from the experiment are shown in FIG. 4. The quantified results are shown in Table 2.

    TABLE-US-00003 TABLE 2 Results from Example 1. Loaded mAb mAb mAb in volume loaded concentration eluate Yield Load # (mL) (mg) Eluate (g) (mg/ml) (mg) (%) 1 161.5 242 8.9 23.2 206 85.2* 2 144.5 217 8.9 23.7 211 97.5* 3 144.3 216 9.2 23.7 218 100.6 4 144.3 216 9.2 23.7 218 100.7 5 144.4 217 9.0 24.5 221 101.8 6 144.3 216 9.7 22.9 222 102.5 7 144.4 217 9.2 24.3 224 103.4 8 144.5 217 9.1 24.7 224 103.6 9 144.4 217 9.6 23.2 223 102.8 10 144.4 217 9.2 24.3 224 103.4 11 144.4 217 9.0 24.5 221 101.8 12 144.2 216 9.3 24.3 226 104.6 *Before reaching steady state.

    [0033] At steady state, the dynamic capacity was on the average 43 g/L, at 45% breakthrough and 0.5 min residence time. The productivity, calculated as mAb concentration/(residence time*number of columns), with the residence time in h, was 60 g/L h.

    Example 2

    [0034] This 3-column PCC experiment was run with the undiluted 4.0 mg/L supernatant of Example 1 as the feed. The residence time during loading was 2.5 min and the conditions as listed in Table 3. In this experiment, the UV absorption after each column was measured and used to automatically switch columns at 5% breakthrough.

    TABLE-US-00004 TABLE 3 PCC steps of Example 2. Residence Column Time Step Buffer volumes (min) Equilibration 10 mM Phosphate 27 mM KCl 5.5 1.5 140 mM NaCl pH 7.4 Feed 4 mg/mL mAb5 fed batch 5% BT 2.5 (0.22 m) Wash 1 10 mM Phosphate 27 mM KCl 2 2 140 mM NaCl pH 7.4 Wash 2 50 mM Acetate buffer pH 6 1.5 1.5 Elution 50 mM Acetate buffer pH 3.5 3 4 CIP 100 mM NaOH 3 5 ReEquilibration 10 mM Phosphate 27 mM KCl 5 1.5 140 mM NaCl pH 7.4

    [0035] The average amount of mAb in each column eluate was 270 mg and the dynamic binding capacity was on the average 54 g/L.

    Example 3

    [0036] The dynamic binding capacity (10% breakthrough, Qb10) for mAb from the cell supernatant of Example 1 on columns of the same type as in Example 1 was determined as a function of residence time using standard methodology. The measurements were made a) on the same matrix as in Example 1 (Prototype) and b) on a matrix with larger bead size (Reference). In the latter case the matrix contained 10.5 mg/ml SpA variant ligands (tetramers of Zvar), covalently coupled via a C-terminal cysteine to high rigidity (crosslinked according to the procedure described in U.S. Pat. No. 6,602,990) agarose beads of 85 micrometers volume-weighted median diameter (d50,v), having a porosity corresponding to a K.sub.D value of 0.69 for dextran of Mw 110 kDa. The results are plotted in FIG. 3 as dynamic binding capacity vs. residence time.

    [0037] This written description uses examples to disclose the invention, including the best mode, and also to enable any person skilled in the art to practice the invention, including making and using any devices or systems and performing any incorporated methods. The patentable scope of the invention is defined by the claims, and may include other examples that occur to those skilled in the art. Such other examples are intended to be within the scope of the claims if they have structural elements that do not differ from the literal language of the claims, or if they include equivalent structural elements with insubstantial differences from the literal languages of the claims. Any patents or patent applications mentioned in the text are hereby incorporated by reference in their entireties, as if they were individually incorporated.