Modified template-independent enzymes for polydeoxynucleotide synthesis

10059929 ยท 2018-08-28

Assignee

Inventors

Cpc classification

International classification

Abstract

The invention includes methods for identifying polymerases, such as modified terminal nucleotidyl transferases (TdT), that are capable of binding nucleotides comprising removable 3-O-blocking moieties to a nucleic acid initiator, without the use of a template. The invention further includes the identified polymerases, and methods of using the polymerases for de novo synthesis of predetermined oligonucleotide sequences.

Claims

1. A modified terminal deoxynucleotidyl transferase (TdT) comprising a mutation in the TGSR motif and capable of adding a nucleotide analog comprising a removable 3-O-blocking moiety to the 3-OH of a nucleic acid initiator in the absence of a nucleic acid template.

2. The modified TdT of claim 1, wherein the modified TdT comprises an N-terminus t-138 bovine TdT and a protein tag sequence fused to the N-terminus.

3. The modified TdT of claim 1, wherein the modified TdT comprises an N-terminus t-151 bovine TdT and a protein tag sequence fused to the N-terminus.

4. The modified TdT of claim 1, wherein the modified TdT comprises an N-terminus t-160 bovine TdT and a protein tag sequence fused to the N-terminus.

5. The modified TdT of claim 1, wherein the modified TdT exhibits an increased rate of incorporation of modified nucleotides, compared to native TdT.

6. The modified TdT of claim 1, wherein the modified TdT is capable of adding adenine, cytosine, guanine, and thymine deoxyribonucleotides modified with a removable 3-O-blocking moiety.

7. The modified TdT of claim 6, wherein said nucleotides are 2-deoxyribonucleotides.

8. The modified TdT of claim 1, wherein the modified TdT is capable of adding adenine, cytosine, guanine, and uracil ribonucleotides modified with a removable 3-O-blocking moiety.

9. The modified TdT of claim 1, wherein said removable 3-O-blocking moiety comprises a 3-O-azidomethyl group.

10. The modified TdT of claim 1, wherein said removable 3-O-blocking moiety comprises a 3-O-amino group.

11. The modified TdT of claim 1, wherein said removable 3-O-blocking moiety comprises a 3-O-allyl group.

12. The modified TdT of claim 1, wherein said removable 3-O-blocking moiety is selected from the group consisting of O-phenoxyacetyl; O-methoxyacetyl; O-acetyl; O-(p-toluene)sulfonate; O-phosphate; O-nitrate; O-[4-methoxy]-tetrahydrothiopyranyl; O-tetrahydrothiopyranyl; O-[5-methyl]-tetrahydrofuranyl; O-[2-methyl,4-methoxy]-tetrahydropyranyl; O-[5-methyl]-tetrahydropyranyl; and O-tetrahydrothiofuranyl.

13. The modified TdT of claim 1, wherein the modified TdT is capable of incorporating a 3-O-blocked nucleotide 5-triphosphate, and said removable blocking moiety comprises a group selected from esters, ethers, carbonitriles, phosphates, carbonates, carbamates, hydroxylamine, borates, nitrates, sugars, phosphoramide, phosphoramidates, phenylsulfenates, sulfates, sulfones and amino acids.

14. The modified TdT of claim 1, wherein the modified TdT is capable of incorporating modified nucleotides at a reaction temperature of about 30 C.

15. The modified TdT of claim 1, wherein the modified TdT is capable of incorporating modified nucleotides at a reaction temperature from 30 C. to 80 C.

16. The modified TdT of claim 1, wherein the modified TdT is capable of incorporating modified nucleotides at a concentration of 1000 M or less.

17. The modified TdT of claim 16, wherein the modified TdT is capable of incorporating modified nucleotides at a concentration of 100 M or less.

18. The modified TdT of claim 1, wherein the modified TdT is expressed by an organism having a genome comprising a nucleic acid sequence being at least 90% identical to SEQ ID NOS. 2, 4, 6, or 8.

19. The modified TdT of claim 1, wherein the TGSR motif comprises a mutation selected from G, A, V, L, I, M, F, W, P, S, T, C, Y, N, Q, D, E, K, R, or H.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 shows an agarose gel of a solution phase polymerization reaction composed of terminal deoxynucleotidyl transferase (TdT), deoxyadenosine triphosphate (dATP) and fluorescent strand initiator 5-Cy5-dA10 at different time points from Tjong et al. Amplified on-chip fluorescence detection of DNA hybridization by surface-initiated enzymatic polymerization, Anal. Chem., 2011; 83:5153-5159 (2011).

(2) FIG. 2 illustrates an exemplary modified terminal deoxynucleotidyl transferase (TdT) mediated polynucleotide synthesis cycle using a support bound initiator and 3-O-blocked nucleotide triphosphate including (A) incorporation of a nucleotide analog comprising a cleavable 3-O-blocking group (indicated by R), and (B) removal of the 3-O-blocking group thus enabling the next 3-O-blocked nucleotide analog to be incorporated, wherein N=A, G, C, or T.

(3) FIG. 3 shows the polyacrylamide gel analysis of a solution phase reaction time course of commercially-available TDT and a nucleic acid initiator with 3-O-azidomethyl-dCTP or 3-O-azidomethyl-dATP. Lane 1100 bp ladder size standard, Lane 2oligonucleotide standard, Lane 33-O-azidomethyl-dCTP+TdT 15 reaction time, Lane 41 hour, Lane 52 hours, Lane 64 hours, Lane 724 hours, Lane 83-O-azidomethyl-dATP+TdT 15 reaction time, Lane 91 hour, Lane 102 hours, Lane 104 hours, Lane 1124 hours, Lane 12dATP+TdT 15 reaction time, Lane 131 hour, Lane 144 hours, Lane 1524 hours.

(4) FIG. 4 shows a computer-generated image of the active site of TdT using the PDB crystal structure 1KDH, showing the computationally docked catalytically productive positions of a dATP (white frame) and a 3-O-allyl-dATP analog (green frame), each complexed to the two active-site metal ions (large pink spheres). The white framework model on the left side of the graphic shows the 3-OH of the oligonucleotide chain attacking the alpha phosphate (dotted black line) of the incoming dATP or 3-O-allyl-dATP analog. The deoxyribose (green) wireframe model shows the position of a 3-O-allyl dATP analog while the deoxyribose (white) wireframe models shows the position of unmodified dATP.

(5) FIG. 5 shows a ribbon model of the active site of TdT using the PDB crystal structure 1KDH with a computationally docked catalytically productive 3-O-allyl dATP analog showing the amino acid residues in closest proximity to the 3-O of the ligand. These residues may be modified to create mutant TdTs suitable for use with the invention.

(6) FIG. 6 shows exemplary 3-O-azidomethyl deoxynucleotides that can be used to synthesize custom DNA oligomers using modified TdTs, as described herein.

(7) FIG. 7 shows a synthetic scheme for producing 3-O-azidomethyl deoxyadenosine triphosphate (3-O-azidomethyl-dATP).

(8) FIG. 8 shows a synthetic scheme for producing 3-O-azidomethyl deoxythymidine triphosphate (3-O-azidomethyl-dTTP).

(9) FIG. 9 shows a synthetic scheme for producing 3-O-azidomethyl deoxycytidine triphosphate (3-O-azidomethyl-dCTP).

(10) FIG. 10 shows a synthetic scheme for producing 3-O-azidomethyl deoxyguanosine triphosphate (3-O-azidomethyl-dGTP).

DESCRIPTION OF THE INVENTION

(11) The invention facilitates the synthesis of polynucleotides, such as DNA, by providing modified enzymes that can be used with nucleic acid analogs. Using the disclosed methods, a modified template-independent terminal deoxynucleotidyl transferase (TdT) is obtained that allows the enzymatically mediated synthesis of de novo oligodeoxynucleotides, thereby enabling their use in routine assembly for gene synthesis. The enzymes of the invention lend themselves to aqueous-based, enzyme-mediated methods of synthesizing polynucleotides of a predetermined sequence on a solid support.

(12) The modified enzymes of the invention will allow 3-O-blocked dNTP analogs to be used in a step-by-step method to extend an initiating nucleic acid into a user defined sequence (see FIG. 2). Furthermore, after each nucleotide extension step, the reactants can be recovered and recycled from the solid support back to the original reagent reservoir. Once that step is complete, the 3-O-blocking group will be removed, allowing the cycle to start anew. At the conclusion of n cycles of extension-recover-deblock-wash, the full length, single strand polydeoxynucleotide will be cleaved from the solid support and isolated for subsequent use. A variety of 3-O-blocked deoxynucleotides, may be used, but the choice of specific 3-O-blocking groups is dictated by: 1) the smallest possible bulk to maximize substrate utilization by TdT and 2) removal of the blocking group with the mildest and preferably aqueous conditions in the shortest period of time.

(13) Cost savings by this approach will be achieved by exploiting the higher yield of final oligonucleotide product at a lower starting scale than currently being used as the existing industry standard (i.e., less than 1 nanomole). Future adaptation of this enzymatic approach to array based formats will allow even further and more dramatic reductions in the cost of synthesis of long oligonucleotides achievable by highly parallel synthesis. Furthermore, the enzymatic synthesis process that we propose uses only aqueous based chemistries like buffers and salts, thus greatly reducing the environmental burden of the organic waste generated by the existing phosphoramidite method.

(14) The methods of the invention may be used to modify terminal deoxynucleotidyl transferases (TdT), however other enzymes could be modified with similar methods. TdT is likely to be a successful starting enzyme because it is capable of 3-extension activity using single strand initiating primers in a template-independent polymerization. However, prior to the invention described herein, there have been no reports of 3-O-blocked nucleotides being incorporated into single-stranded oligonucleotide by an enzyme in the absence of a template. In fact, as Chang and Bollum reported, substitution of the 3-hydroxyl group results in complete inactivity of available transferase enzymes. See Chang and Bollum, Molecular Biology of Terminal Transferase, CRC Critical Reviews in Biochemistry, vol. 21 (1), p. 27-52 (1986), incorporated herein by reference in its entirety. Nonetheless, when TdT is used with natural dNTPs (i.e., not 3-O-blocked), and without a template, oligonucleotide extension continues without stopping. Such uncontrolled incorporation is evidenced by the time-dependent gel electrophoresis images shown in FIG. 1. FIG. 1 shows an agarose gel of a solution phase polymerization reaction composed of terminal deoxynucleotidyl transferase (TdT), deoxyadenosine triphosphate (dATP) and fluorescent strand initiator 5-Cy5-dA10 at different time points. (Adapted with permission from Tjong et al. Amplified on-chip fluorescence detection of DNA hybridization by surface-initiated enzymatic polymerization, Anal. Chem., 2011; 83:5153-5159 (2011), incorporated by reference herein in its entirety.) Additionally, TdT can extend primers in a near quantitative manner resulting in the addition of thousands of nucleotides, while TdT is likely to accept a wide variety of modified and substituted dNTPs as efficient substrates. Furthermore, a substantial library of mechanistic and structural information regarding TdT already exists. See Delarue et al., EMBO J. 2002; 21(3):427-39; Gouge et al., J Mol Biol. 2013 Nov. 15; 425(22):4334-52 and Romain et al., Nucleic Acids Res. 2009; 37(14):4642-56, both of which are incorporated by reference in their entireties.

(15) It is known that TdT can use substrates having modifications and/or substitutions at the deoxyribose sugar ring as well as the purine/pyrimidine nucleobases. For example, TdT accepts bulky modifications at the C5 of pyrimidines and the C7 of purines. See Sorensen et al., Enzymatic Ligation of Large Biomolecules to DNA, ACS Nano 2013, 7(9):8098-104; Figeys et al., Anal. Chem. 1994, 66(23):4382-3; Li et al., Cytometry, 1995, 20(2):172-80, all of which are incorporated by reference in their entireties. In some instances, TdT can even accept non-nucleotide triphosphates. See Barone et al., Nucleotides and Nucleic Acids 2001, 20(4-7):1141-5, and Alexandrova et al., Bioconjug Chem., 2007, 18(3):886-93, both of which are incorporated by reference in their entireties. However, there is little evidence in the prior art that TdT can accept 3-O-blocked nucleotides. See, for example, Knapp et al., Chem. Eur. J., 2011, 17:2903, incorporated herein by reference in its entirety. While the lack of activity of TdT was not a focus of Knapp et al., the authors reported that they tested their 3-OH modified analog with TdT, and saw no incorporation of this relatively small 3-OH modification into an oligonucleotide.

(16) Native TdT is a very efficient enzyme. It has been demonstrated that TdT can polymerize extremely long homopolydeoxynucleotides of 1000 to 10,000 nucleotides in length (see Hoard et al., J of Biol Chem, 1969 244(19):5363-73; Bollum, The Enzymes, Volume 10, New York: Academic Press; 1974. p. 141-71; Tjong et al., Anal Chem, 2011, 83:5153-59, all of which are incorporated by reference in their entireties). Random sequence oligomers consisting of all four nucleotides have also been polymerized by TdT, however there are no reports of ordered polynucleotides being synthesized in the absence of a template. See Damiani, et al., Nucleic Acids Res, 1982, 10(20):6401-10, incorporated by reference herein in its entirety. Support-bound synthesis of polynucleotides by TdT is additionally supported by reports of homopolymer synthesis of 150 bps initiators covalently attached to self-assembled monolayers on gold surfaces. See Chow et al., J Am Chem Soc 2005; 127:14122-3, and Chow and Chilikoti, Langmuir 2007, 23:11712-7, both of which are incorporated by reference in their entireties. These authors also observed preference by TdT of dATP>dTTP>>dGTPdCTP for incorporation of homopolymers. In a more recent report, Tjong et al. demonstrated the TdT mediated synthesis of long (>1 Kb) homopolymer ssDNA from initiator primers immobilized on glass surfaces.

(17) The distributive behavior of TdT is reinforced by FIG. 3, which shows a time course of a solution phase synthesis of 1-1.5 kb homopolymers. After each addition of an unmodified (natural) dNTP, the enzyme dissociates, thus allowing the random extension of any strand in the population. The distribution of product lengths in such a system should follow a Poisson distribution, as reported by Bollum and co-workers in 1974. If TdT were used with a terminating nucleotide species, i.e., one with the 3-O-position blocked, the reaction should proceed to completion, resulting not in a distribution of product lengths, but essentially a pure product of a single nucleotide addition.

(18) Nonetheless, as described above, nucleotide synthesis with 3-O-blocked dNTPs does not proceed with commercially-available TdT proteins. This fact is reinforced by FIG. 3, which shows a gel shift assay used to monitor the solution phase incorporation kinetics of 3-O-azidomethyl dATP and 3-O-azidomethyl dCTP using a commercially-available, recombinant TdT. The data in FIG. 3 clearly show that neither 3-O-modified dNTP analog is a substrate for TdT, i.e., there is no polynucleotide extension when compared to reactions containing dATP as a positive control (lanes 12 thru 15). FIG. 3, thus, adds further evidence that commercially-available TdTs are not able to synthesize oligomers by incorporating dNTPs with modified 3-OHs.

(19) With suitable modifications, a variety of different 3-O-blocked dNTP analogs will be suitable for the controlled addition of nucleotides by TdT. Modified 3-O-blocked dNTP analogs include, but are not limited to, the 3-O-allyl, 3-O-azidomethyl, 3-ONH.sub.2, and 3-OCH.sub.2CN blocking groups. Overall, the choice of the 3-O-blocking group will dictated by: 1) the smallest possible bulk to maximize substrate utilization by TdT, which is likely to affect kinetic uptake, and 2) the blocking group with the mildest removal conditions, preferably aqueous, and in the shortest period of time. 3-O-blocking groups that are the suitable for use with this invention are described in WO 2003/048387; WO 2004/018497; WO 1996/023807; WO 2008/037568; Hutter D, et al. Nucleosides Nucleotides Nucleic Acids, 2010, 29(11): 879-95; and Knapp et al., Chem. Eur. J., 2011, 17:2903, all of which are incorporated by reference in their entireties.

(20) A computational model of the active site of murine TdT was created to understand the structural basis for the lack of utilization of 3-O-blocked dNTPs by TdT. Additionally, the computer model made it possible to fit various modified dNTPs into the active site. FIG. 4 shows the docking of a 3-O-allyl-dATP (shown in green) with murine TdT (see SEQ ID NO. 9, below) using the PDB crystal structure 1KDH and AutoDock 4.2 (Molecular Graphics Laboratory, Scripps Research Institute, La Jolla, Calif.). FIG. 4 also shows a dATP with an unmodified 3-OH (white) superimposed on the 3-O-allyl-dATP. The phosphate portions of the dATPs (orange/red) are in complex with the catalytic metal ions (pink) while the alpha phosphate is positioned to be attacked by the 3-OH of the bound oligonucleotide initiator (black dotted line). The model shown in FIG. 4 predicts that there is sufficient room for the 3-allyl-dNTP to interact with TdT in a catalytically productive conformation, but larger protecting groups at this position will likely prevent catalytically-productive binding of such modified dNTP analogs.

(21) AutoDock's predicted binding mode suggests that modification to the 3-OH will change the electrostatic interactions between two residues, Arg336 and Arg454. Although Arg336 is near the reaction center in the active site, Arg 336 is highly conserved, and early studies found that replacement of Arg336 with Gly or Ala reduced dNTP activity by 10-fold (Yang B et al. J. Mol. Biol. 1994; 269(16):11859-68). Accordingly, one motif for modification is the GGFRR motif including Arg 336 in the above structural model.

(22) On the other hand, sequence analysis of the TdT family demonstrates a wide range of amino acids that can be accommodated at position 454. This analysis suggests structural flexibility at position 454, and surrounding residues. Additionally, it is thought that Gly452 and Ser453 exist in a cis-peptide bond conformation (see Delarue et al., EMBO J., 2002; 21(3):427-39, incorporated herein by reference in its entirety) and that the guanidinium group of Arg336 assists in the stabilization of this conformation. The stability provided by Arg336 may help explain why substitutions at this position have a negative impact on the reactivity of modified TdT proteins. In some instances, the instability created by modifying position 336 may be overcome by using proline residues to stabilize cis-peptide bond conformation. However, if Arg336 is substituted, e.g., with alanine or glycine, the entire TGSR motif (positions 451, 452, 435, 454) may also have to be modified to compensate for this change. For example, the TGSR motif may be modified to TPSR or TGPR. Accordingly, the TGSR motif, including Gly452 in the above structural model was targeted for modification.

(23) In another embodiment, substitutions at Arg454 to accommodate the steric bulk of a 3-O-blocking group may require additional modifications to the 14 region to compensate for substitutions of glycine or alanine at Arg454. In other embodiments, substitutions to other residues in the 11 region may be required to compensate for substitution to Arg336 either instead of, or in addition to, modification of the TGSR motif.

(24) While modification to Arg336 and Arg454 may change the binding interactions of 3-O-modified dNTPs, it may also be necessary to explore substitutions that would result in improved steric interactions of 3-O-modified dNTPs with TdT. Such steric modifications can also be explored computationally. FIG. 5 shows a model of a catalytically-productive, docked 3-O-allyl modified dATP and its interactions with residues such as Gly332, Gly333, Gly452, Thr451 and Ser453 of murine TdT. Each of these residues is within 0.6 nm of the 3-OH of a typical dNTP. These residues are also potential targets for substitution to allow the extra steric bulk of a 3-blocking group like 3-O-azidomethyl or 3-O-allyl. Residues that are within 1.2 nm of the 3-OH such as Glu457, Ala510, Asp509, Arg508, Lys199, Ser196 Met192, or Leu161 may also potentially interfere with the substrate utilization of a 3-O-blocked dNTP and are thus targets for substitution in addition to or in combination with Arg336 and Arg454. In addition to amino acid substitutions at positions 508, 509 and 510 it may be necessary to delete residues to remove interference with a 3-O-blocking group such as deletions of one or more amino acids between Pro505 and Asp509. Other residues that may need to be altered are Val 436, Trp450, Ser453, Phe456, Glu491, Phe495. In some embodiments, the following changes may be required: Arg454Ala, Arg454Gly, Trp450Gly, Trp450A, Thr451Gly, Thr451Ala, Glu491Asp, Ser453Ala, Ser453Gly, Trp450His, Trp450Tyr, Trp450Phe. Combinations of changes like Trp450Ala+Val436Trp, Phe456Tyr+Phe495Tyr may be required to remove interference with a 3-O-blocking group. Since these amino acids are located near the C-terminus of the protein, and exist in a relatively unstructured region, they may be deleted singly or altogether, either instead of or in combination with the modifications described above.

(25) As shown below, most TdTs include the GGFRR and TGSR motifs. In the following sequences, the GGFRR and TGSR motifs have been bolded and underlined for easy reference. Native calf thymus TdT is a candidate for alteration of the primary structure to achieve a suitable template-independent polymerase. However, a variety of other proteins may be explored to identify a candidate suitable for the use with 3-O-blocked dNTP analogs, including human and murine TdT. The amino acid sequence corresponding to native calf TdT is listed in Table 1 as SEQ ID NO. 1, while the nucleic acid sequence is listed in Table 2 as SEQ ID NO. 2. In some embodiments, the resulting protein, adapted for sequence-specific de novo polynucleotide synthesis with 3-O-modified dNTPs and NTPs, will be at least 85% identical, i.e., at least 90% identical, i.e., at least 93% identical, i.e., at least 95% identical, i.e., at least 97% identical, i.e., at least 98% identical, i.e., at least 99% identical, with SEQ ID NO. 1. Furthermore, it may be possible to truncate portions of the amino acid sequence of bovine TdT and still maintain catalytic activity.

(26) TABLE-US-00001 TABLE1 AminoAcidSequenceofBovineTdT SEQIDNO.1:(520aa) MAQQRQHQRLPMDPLCTASSGPRKKRPRQVGASMASPPHD IKFQNLVLFILEKKMGTTRRNFLMELARRKGFRVENELSD SVTHIVAENNSGSEVLEWLQVQNIRASSQLELLDVSWLIE SMGAGKPVEITGKHQLVVRTDYSATPNPGFQKTPPLAVKK ISQYACQRKTTLNNYNHIFTDAFEILAENSEFKENEVSYV TFMRAASVLKSLPFTIISMKDTEGIPCLGDKVKCIIEEII EDGESSEVKAVLNDERYQSFKLFTSVFGVGLKTSEKWFRM GFRSLSKIMSDKTLKFTKMQKAGFLYYEDLVSCVTRAEAE AVGVLVKEAVWAFLPDAFVTMTGGFRRGKKIGHDVDFLIT SPGSAEDEEQLLPKVINLWEKKGLLLYYDLVESTFEKFKL PSRQVDTLDHFQKCFLILKLHHQRVDSSKSNQQEGKTWKA IRVDLVMCPYENRAFALLGWTGSRQFERDIRRYATHERKM MLDNHALYDKTKRVFLKAESEEEIFAHLGLDYIEPWERNA

(27) TABLE-US-00002 TABLE2 NucleicAcidSequenceofBovineTdT SEQIDNO.2:(1923nt) ctcttctggagataccacttgatggcacagcagaggcagc atcagcgtcttcccatggatccgctgtgcacagcctcctc aggccctcggaagaagagacccaggcaggtgggtgcctca atggcctcccctcctcatgacatcaagtttcaaaatttgg tcctcttcattttggagaagaaaatgggaaccacccgcag aaacttcctcatggagctggctcgaaggaaaggtttcagg gttgaaaatgagctcagtgattctgtcacccacattgtag cagaaaacaactctggttcagaggttctcgagtggcttca ggtacagaacataagagccagctcgcagctagaactcctt gatgtctcctggctgatcgaaagtatgggagcaggaaaac cagtggagattacaggaaaacaccagcttgttgtgagaac agactattcagctaccccaaacccaggcttccagaagact ccaccacttgctgtaaaaaagatctcccagtacgcgtgtc aaagaaaaaccactttgaacaactataaccacatattcac ggatgcctttgagatactggctgaaaattctgagtttaaa gaaaatgaagtctcttatgtgacatttatgagagcagctt ctgtacttaaatctctgccattcacaatcatcagtatgaa ggatacagaaggaattccctgcctgggggacaaggtgaag tgtatcatagaggaaattattgaagatggagaaagttctg aagttaaagctgtgttaaatgatgaacgatatcagtcctt caaactctttacttctgtttttggagtgggactgaagaca tctgagaaatggttcaggatggggttcagatctctgagta aaataatgtcagacaaaaccctgaaattcacaaaaatgca gaaagcaggatttctctattatgaagaccttgtcagctgc gtgaccagggccgaagcagaggcggttggcgtgctggtta aagaggctgtgtgggcatttctgccggatgcctttgtcac catgacaggaggattccgcaggggtaagaagattgggcat gatgtagattttttaattaccagcccaggatcagcagagg atgaagagcaacttttgcctaaagtgataaacttatggga aaaaaagggattacttttatattatgaccttgtggagtca acatttgaaaagttcaagttgccaagcaggcaggtggata ctttagatcattttcaaaaatgctttctgattttaaaatt gcaccatcagagagtagacagtagcaagtccaaccagcag gaaggaaagacctggaaggccatccgtgtggacctggtta tgtgcccctacgagaaccgtgcctttgccctgctaggctg gactggctcccggcagtttgagagagacatccggcgctat gccacacacgagcggaagatgatgctggataaccacgctt tatatgacaagaccaagagggtatttctcaaagcggaaag tgaagaagaaatctttgcacatctgggattggactacatt gaaccatgggaaagaaatgcttaggagaaagctgtcaact tttttcttttctgttctttttttcaggttagacaaattat gcttcatattataatgaaagatgccttagtcaagtttggg attctttacattttaccaagatgtagattgcttctagaaa taagtagttttggaaacgtgatcaggcaccccctgggtta tgctctggcaagccatttgcaggactgatgtgtagaactc gcaatgcattttccatagaaacagtgttggaattggtggc tcatttccagggaagttcatcaaagcccactttgcccaca gtgtagctgaaatactgtatacttgccaataaaaatagga aac

(28) Additionally, to make isolation of recombinant proteins easier, it is common to append an N-terminal His tag sequence to the recombinant protein (see Boule J-B et al., Molecular Biotechnology, 1998; 10:199-208, incorporated by reference herein in its entirety), which is used in combination with an affinity column (Hitrap, Amersham Pharmacia Biotech, Uppsala, Sweden). Alternatively, N-terminal truncated forms of the enzyme with appended His-tag sequence will work with the current invention (see, e.g., U.S. Pat. No. 7,494,797, incorporated by reference herein in its entirety). His-tagged Bovine TdT amino acid sequences are shown below in Tables 3, 5, and 7, while His-tagged Bovine TdT nucleic acid sequences are shown below in Tables 4, 6, and 8. His tags may be engineered at other positions as required. In some embodiments, the resulting protein, adapted for sequence-specific de novo polynucleotide synthesis with 3-O-modified dNTPs and NTPs, will be at least 85% identical, i.e., at least 90% identical, i.e., at least 93% identical, i.e., at least 95% identical, i.e., at least 97% identical, i.e., at least 98% identical, i.e., at least 99% identical, with SEQ ID NOS. 3, 5, or 7.

(29) TABLE-US-00003 TABLE3 AminoAcidSequenceofat-138and His-taggedBovineTdT. SEQIDNo.3:(392aa) MetArgGlySerHisHisHisHisHisHisArgThr AspTyrSerAlaThrProAsnProGlyPheGlnLys ThrProProLeuAlaValLysLysIleSerGlnTyr AlaCysGlnArgLysThrThrLeuAsnAsnTyrAsn HisIleAspAlaPheGluIleLeuAlaGluAsnSer GluPheLysGluAsnGluValSerTyrValThrPhe MetArgAlaAlaSerValLeuLysSerLeuProPhe ThrIleIleSerMetLysAspThrPheThrGluGly IleProCysLeuGlyAspLysValLysCysIleIle GluGluIleIleGluAspGlyGluSerSerGluVal LysAlaValLeuAsnAspGluArgTyrGlnSerPhe LysLeuSerValPheGlyValGlyLeuLysThrSer GluLysTrpPheArgMetGlyPheThrPheArgSer LeuSerLysIleMetSerAspLysThrLeuLysLys MetGlnLysAlaGlyPheLeuTyrTyrGluAspLeu ValSerCysValThrArgAlaGluAlaGluAlaVal GlyValLeuValLysGluAlaValTrpAlaPheLeu ProAspAlaPheValThrMetThrGlyGlyPheArg ArgGlyLysLysIleGlyHisAspValAspPheLeu IleThrSerProGlySerAlaGluAspGluGluGln LeuLeuProLysValIleAsnLeuTrpGluLysLys GlyLeuLeuLeuTyrTyrAspLeuValGluSerThr PheGluLysPheLysPheThrLeuProSerArgGln ValAspThrLeuAspHisPheGlnLysCysPheLeu IleLeuLysLeuHisHisGlnArgValAspSerSer LysSerAsnGlnGlnGluGlyLysThrTrpLysAla IleArgValAspLeuValMetCysProTyrGluAsn ArgAlaPheAlaLeuLeuGlyTrpThrGlySerArg GlnPheGluArgAspIleArgArgTyrAlaThrHis GluArgLysMetMetLeuAspAsnHisAlaLeuTyr AspLysThrLysArgValPheLeuLysAlaGluSer GluGluGluIlePheAlaHisLeuGlyLeuAspTyr IleGluProTrpGluArgAsnAla

(30) TABLE-US-00004 TABLE4 NucleotideSequenceofat-138and His-taggedBovineTdT. SEQIDNo.4:(1187nt) atgagaggatcgcatcaccatcaccatcacagaacagact attcagctaccccaaacccaggcttccagaagactccacc acttgctgtaaaaaagatctcccagtacgcgtgtcaaaga aaaaccactttgaacaactataaccacatattcacggatg cctttgagatactggctgaaaattctgagtttaaagaaaa tgaagtctcttatgtgacatttatgagagcagcttctgta cttaaatctctgccattcacaatcatcagtatgaaggata cagaaggaattccctgcctgggggacaaggtgaagtgtat catagaggaaattattgaagatggagaaagttctgaagtt aaagctgtgttaaatgatgaacgatatcagtccttcaaac tctttacttctgtttttggagtgggactgaagacatctga gaaatggttcaggatggggttcagatctctgagtaaaata atgtcagacaaaaccctgaaattcacaaaaatgcagaaag caggatttctctattatgaagaccttgtcagctgcgtgac cagggccgaagcagaggcggttggcgtgctggttaaagag gctgtgtgggcatttctgccggatgcctttgtcaccatga caggaggattccgcaggggtaagaagattgggcatgatgt agattttttaattaccagcccaggatcagcagaggatgaa gagcaacttttgcctaaagtgataaacttatgggaaaaaa agggattacttttatattatgaccttgtggagtcaacatt tgaaaagttcaagttgccaagcaggcaggtggatacttta gatcattttcaaaaatgctttctgattttaaaattgcacc atcagagagtagacagtagcaagtccaaccagcaggaagg aaagacctggaaggccatccgtgtggacctggttatgtgc ccctacgagaaccgtgcctttgccctgctaggctggactg gctcccggcagtttgagagagacatccggcgctatgccac acacgagcggaagatgatgctggataaccacgctttatat gacaagaccaagagggtatttctcaaagcggaaagtgaag aagaaatctttgcacatctgggattggactacattgaacc atgggaaagaaatgcttaagcttgcgc

(31) TABLE-US-00005 TABLE5 AminoAcidSequenceofat-151and His-taggedBovineTdT. SEQIDNo.5:(379aa) MetArgGlySerHisHisHisHisHisHisLysThr ProProLeuAlaValLysLysIleSerGlnTyrAla CysGlnArgLysThrThrLeuAsnAsnTyrAsnHis IleAspAlaPheGluIleLeuAlaGluAsnSerGlu PheLysGluAsnGluValSerTyrValThrPheMet ArgAlaAlaSerValLeuLysSerLeuProPheThr IleIleSerMetLysAspThrPheThrGluGlyIle ProCysLeuGlyAspLysValLysCysIleIleGlu GluIleIleGluAspGlyGluSerSerGluValLys AlaValLeuAsnAspGluArgTyrGlnSerPheLys LeuSerValPheGlyValGlyLeuLysThrSerGlu LysTrpPheArgMetGlyPheThrPheArgSerLeu SerLysIleMetSerAspLysThrLeuLysLysMet GlnLysAlaGlyPheLeuTyrTyrGluAspLeuVal SerCysValThrArgAlaGluAlaGluAlaValGly ValLeuValLysGluAlaValTrpAlaPheLeuPro AspAlaPheValThrMetThrGlyGlyPheArgArg GlyLysLysIleGlyHisAspValAspPheLeuIle ThrSerProGlySerAlaGluAspGluGluGlnLeu LeuProLysValIleAsnLeuTrpGluLysLysGly LeuLeuLeuTyrTyrAspLeuValGluSerThrPhe GluLysPheLysPheThrLeuProSerArgGlnVal AspThrLeuAspHisPheGlnLysCysPheLeuIle LeuLysLeuHisHisGlnArgValAspSerSerLys SerAsnGlnGlnGluGlyLysThrTrpLysAlaIle ArgValAspLeuValMetCysProTyrGluAsnArg AlaPheAlaLeuLeuGlyTrpThrGlySerArgGln PheGluArgAspIleArgArgTyrAlaThrHisGlu ArgLysMetMetLeuAspAsnHisAlaLeuTyrAsp LysThrLysArgValPheLeuLysAlaGluSerGlu GluGluIlePheAlaHisLeuGlyLeuAspTyrIle GluProTrpGluArgAsnAla

(32) TABLE-US-00006 TABLE6 NucleotideSequenceofat-151and His-taggedBovineTdT. SEQIDNo.6:(1148nt) atgagaggatcgcatcaccatcaccatcacaagactccac cacttgctgtaaaaaagatctcccagtacgcgtgtcaaag aaaaaccactttgaacaactataaccacatattcacggat gcctttgagatactggctgaaaattctgagtttaaagaaa atgaagtctcttatgtgacatttatgagagcagcttctgt acttaaatctctgccattcacaatcatcagtatgaaggat acagaaggaattccctgcctgggggacaaggtgaagtgta tcatagaggaaattattgaagatggagaaagttctgaagt taaagctgtgttaaatgatgaacgatatcagtccttcaaa ctctttacttctgtttttggagtgggactgaagacatctg agaaatggttcaggatggggttcagatctctgagtaaaat aatgtcagacaaaaccctgaaattcacaaaaatgcagaaa gcaggatttctctattatgaagaccttgtcagctgcgtga ccagggccgaagcagaggcggttggcgtgctggttaaaga ggctgtgtgggcatttctgccggatgcctttgtcaccatg acaggaggattccgcaggggtaagaagattgggcatgatg tagattttttaattaccagcccaggatcagcagaggatga agagcaacttttgcctaaagtgataaacttatgggaaaaa aagggattacttttatattatgaccttgtggagtcaacat ttgaaaagttcaagttgccaagcaggcaggtggatacttt agatcattttcaaaaatgctttctgattttaaaattgcac catcagagagtagacagtagcaagtccaaccagcaggaag gaaagacctggaaggccatccgtgtggacctggttatgtg cccctacgagaaccgtgcctttgccctgctaggctggact ggctcccggcagtttgagagagacatccggcgctatgcca cacacgagcggaagatgatgctggataaccacgctttata tgacaagaccaagagggtatttctcaaagcggaaagtgaa gaagaaatctttgcacatctgggattggactacattgaac catgggaaagaaatgcttaagcttgcgc

(33) TABLE-US-00007 TABLE7 AminoAcidSequenceofat-160and His-taggedBovineTdT. SEQIDNo.7:(370aa) MetArgGlySerHisHisHisHisHisHisIleSer GlnTyrAlaCysGlnArgLysThrThrLeuAsnAsn TyrAsnHisIleAspAlaPheGluIleLeuAlaGlu AsnSerGluPheLysGluAsnGluValSerTyrVal ThrPheMetArgAlaAlaSerValLeuLysSerLeu ProPheThrIleIleSerMetLysAspThrPheThr GluGlyIleProCysLeuGlyAspLysValLysCys IleIleGluGluIleIleGluAspGlyGluSerSer GluValLysAlaValLeuAsnAspGluArgTyrGln SerPheLysLeuSerValPheGlyValGlyLeuLys ThrSerGluLysTrpPheArgMetGlyPheThrPhe ArgSerLeuSerLysIleMetSerAspLysThrLeu LysLysMetGlnLysAlaGlyPheLeuTyrTyrGlu AspLeuValSerCysValThrArgAlaGluAlaGlu AlaValGlyValLeuValLysGluAlaValTrpAla PheLeuProAspAlaPheValThrMetThrGlyGly PheArgArgGlyLysLysIleGlyHisAspValAsp PheLeuIleThrSerProGlySerAlaGluAspGlu GluGlnLeuLeuProLysValIleAsnLeuTrpGlu LysLysGlyLeuLeuLeuTyrTyrAspLeuValGlu SerThrPheGluLysPheLysPheThrLeuProSer ArgGlnValAspThrLeuAspHisPheGlnLysCys PheLeuIleLeuLysLeuHisHisGlnArgValAsp SerSerLysSerAsnGlnGlnGluGlyLysThrTrp LysAlaIleArgValAspLeuValMetCysProTyr GluAsnArgAlaPheAlaLeuLeuGlyTrpThrGly SerArgGlnPheGluArgAspIleArgArgTyrAla ThrHisGluArgLysMetMetLeuAspAsnHisAla LeuTyrAspLysThrLysArgValPheLeuLysAla GluSerGluGluGluIlePheAlaHisLeuGlyLeu AspTyrIleGluProTrpGluArgAsnAla

(34) TABLE-US-00008 TABLE8 NucleotideSequenceofat-160and His-taggedBovineTdT. SEQIDNo.8:(1121nt) atgagaggatcgcatcaccatcaccatcacatctcccagt acgcgtgtcaaagaaaaaccactttgaacaactataacca catattcacggatgcctttgagatactggctgaaaattct gagtttaaagaaaatgaagtctcttatgtgacatttatga gagcagcttctgtacttaaatctctgccattcacaatcat cagtatgaaggatacagaaggaattccctgcctgggggac aaggtgaagtgtatcatagaggaaattattgaagatggag aaagttctgaagttaaagctgtgttaaatgatgaacgata tcagtccttcaaactctttacttctgtttttggagtggga ctgaagacatctgagaaatggttcaggatggggttcagat ctctgagtaaaataatgtcagacaaaaccctgaaattcac aaaaatgcagaaagcaggatttctctattatgaagacctt gtcagctgcgtgaccagggccgaagcagaggcggttggcg tgctggttaaagaggctgtgtgggcatttctgccggatgc ctttgtcaccatgacaggaggattccgcaggggtaagaag attgggcatgatgtagattttttaattaccagcccaggat cagcagaggatgaagagcaacttttgcctaaagtgataaa cttatgggaaaaaaagggattacttttatattatgacctt gtggagtcaacatttgaaaagttcaagttgccaagcaggc aggtggatactttagatcattttcaaaaatgctttctgat tttaaaattgcaccatcagagagtagacagtagcaagtcc aaccagcaggaaggaaagacctggaaggccatccgtgtgg acctggttatgtgcccctacgagaaccgtgcctttgccct gctaggctggactggctcccggcagtttgagagagacatc cggcgctatgccacacacgagcggaagatgatgctggata accacgctttatatgacaagaccaagagggtatttctcaa agcggaaagtgaagaagaaatctttgcacatctgggattg gactacattgaaccatgggaaagaaatgcttaagcttgcg c

(35) TABLE-US-00009 TABLE9 AminoAcidSequenceofmurineTdT SEQIDNO.9:(510aa) MDPLQAVHLGPRKKRPRQLGTPVASTPYDIRFRDLVLFIL EKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNS GSDVLEWLQLQNIKASSELELLDISWLIECMGAGKPVEMM GRHQLVVNRNSSPSPVPGSQNVPAPAVKKISQYACQRRTT LNNYNQLFTDALDILAENDELRENEGSCLAFMRASSVLKS LPFPITSMKDTEGIPCLGDKVKSIIEGIIEDGESSEAKAV LNDERYKSFKLFTSVFGVGLKTAEKWFRMGFRTLSKIQSD KSLRFTQMQKAGFLYYEDLVSCVNRPEAEAVSMLVKEAVV TFLPDALVTMTGGFRRGKMTGHDVDFLITSPEATEDEEQQ LLHKVTDFWKQQGLLLYCDILESTFEKFKQPSRKVDALDH FQKCFLILKLDHGRVHSEKSGQQEGKGWKAIRVDLVMCPY DRRAFALLGWTGSRQFERDLRRYATHERKMMLDNHALYDR TKRVFLEAESEEEIFAHLGLDYIEPWERNA

(36) A variety of 3-O-modified dNTPs and NTPs may be used with the disclosed proteins for de novo synthesis. In some embodiments, the preferred removable 3-O-blocking group is a 3-O-amino, a 3-O-allyl or a 3-O-azidomethyl. In other embodiments, the removable 3-O-blocking moiety is selected from the group consisting of O-phenoxyacetyl; O-methoxyacetyl; O-acetyl; O-(p-toluene)-sulfonate; O-phosphate; O-nitrate; O-[4-methoxy]-tetrahydrothiopyranyl; O-tetrahydrothiopyranyl; O-[5-methyl]-tetrahydrofuranyl; O-[2-methyl,4-methoxy]-tetrahydropyranyl; O-[5-methyl]-tetrahydropyranyl; and O-tetrahydrothiofuranyl (see U.S. Pat. No. 8,133,669). In other embodiments the removable blocking moiety is selected from the group consisting of esters, ethers, carbonitriles, phosphates, carbonates, carbamates, hydroxylamine, borates, nitrates, sugars, phosphoramide, phosphoramidates, phenylsulfenates, sulfates, sulfones and amino acids (see Metzker M L et al. Nuc Acids Res. 1994; 22(20):4259-67, U.S. Pat. Nos. 5,763,594, 6,232,465, 7,414,116; and 7,279,563, all of which are incorporated by reference in their entireties).

Synthesis of Exemplary 3-O-Blocked dNTP Analogs

(37) FIG. 6 shows four exemplary 3-O-blocked dNTP analogs, namely 3-O-azidomethyl-dATP, 3-O-azidomethyl-dCTP, 3-O-azidomethyl-dGTP, and 3-O-azidomethyl-dTTP. The synthesis of each 3-O-azidomethyl analog is described below and detailed in FIGS. 7-10. The 3-O-blocked dNTP analogs can also be purchased from specialty suppliers, such as Azco Biotech, Oceanside, Calif. It is to be understood that corresponding 3-O-blocked ribonucleotides can be formed with similar synthetic methods to enable the creation of custom RNA oligos.

3-O-azidomethyl-dATP

(38) With reference to FIG. 7, a solution of N.sup.6-benzoyl-5-O-(tert-butyldimethylsilyl)-2-deoxyadenosine (3.0 g; 6.38 mmol) [CNH Technologies, Woburn, Mass.] in DMSO (12 ml), acetic acid (5.5 ml) and acetic anhydride (17.6 ml) was prepared. The mixture was stirred at room temperature for 48 h. Approximately 100 ml of a saturated NaHCO.sub.3 solution was added and the aqueous layer was extracted with CH.sub.2Cl.sub.2. The combined organic extract was washed with saturated NaHCO.sub.3 solution and dried over Na.sub.2SO.sub.4. The residue was purified by flash column chromatography (hexane/ethyl acetate, 1:1 to 1:4) to recover N.sup.6-Benzoyl-3-O-(methylthiomethyl)-5-O-(tert-butyldimethylsilyl)-2-deoxyadenosine (shown as compound 1 in FIG. 7) as a white powder (2.4 g; 71% yield). 400 mg of N.sup.6-Benzoyl-3-O-(methylthiomethyl)-5-O-(tert-butyldimethylsilyl)-2-deoxyadenosine was dissolved in dry CH.sub.2Cl.sub.2 (7 ml) under nitrogen to create a solution (0.76 mmol). Cyclohexene (400 l), and SO.sub.2Cl.sub.2 (155 l; 1.91 mmol, redistilled) were then added. The reaction mixture was stirred at 0 C. for 2 h. The solvent was then removed under reduced pressure and then under a high-vacuum pump for 10 min. The resulting residue was dissolved in dry DMF (5 ml) and reacted with NaN.sub.3 (400 mg; 6.6 mmol) at room temperature for 3 h. The reaction mixture was dispersed in distilled water (50 ml) and extracted with CH.sub.2Cl.sub.2. The combined organic layer was dried over Na.sub.2SO.sub.4 and concentrated under reduced pressure. The residue was dissolved in MeOH (5 ml) and stirred with NH.sub.4F (300 mg; 8.1 mmol) at room temperature for 24 h. The solvent was then removed under reduced pressure. The reaction mixture was concentrated under reduced pressure and partitioned between water and CH.sub.2Cl.sub.2. The organic layer was separated and dried over Na.sub.2SO.sub.4. After concentration, the crude product was purified by flash column chromatography (ethyl acetate/methanol) to produce N.sup.6-Benzoyl-3-O-(azidomethyl)-2-deoxyadenosine (compound 2; FIG. 7) as a white powder (150 mg; 48% yield). N.sup.6-Benzoyl-3-O-(azidomethyl)-2-deoxyadenosine (123 mg; 0.3 mmol) and a proton sponge (75.8 mg; 0.35 mmol) were then dried in a vacuum desiccator over P.sub.2O.sub.5 overnight before dissolving in trimethyl phosphate (600 l). Next freshly distilled POCl.sub.3 (40 l; 0.35 mmol) was added dropwise at 0 C. and the mixture was stirred at 0 C. for 2 h. Subsequently, a mixture of tributylammonium pyrophosphate (552 mg) and tributylamine (0.55 ml; 2.31 mmol) in anhydrous DMF (2.33 ml) was added at room temperature and stirred for 30 min. Triethyl ammonium bicarbonate solution (TEAB) (0.1 M; pH 8.0; 15 ml) was then added, and the mixture was stirred for 1 hour at room temperature. Subsequently, concentrated NH.sub.4OH (15 ml) was added and stirred overnight at room temperature. The resulting mixture was concentrated under vacuum and the residue was diluted with 5 ml of water. The crude mixture was then purified with anion exchange chromatography on DEAE-Sephadex A-25 at 4 C. using a gradient of TEAB (pH 8.0; 0.1-1.0 M). The crude product was purified with reverse-phase HPLC to produce 3-O-azidomethyl-dATP (FIG. 7, compound 3), a nucleotide analog to be used for later synthesis.

3-O-azidomethyl-dTTP

(39) Acetic acid (4.8 ml) and acetic anhydride (15.4 ml) were added to a stirred solution of 5-O-(tertbutyldimethylsilyl)thymidine (2.0 g; 5.6 mmol) [CNH Technologies, Woburn, Mass.] in DMSO. The reaction mixture was stirred at room temperature for 48 h. A saturated NaHCO.sub.3 solution (100 ml) was added, and the aqueous layer was extracted with ethyl acetate (3100 ml). The combined organic extract was washed with a saturated solution of NaHCO.sub.3 and dried over Na.sub.2SO.sub.4. After concentration, the crude product was purified by flash column chromatography (hexane/ethyl acetate) to produce 3-O-(Methylthiomethyl)-5-O-(tert-butyldimethylsilyl)thymidine (FIG. 8; Compound 4) as a white powder (1.75 g; 75% yield). Approximately 1 gram of 3-O-(Methylthiomethyl)-5-O-(tert-butyldimethylsilyl)thymidine was then dissolved in dry CH.sub.2Cl.sub.2 (10 ml) under nitrogen. To this mixture cyclohexene (1.33 ml) and SO.sub.2Cl.sub.2 (284 l; 3.5 mmol, redistilled) were added. The resulting mixture was then stirred at 0 C. for 1.5 h. The solvent was then removed under reduced pressure and then under high vacuum for 10 min. The residue was dissolved in dry DMF (5 ml) and reacted with NaN.sub.3 (926 mg; 15.4 mmol) at room temperature for 3 h. That reaction mixture was next dispersed in distilled water (50 ml) and extracted with CH.sub.2Cl.sub.2 (350 ml). The combined organic extract was dried over Na.sub.2SO.sub.4 and concentrated under reduced pressure. The residue was dissolved in MeOH (5 ml) and reacted with NH.sub.4F (600 mg; 16.2 mmol) at room temperature for 24 h. The reaction mixture was concentrated under reduced pressure and partitioned between water and CH.sub.2Cl.sub.2. The organic layer was then separated and dried over Na.sub.2SO.sub.4. After concentration, the residue was purified by flash column chromatography (hexane/ethyl acetate) to produce 3-O-(azidomethyl)thymidine (FIG. 8, Compound 5) as a white powder (550 mg; 71% yield). Next, the 3-O-(azidomethyl)thymidine and a proton sponge (0.35 mmol) were dried in a vacuum desiccator over P.sub.2O.sub.5 overnight before dissolving in trimethyl phosphate (600 l). Next, freshly distilled POCl.sub.3 (40 l; 0.35 mmol) was added dropwise at 0 C. and the mixture was stirred at 0 C. for 2 h. Subsequently, a mixture of tributylammonium pyrophosphate (552 mg) and tributylamine (0.55 ml; 2.31 mmol) in anhydrous DMF (2.33 ml) was added at room temperature and stirred for 30 min. Triethyl ammonium bicarbonate solution (TEAB) (0.1 M; pH 8.0; 15 ml) was then added, and the mixture was stirred for 1 hour at room temperature. Subsequently, concentrated NH.sub.4OH (15 ml) was added and stirred overnight at room temperature. The resulting mixture was concentrated under vacuum and the residue was diluted with 5 ml of water. The crude mixture was then purified with anion exchange chromatography on DEAE-Sephadex A-25 at 4 C. using a gradient of TEAB (pH 8.0; 0.1-1.0 M). The crude product was purified with reverse-phase HPLC to produce 3-O-azidomethyl-dTTP (FIG. 8, compound 6), a nucleotide analog to be used for later synthesis.

3-O-azidomethyl-dCTP

(40) Three and a half grams of N.sup.4-benzoyl-5-O-(tert-butyldimethylsilyl)-2-deoxycytidine [CNH Technologies, Woburn, Mass.] was added to 14.7 ml of DMSO to produce a 7.65 mmol solution. To this solution, acetic acid (6.7 ml) and acetic anhydride (21.6 ml) were added, and the reaction mixture was stirred at room temperature for 48 h. A saturated NaHCO.sub.3 solution (100 ml) was then added and the aqueous layer was extracted with CH.sub.2Cl.sub.2 (3100 ml). The combined organic extract was washed with a saturated solution of NaHCO.sub.3 and then dried over Na.sub.2SO.sub.4. After concentration, the crude product was purified by flash column chromatography (ethyl acetate/hexane) to produce N.sup.4-Benzoyl-3-O-(methylthiomethyl)-5-O-(tert-butyldimethylsilyl)-2-deoxycytidine (FIG. 9; compound 7) as a white powder (2.9 g; 73% yield). In 8 ml of CH.sub.2Cl.sub.2 N.sup.4-Benzoyl-3-O-(methylthiomethyl)-5-O-(tert-butyldimethylsilyl)-2-deoxycytidine (558 mg; 1.04 mmol) was dissolved and then cyclohexene (560 l) and SO.sub.2Cl.sub.2 (220 l; 2.7 mmol) were added. The reaction mixture was stirred at 0 C. for 1 h. The volatiles were then removed with reduced pressure. The remaining residue was dissolved in dry DMF (5 ml) and reacted with NaN.sub.3 (400 mg; 6.6 mmol) at room temperature for 2 h. The reaction mixture was dispersed in distilled water (50 ml) and extracted with CH.sub.2Cl.sub.2 (350 ml). The combined organic extract was dried over Na.sub.2SO.sub.4 and concentrated under reduced pressure. The residue was dissolved in MeOH (5 ml) and reacted with NH.sub.4F (600 mg; 16.2 mmol) at room temperature for 24 h. The solvent was removed under reduced pressure. The resulting residue was suspended in water (50 ml) and extracted with CH.sub.2Cl.sub.2 (350 ml). The combined organic extract was dried over Na.sub.2SO.sub.4 and concentrated under reduced pressure. The crude product was purified by flash column chromatography (hexane/ethyl acetate) to produce N.sup.4-Benzoyl-3-O-(azidomethyl)-2-deoxycytidine (FIG. 9, compound 8) as a white powder (200 mg; 50% yield). Next, the N.sup.4-Benzoyl-3-O-(azidomethyl)-2-deoxycytidine and a proton sponge (0.35 mmol) were dried in a vacuum desiccator over P.sub.2O.sub.5 overnight before dissolving in trimethyl phosphate (600 l). Then freshly distilled POCl.sub.3 (40 l; 0.35 mmol) was added dropwise at 0 C. and the mixture was stirred at 0 C. for 2 h. Subsequently, a mixture of tributylammonium pyrophosphate (552 mg) and tributylamine (0.55 ml; 2.31 mmol) in anhydrous DMF (2.33 ml) was added at room temperature and stirred for 30 min. Triethyl ammonium bicarbonate solution (TEAB) (0.1 M; pH 8.0; 15 ml) was then added, and the mixture was stirred for 1 hour at room temperature. Subsequently, concentrated NH.sub.4OH (15 ml) was added and stirred overnight at room temperature. The resulting mixture was concentrated under vacuum and the residue was diluted with 5 ml of water. The crude mixture was then purified with anion exchange chromatography on DEAE-Sephadex A-25 at 4 C. using a gradient of TEAB (pH 8.0; 0.1-1.0 M). The crude product was purified with reverse-phase HPLC to produce 3-O-azidomethyl-dCTP (FIG. 9, compound 9), a nucleotide analog to be used for later synthesis.

3-O-azidomethyl-dGTP

(41) To a stirred solution of N.sup.2-isobutyryl-5-O-(tert-butyldimethylsilyl)-2-deoxyguanosine (5 g; 11.0 mmol) [CNH Technologies, Woburn, Mass.] in dry DMSO (21 ml), acetic acid (10 ml) and acetic anhydride (32 ml) were added. The reaction mixture was stirred at room temperature for 48 h. A saturated NaHCO.sub.3 solution (100 ml) was added and the aqueous layer was extracted with ethyl acetate (3100 ml). The combined organic extract was washed with a saturated NaHCO.sub.3 solution and dried over Na.sub.2SO.sub.4. After concentration, the crude product was purified by flash column chromatography (CH.sub.2Cl.sub.2/MeOH) to produce N.sup.2-Isobutyryl-3-O-(methylthiomethyl)-5-O-(tert-butyldimethylsilyl)-2-deoxyguanosine (FIG. 10, compound 10) as a white powder (3.9 g; 69% yield). One gram of N.sup.2-Isobutyryl-3-O-(methylthiomethyl)-5-O-(tert-butyldimethylsilyl)-2-deoxyguanosine was subsequently added to dry pyridine (22 ml; 2.0 mmol) along with diphenylcarbamoyl chloride (677 mg; 2.92 mmol) and DIEA (N,N-diisopropylethylamine; SIGMA) (1.02 ml; 5.9 mmol). The reaction mixture was stirred under nitrogen atmosphere at room temperature for 3 h. The solvent was removed under high vacuum. The crude product was purified by flash column chromatography (ethyl acetate/hexane) to produce N.sup.2-Isobutyryl-O.sup.6-(diphenylcarbamoyl)-3-O-(methylthiomethyl)-5-O-(tert-butyldimethylsilyl)-2-deoxyguanosine (FIG. 10, compound 11), which appeared as a yellowish powder (1.09 g; 80% yield). N.sup.2Isobutyryl-O.sup.6-(diphenylcarbamoyl)-3-O-(methylthiomethyl)-5-O-(tert-butyldimethylsilyl)-2-deoxyguanosine was then dissolved in dry CH.sub.2Cl.sub.2 (1.1 mmol) and stirred under nitrogen atmosphere at 0 C. for 1.5 h. The solvent was removed under reduced pressure and then under high vacuum for 10 min. The resulting residue was dissolved in dry DMF (5 ml) and reacted with NaN.sub.3 (600 mg; 10 mmol) at room temperature for 3 h. The reaction mixture was then dispersed in distilled water (50 ml) and extracted with CH.sub.2Cl.sub.2 (350 ml). The combined organic extract was dried over Na.sub.2SO.sub.4 and concentrated under reduced pressure. The resultant residue was dissolved in MeOH (5 ml) and reacted with NH.sub.4F (500 mg; 13.5 mmol) at room temperature for 24 h. The solvent was removed under reduced pressure. The residue was suspended in water (50 ml) and extracted with CH.sub.2Cl.sub.2 (350 ml). The combined organic extract was dried over Na.sub.2SO.sub.4 and concentrated under reduced pressure. The crude product was purified by flash column chromatography (hexane/ethyl acetate) to produce N.sup.2-Isobutyryl-O.sup.6-(diphenylcarbamoyl)-3-O-azidomethyl-2-deoxyguanosine (FIG. 10, compound 12) as a white powder (230 mg; 36% yield). Finally, the N.sup.2-Isobutyryl-O.sup.6-(diphenylcarbamoyl)-3-O-azidomethyl-2-deoxyguanosine and a proton sponge (0.35 mmol) were dried in a vacuum desiccator over P.sub.2O.sub.5 overnight before dissolving in trimethyl phosphate (600 l). Then freshly distilled POCl.sub.3 (40 l; 0.35 mmol) was added dropwise at 0 C. and the mixture was stirred at 0 C. for 2 h. Subsequently, a mixture of tributylammonium pyrophosphate (552 mg) and tributylamine (0.55 ml; 2.31 mmol) in anhydrous DMF (2.33 ml) was added at room temperature and stirred for 30 min. Triethyl ammonium bicarbonate solution (TEAB) (0.1 M; pH 8.0; 15 ml) was then added, and the mixture was stirred for 1 hour at room temperature. Subsequently, concentrated NH.sub.4OH (15 ml) was added and stirred overnight at room temperature. The resulting mixture was concentrated under vacuum and the residue was diluted with 5 ml of water. The crude mixture was then purified with anion exchange chromatography on DEAE-Sephadex A-25 at 4 C. using a gradient of TEAB (pH 8.0; 0.1-1.0 M). The crude product was purified with reverse-phase HPLC to produce 3-O-azidomethyl-dGTP (FIG. 10, compound 13), a nucleotide analog to be used for later synthesis.

(42) As described with respect to FIG. 2, once a 3-O-blocked dNTP or 3-O-blocked rNTP is added, it will be necessary to remove the blocking group so that additional dNTPs or rNTPs can be added. In some embodiments, the 3-O-blocking group can be removed with a palladium catalyst in neutral aqueous solution at elevated temperature hydrochloric acid to pH 2, a reducing agent such as mercaptoethanol, or by the addition of tris-(2-carboxyethyl)phosphine. See, e.g., U.S. Pat. No. 6,664,079; Meng, et al. J. Org. Chem., 2006, 71(81):3248-52; Bi et al., J. Amer. Chem. Soc. 2006; 2542-2543, U.S. Pat. No. 7,279,563, and U.S. Pat. No. 7,414,116, all of which are incorporated herein by reference in their entireties. In other embodiments, the 3-substitution group may be removed by UV irradiation (see, e.g., WO 92/10587, incorporated by reference herein in its entirety). In some embodiments, the removal of the 3-O-blocking group does not include chemical cleavage but uses a cleaving enzyme such as alkaline phosphatase.

EXAMPLES

(43) Protein Modifications.

(44) As a starting point for optimizing TdT activity with dNTP analogs with 3-O-blocking groups, we make 400 (20.sup.2) point mutants at Arg336 and/or Arg454 residues to assess the impact on utilization of modified dNTP analogs such as 3-O-azidomethyl dNTPs as substrates. Protein modifications at these sites act as positive controls for assay development and attempts to increase the activity of TdT with the 3-O-blocking groups modified dNTP analogs. Subsequently, following these point mutations with saturation mutagenesis of the surrounding regions, we identify sequences that may compensate for the potential reduction in activity due to changes at Arg336 or Arg454, as discussed in the text above.

(45) We also develop 3-O-azidomethyl-dNTPs as suitable building blocks for enzyme mediated solid support bound oligodeoxynucleotides synthesis by producing and screening a library of 1000 modified TdT proteins which accept a 3-O-blocked dNTP as a substrate. In some embodiments, we use PA gel shift assays to screen the modified protein space of hundreds to thousands of TdT sequence variants to verify addition of 3-O-blocked dNTPs (see Bussow et al., Genomics, 2000:65(1):1-8, incorporated herein by reference in its entirety). In other embodiments, we use MALDI-TOF as a high throughput alternative to PA gel shift assays. Automated MALDI-TOF instruments are capable of analyzing hundreds of samples per hour, and can readily detect and differentiate the anticipated mass gain of 304.26-329.27 Da from one of the four nucleotide terminators. MALDI-TOF analysis of oligonucleotides is typically performed in negative-ion mode, to allow for higher sensitivity, higher resolution, and lower fragmentation compared to positive-ion mode. For validation of MALDI-TOF, primer extension is monitored by polyacrylamide (PA) gel shift assays, which are used to quantify the rate of conversion of a n-mer primer to a n+1-mer (see, e.g., Leconte et al., Angew Chem Int Ed Eng, 2010; 49(34):5921-24).

(46) Using commercially-available gene synthesis methods (i.e., IDT gBlocks), we also create single- and double-site mutations at Arg336 and Arg454 to allow for accommodation of 3-O-blocked dNTPs at the active site of TdT. This minimal library of synthetic TdT genes are inserted into a suitable N-terminal His tagged expression vector, like pRSETA or pET19b (see Kuan et al., Biochem. Insights, 2010; 3:41-6, incorporated herein by reference in its entirety), via restriction site or In-Fusion assembly methods (see Sleight et al., Nucleic Acids Res., 2010; 38(8)2624-36, incorporated herein by reference in its entirety). These methods allow us to transform the E. coli host strain DH5a to express the desired proteins. The resulting plasmid library is amplified by DH5a culture in LB media with ampicillin and extracted for subsequent transformation in the E. coli BL21(DE3) expression strain. Each BL21 clone is assigned to one well of a 96-well plate. Sequence identity of the modified TdT gene is verified with standard DNA sequencing. After induction of TdT expression, cells are harvested and lysed. His-tagged TdT are captured from the lysate using a His tag purification resin. The captured protein is eluted from the resin with imidazole and dialyzed into an extension reaction buffer for activity screens.

(47) Computer Modeling.

(48) In order to guide the optimum alteration of a TdT enzyme, we model and design TdT mutant libraries that are used to predict proteins that can bind modified dNTP substrates in a catalytically-productive mode. In particular, we use the Enzyme Design technology within the Rosetta Molecular Modeling Suite (Rosetta Commons, Seattle, Wash.) to model TdT and 3-O-blocked dNTP analogs. Initially, functional constraints in the form of distance, angles, and dihedrals between the substrate and enzyme are defined in order to enforce a catalytically productive interface during simulations. Design simulations that utilize these functional constraints are then run, during which the combinatorial sequence space of the active site are heuristically sampled, and predicted energies for millions of putative active site sequences are calculated. Additionally, amino acids at the active site interface, with the exception of the catalytic residues, are allowed to change to any of the twenty amino acids; while amino acids outside of the active site interface are kept fixed. At the end of the design run the three-dimensional coordinates of the predicted lowest energy structure are recorded. [As this is a simulated annealing simulation it is generally necessary to run roughly 1000 design trajectories. Between zero and twenty mutations predicted during a design simulation are generally observed.] The lowest 10% of designs based on energy are selected, and the observed amino acids at each designable position are used to construct a combinatorial library of 1000 TdT variants. If the 10% cutoff leads to a larger combinatorial space than 1000, a more stringent energy cutoff is used.

(49) After computational selection, the identified TdT genes are subjected to extensive mutagenesis by ordering gBlock fragments with up to 6 amino acid modifications on either side of Arg336 and Arg454 residues. In the case of libraries that require additional sites in the sequence to be modified beyond +/6 of Arg336 and/or Arg454, additional gBlocks encompassing those regions are used for iterative mutagenesis. Transfected E. coli cells are grown in 2 ml 96-well plates, pelleted and lysed in the same plates. Lysate are transferred to 96-well filter plates containing His tag purification resin, washed and eluted from the resin using imidazole.

(50) Eluent containing partially purified recombinant enzyme are dialyzed in-plate into an extension assay reaction buffer for activity screening in 96-well plates. The extension assays are then initiated with the addition of a 20-mer primer and 1000 uM concentration of each of four 3-O-azidomethyl-dNTP terminators. After incubation for 12 hrs at 37 C., the reactions are terminated by heating to 70 C. for 10 min. 5 ul of each reaction is transferred to a subsequent 96-well plate and mixed 1:1 with the MALDI-TOF matrix 3-Hydroxypicolinic acid (3-HPA) in acetonitrile with ammonium citrate. 1-2 ul aliquots are spotted onto MALDI plates, dried under vacuum, and subjected to mass analysis of the extension products in negative ion reflector mode on a Bruker Biflex IV MALDI-TOF MS (Bruker Corp., Billerica, Mass.). Screening takes 1 hour per MALDI plate enabling a search of a large amount of modified protein space. MALDI-MS analysis is used to detect the molecular weight gain (304.26-329.27) due to the addition of a single nucleotide terminator. To increase sensitivity, MALDI matrices are varied by using 2,3,4-Trihydroxyacetophene (2,3,4-THAP) in acetonitrile with ammonium citrate, or -Cyano-4-hydroxycinnamic acid (CHCA) in acetonitrile and trifluoroacetic acid. ZipTips with C18 resin may also be used to desalt and concentrate the oligonucleotide product. An oligonucleotide standard is used for reference during instrument calibration.

(51) De Novo Synthesis.

(52) Once screening is completed, the engineered TdT developed above and two different 3-OR reversible terminator dNTP analogs (i.e., dATP & dCTP), are used in a prototype process using an initiator attached to a solid support with the manual addition of extension reaction reagents and wash buffers. 5-biotin-dT10 is immobilized on commercially available streptavidin (SA)-coated magnetic beads and used as a support-bound oligonucleotide initiator using standard protocols. The 3-OR reversible terminator dNTP analogs, e.g., 3-O-azidomethyl-dNTP analogs, are used at high concentrations (approx. 1 mM) to insure quantitative TdT-mediated incorporations in 1-5 min reaction times. After removal of the unreacted dNTPs with extensive washing, the 3-OR reversible terminator is removed. For example, 3-O-azidomethyl block groups are removed by treatment with 0.5M TCEP (pH 10) at 60 C. for 5. After several rounds of enzymatic incorporation of the nucleotide analogs, the resulting oligonucleotide are analyzed via MALDI-TOF. [Previous studies have shown that biotinylated substrates immobilized on magnetic streptavidin beads can be analyzed directly by MALDI-TOF, without removal from the bead surface (see Zhou, Anal Biochem, 2011; 408:5-11, incorporated by reference herein in its entirety).] The resulting analysis is used to estimate the completeness of utilization of the initiating primers, homopolymer formation due to failure of the terminating species, and the extent of n1 formation indicative of failure to extend, or failure to deblock the 3OR group to completion.

(53) After proof of principle with a limited set of 3-OR reversible terminator dNTP analogs, complete de novo oligonucleotide synthesis will be achieved with the newly engineered enzymes by using repeated bind-wash-unblock steps as described in FIG. 2 and the accompanying text.

INCORPORATION BY REFERENCE

(54) References and citations to other documents, such as patents, patent applications, patent publications, journals, books, papers, web contents, have been made throughout this disclosure. All such documents are hereby incorporated herein by reference in their entirety for all purposes.

EQUIVALENTS

(55) Various modifications of the invention and many further embodiments thereof, in addition to those shown and described herein, will become apparent to those skilled in the art from the full contents of this document, including references to the scientific and patent literature cited herein. The subject matter herein contains important information, exemplification and guidance that can be adapted to the practice of this invention in its various embodiments and equivalents thereof.