METHOD AND KIT FOR DETECTING HUMAN a-DEFENSIN HD5, AND ANTIBODIES USED IN SAID METHOD AND KIT
20220357317 · 2022-11-10
Assignee
Inventors
Cpc classification
G01N33/543
PHYSICS
C07K2317/51
CHEMISTRY; METALLURGY
C12N5/163
CHEMISTRY; METALLURGY
International classification
Abstract
The purpose of the present invention is to provide a method for detecting, in a selective and simple manner, an oxidized form of HD5 which is human α-defensin, that is, HD5 having intramolecular disulfide bonds that function beneficially in the human body.
[Solution] The present invention relates to: two kinds of novel monoclonal antibodies that contain amino acid sequences of SEQ ID NO: 1-6 or 7-12 as a CDR and that specifically bind to human α-defensin HD5 having intramolecular disulfide bonds; an immunological detection method using the antibodies; and a kit containing the antibodies.
Claims
1. A method for immunologically detecting a human α-defensin HD5 with intramolecular disulfide bonds, the method comprising detecting the human α-defensin HD5 with the intramolecular disulfide bonds in a specimen by a sandwich method with use of a monoclonal antibody or an antigen binding fragment of the monoclonal antibody according to the following a) and a monoclonal antibody or an antigen binding fragment of the monoclonal antibody according to the following b): a) a monoclonal antibody or an antigen binding fragment of the monoclonal antibody that specifically binds to the human α-defensin HD5 with the intramolecular disulfide bonds and comprises: a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 1 as CDR1, the amino acid sequence of SEQ ID NO: 2 as CDR2, and the amino acid sequence of SEQ ID NO: 3 as CDR3; and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 4 as CDR1, the amino acid sequence of SEQ ID NO: 5 as CDR2, and the amino acid sequence of SEQ ID NO: 6 as CDR3; and b) a monoclonal antibody or an antigen binding fragment of the monoclonal antibody that specifically binds to the human α-defensin HD5 with the intramolecular disulfide bonds and comprises: a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 7 as CDR1, the amino acid sequence of SEQ ID NO: 8 as CDR2, and the amino acid sequence of SEQ ID NO: 9 as CDR3; and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 10 as CDR1, the amino acid sequence of SEQ ID NO: 11 as CDR2, and the amino acid sequence of SEQ ID NO: 12 as CDR3.
2. The method according to claim 1, wherein the monoclonal antibody or the antigen binding fragment of the monoclonal antibody according to a) comprises: a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 13 or an amino acid sequence having 90% or more sequence identity to the amino acid sequence of SEQ ID NO: 13; and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 14 or an amino acid sequence having 90% or more sequence identity to the amino acid sequence of SEQ ID NO: 14, and wherein the monoclonal antibody or the antigen binding fragment of the monoclonal antibody according to b) comprises: a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 15 or an amino acid sequence having 90% or more sequence identity to the amino acid sequence of SEQ ID NO: 15; and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 16 or an amino acid sequence having 90% or more sequence identity to the amino acid sequence of SEQ ID NO: 16.
3. The method according to claim 1, wherein the monoclonal antibody or the antigen binding fragment of the monoclonal antibody according to a) is used as a capture antibody, and the monoclonal antibody or the antigen binding fragment of the monoclonal antibody according to b) is used as a detection antibody.
4. The method according to claim 1, comprising: a step of adding the specimen to a support on which the monoclonal antibody or the antigen binding fragment of the monoclonal antibody according to a) is immobilized; a step of adding the labeled monoclonal antibody or the antigen binding fragment of the monoclonal antibody according to b) to the support; and a step of detecting the monoclonal antibody or the antigen binding fragment of the monoclonal antibody according to b) that binds to the human α-defensin HD5 with the intramolecular disulfide bonds.
5. The method according to claim 1, wherein the specimen is an extract with an aqueous medium from a freeze-dried and crushed human feces.
6. A kit for immunologically detecting a human α-defensin HD5 with intramolecular disulfide bonds by a sandwich method, the kit comprising a monoclonal antibody or an antigen binding fragment of the monoclonal antibody according to the following a) and a monoclonal antibody or an antigen binding fragment of the monoclonal antibody according to the following b): a) a monoclonal antibody or an antigen binding fragment of the monoclonal antibody that specifically binds to the human α-defensin HD5 with the intramolecular disulfide bonds and comprises: a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 1 as CDR1, the amino acid sequence of SEQ ID NO: 2 as CDR2, and the amino acid sequence of SEQ ID NO: 3 as CDR3; and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 4 as CDR1, the amino acid sequence of SEQ ID NO: 5 as CDR2, and the amino acid sequence of SEQ ID NO: 6 as CDR3; and b) a monoclonal antibody or an antigen binding fragment of the monoclonal antibody that specifically binds to the human α-defensin HD5 with the intramolecular disulfide bonds and comprises: a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 7 as CDR1, the amino acid sequence of SEQ ID NO: 8 as CDR2, and the amino acid sequence of SEQ ID NO: 9 as CDR3; and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 10 as CDR1, the amino acid sequence of SEQ ID NO: 11 as CDR2, and the amino acid sequence of SEQ ID NO: 12 as CDR3.
7. The kit according to claim 6, wherein the monoclonal antibody or the antigen binding fragment of the monoclonal antibody according to a) is used as a capture antibody, and the monoclonal antibody or the antigen binding fragment of the monoclonal antibody according to b) is used as a detection antibody.
8. The kit according to claim 7, wherein the monoclonal antibody or the antigen binding fragment of the monoclonal antibody according to a) is immobilized on a support, and the monoclonal antibody or the antigen binding fragment of the monoclonal antibody according to b) is labeled.
9. A monoclonal antibody or an antigen binding fragment of the monoclonal antibody that specifically binds to a human α-defensin HD5 with intramolecular disulfide bonds and comprises: a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 1 as CDR1, the amino acid sequence of SEQ ID NO: 2 as CDR2, and the amino acid sequence of SEQ ID NO: 3 as CDR3; and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 4 as CDR1, the amino acid sequence of SEQ ID NO: 5 as CDR2, and the amino acid sequence of SEQ ID NO: 6 as CDR3.
10. A monoclonal antibody or an antigen binding fragment of the monoclonal antibody that specifically binds to a human α-defensin HD5 with intramolecular disulfide bonds and comprises: a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 7 as CDR1, the amino acid sequence of SEQ ID NO: 8 as CDR2, and the amino acid sequence of SEQ ID NO: 9 as CDR3; and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 10 as CDR1, the amino acid sequence of SEQ ID NO: 11 as CDR2, and the amino acid sequence of SEQ ID NO: 12 as CDR3.
11-13. (canceled)
Description
BRIEF DESCRIPTION OF DRAWINGS
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
DESCRIPTION OF EMBODIMENTS
[0043] A first aspect of the present invention relates to a method for immunologically detecting ox-HD5, comprising detecting ox-HD5 in a specimen by a sandwich method with use of a monoclonal antibody or an antigen binding fragment thereof according to the following a) and a monoclonal antibody or an antigen binding fragment thereof according to the following b):
[0044] a) a monoclonal antibody or an antigen binding fragment thereof that specifically binds to ox-HD5 and comprises: a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 1 as CDR1, the amino acid sequence of SEQ ID NO: 2 as CDR2, and the amino acid sequence of SEQ ID NO: 3 as CDR3; and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 4 as CDR1, the amino acid sequence of SEQ ID NO: 5 as CDR2, and the amino acid sequence of SEQ ID NO: 6 as CDR3; and
[0045] b) a monoclonal antibody or an antigen binding fragment thereof that specifically binds to ox-HD5 and comprises: a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 7 as CDR1, the amino acid sequence of SEQ ID NO: 8 as CDR2, and the amino acid sequence of SEQ ID NO: 9 as CDR3; and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 10 as CDR1, the amino acid sequence of SEQ ID NO: 11 as CDR2, and the amino acid sequence of SEQ ID NO: 12 as CDR3.
[0046] The present invention also provides as other aspects: a kit for immunologically detecting ox-HD5 with intramolecular disulfide bonds by the sandwich method, the kit comprising the monoclonal antibody or the antigen binding fragment thereof according to a) described above and the monoclonal antibody or the antigen binding fragment thereof according to b) described above; the monoclonal antibody or the antigen binding fragment thereof according to a) described above; and the monoclonal antibody or the antigen binding fragment thereof according to b) described above.
Human α-Defensin HD5
[0047] Human α-defensin has two isoforms, HD5 and HD6. HD5 (DEFA5, also referred to as defensin α5) is translated as a full-length prepeptide pre-HD5 (SEQ ID NO: 17) with 94 amino acid residues including a signal peptide at positions 1 to 19 in its N-terminus side. The signal peptide is cleaved out from the pre-HD5 to generate propeptide pro-HD5 (75 amino acids), and then 43 amino acid residues are cleaved out in the N-terminus side to generate a mature form of HD5 (32 amino acids, SEQ ID NO: 18). The amino acid sequence of the mature form of HD5 includes six cysteine residues that form three intramolecular disulfide bonds to generate ox-HD5.
Anti-ox-HD5 Monoclonal Antibody
[0048] Anti-ox-HD5 monoclonal antibodies according to the above a) and b) used in the present invention refers to an antibody specifically binding to ox-HD5, that is, HD5 with three intramolecular disulfide bonds. The term, specifically binding to ox-HD5, means binding preferentially to ox-HD5 over untargeted proteins such as a reduced form of HD5 without any intramolecular disulfide bond, for example, and does not mean never binding to untargeted proteins. The antibody specifically binding to ox-HD5 is also referred to as the antibody having high binding affinity to ox-HD5. The antibody can bind to ox-HD5 with at least twice, preferably at least 10 times, more preferably at least 20 times, most preferably at least 100 times higher affinity than the affinity with which the antibody binds to untargeted proteins. When an antibody can detect the presence of ox-HD5 without giving undesirable results such as false positive and false negative results typically, the antibody is considered to be the antibody specifically binding to ox-HD5.
[0049] In the present invention, the anti-ox-HD5 monoclonal antibody may belong to any class of immunoglobulin molecules (for example, IgG, IgE, IgM, IgD or IgA) and any subclass thereof, but is preferably IgG. The monoclonal antibody may originate from any one of species including mouse, rat, shark, rabbit, pig, hamster, camel, llama, goat and human, for example, and may be a chimeric antibody or a humanized antibody.
[0050] The heavy chain variable region of the anti-ox-HD5 monoclonal antibody according to a) has 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, or 99% or more sequence identity to the amino acid sequence of SEQ ID NO: 13, and preferably has the same amino acid sequence as the amino acid sequence of SEQ ID NO: 13.
[0051] The light chain variable region of the anti-ox-HD5 monoclonal antibody according to a) has 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, or 99% or more sequence identity to the amino acid sequence of SEQ ID NO: 14, and preferably has the same amino acid sequence as the amino acid sequence of SEQ ID NO: 14.
[0052] The heavy chain variable region of the anti-ox-HD5 monoclonal antibody according to b) has 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, or 99% or more sequence identity to the amino acid sequence of SEQ ID NO: 15, and preferably has the same amino acid sequence as the amino acid sequence of SEQ ID NO: 15.
[0053] The light chain variable region of the anti-ox-HD5 monoclonal antibody according to b) has 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, or 99% or more sequence identity to the amino acid sequence of SEQ ID NO: 16, and preferably has the same amino acid sequence as the amino acid sequence of SEQ ID NO: 16.
[0054] The identity of amino acid sequence is represented as a ratio of the number of identical amino acid residues to an alignment length, and the two compared amino acid sequences are aligned in such a way as to maximize the number of identical amino acid residues in accordance with conventional methods. The sequence identity can be determined by use of a sequence comparison program such as BLAST, for example, in accordance with any method well-known to a person skilled in the art.
[0055] The heavy chain variable regions and the light chain variable regions of the anti-ox-HD5 monoclonal antibodies according to a) and b) may contain deletion, substitution or addition of 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, 2 or less, or one amino acid(s) in framework regions, namely amino acid sequences other than CDR. Here, the substitution of amino acid is preferably conservative substitution. The term “conservative substitution” refers to substituting a certain amino acid in the protein with another amino acid with similar properties (for example, charge, side chain size, hydrophobicity/hydrophilicity, backbone structure, rigidity and the like) without any influence on desired properties of the protein such as biological activity, affinity and/or specificity to its antigen. Examples of the conservative substitution include a substitution between amino acids such as glycine (Gly)—proline (Pro), glycine—alanine (Ala) or valine (Val), leucine (Leu)—isoleucine (Ile), glutamic acid (Glu)—glutamine (Gln), aspartic acid (Asp)—asparagine (Asn), cysteine (Cys)—threonine (Thr), threonine—serine (Ser) or alanine, and lysine (Lys)—arginine (Arg).
[0056] In the present invention, the antigen binding fragment is defined as a partial fragment of an antibody that retains the capability of specifically binding to the antigen. Examples of antigen binding fragment are not limited, but include Fab (fragment of antigen binding), Fab′, F(ab′)2, a single chain antibody (single chain Fv), a disulfide stabilized antibody (disulfide stabilized Fv) and a peptide containing CDR.
[0057] The anti-ox-HD5 monoclonal antibody and the antigen binding fragment thereof used in the present invention can be prepared by methods well-known to a person skilled in the art. For example, the anti-ox-HD5 monoclonal antibody can be prepared by immunizing a suitable animal with ox-HD5 as an antigen, then fusing B cells of the animal to myeloma cells to obtain a hybridoma, and then culturing the same. For example, see Meyaard et al. (1997) Immunity 7:283-290; Wright et al. (2000) Immunity 13:233-242; Kaithamana et al. (1999) J. Immunol. 163:5157-5164, and so on, for a hybridoma method.
[0058] ox-HD5 can be prepared by producing a polypeptide consisting of the amino acid sequence represented by SEQ ID NO: 18 in a chemical or genetic engineering way, and then using the polypeptide for a disulfide bond formation reaction used in a well-known protein refolding process. The disulfide bond formation reaction can be carried out typically by gently stirring in a weak alkaline aqueous solvent at approximately 4° C. to 10° C. for approximately 12 hours to 48 hours, or by gently stirring for oxidation at approximately 20° C. to 30° C. for approximately 12 hours to 48 hours in the presence of a redox agent (oxidized glutathione/reduced glutathione, cystine/cysteine, cysteamine/cystamine and the like) that is prepared by combining an oxidant with a reductant at an appropriate ratio.
[0059] ox-HD5 may be prepared by transforming a host cell with use of a nucleic acid encoding pre-HD5 or pro-HD5, and converting the pre-HD5 or pro-HD5 into ox-HD5 in the host cell. ox-HD5 may be utilized as it is as the antigen, or bound to various carrier proteins through a suitable condensing agent so as to be yielded as an immunogenic conjugate as the antigen. ox-HD5 may be used as the antigen with a suitable adjuvant.
[0060] The anti-ox-HD5 monoclonal antibody and the antigen binding fragment thereof used in the present invention can be prepared by genetic engineering methods that includes introducing expression vectors containing the nucleic acids encoding them into suitable host cells and expressing them in the host cells. The antibody preparation according to genetic engineering methods including preparation of nucleic acids encoding the anti-ox-HD5 monoclonal antibody and the antigen binding fragment thereof, types of host cells, methods for gene introduction, expression and purification of proteins and the like, can be carried out by methods well-known to the person skilled in the art according to instructions in experimental procedure manuals that describes in detail about various operations for genetical modification. The present invention also provides the nucleic acids encoding the anti-ox-HD5 monoclonal antibody and the antigen binding fragment thereof, the expression vector containing the nucleic acid, and the transformed host cell, as other aspects.
[0061] A preferred example of the anti-ox-HD5 monoclonal antibody according to a) is a monoclonal antibody (represented as monoclonal antibody 12-1 or 12-1 simply, hereinafter) produced by a hybridoma that has been internationally deposited with International Accession Number NITE BP-03086 (identification reference: 12-1) dated on Dec. 4, 2019 in #122, 2-5-8 Kazusakamatari, Kisarazu-shi, Chiba, Japan, Patent Microorganisms Depositary Center of the National Institute of Technology and Evaluation.
[0062] A preferred example of the anti-ox-HD5 monoclonal antibody according to b) is a monoclonal antibody (represented as monoclonal antibody 39E-7 or 39E-7 simply, hereinafter) produced by a hybridoma that has been internationally deposited with International Accession Number NITE BP-03087 (identification reference: 39E-7) dated on Dec. 4, 2019 in #122, 2-5-8 Kazusakamatari, Kisarazu-shi, Chiba, Japan, Patent Microorganisms Depositary Center of the National Institute of Technology and Evaluation.
[0063] A preferred example of the antigen binding fragment of the anti-ox-HD5 monoclonal antibody according to a) is an antigen binding fragment of the monoclonal antibody 12-1, and a preferred example of the antigen binding fragment of the anti-ox-HD5 monoclonal antibody according to b) is an antigen binding fragment of the monoclonal antibody 39E-7.
Immunological Detection Method and Kit for ox-HD5
[0064] Both of the anti-ox-HD5 monoclonal antibody and the antigen binding fragment thereof in the present invention are specifically bound to ox-HD5, and thereby can be used for immunological detection of ox-HD5 and utilized in affinity columns and the like for ox-HD5.
[0065] In addition, the anti-ox-HD5 monoclonal antibody or the antigen binding fragment thereof according to a) and the anti-ox-HD5 monoclonal antibody or the antigen binding fragment thereof according to b) recognize different epitopes of ox-HD5 and are simultaneously bound to one molecule of ox-HD5 to form a sandwich complex, thereby enabling the immunological detection of ox-HD5 in a specimen at a high sensitivity by the sandwich method with use of combination of these antibodies.
[0066] The immunological detection method for ox-HD5 includes all types of immunoassays utilizing antigen-antibody reactions, and examples thereof include ELISA, radio immunoassay, immunostaining of tissues or cells, immunoblotting, immunochromatography. In the present invention, it is preferred to employ the immunological detection by the sandwich method with use of the anti-ox-HD5 monoclonal antibody or the antigen binding fragment thereof according to a) and the anti-ox-HD5 monoclonal antibody or the antigen binding fragment thereof according to b). In particular, it is preferred to employ the immunological detection by the sandwich method with use of the anti-ox-HD5 monoclonal antibody or the antigen binding fragment thereof according to a) as a capture antibody and the anti-ox-HD5 monoclonal antibody or the antigen binding fragment thereof according to b) as a detection antibody, for example, sandwich ELISA.
[0067] The anti-ox-HD5 monoclonal antibody and the antigen binding fragment thereof according to the present invention can be immobilized on a suitable support or labeled with an appropriate labeling compound, for the purpose of the immunological detection of ox-HD5. In a preferred embodiment of the present invention, the monoclonal antibody or the antigen binding fragment thereof according to a) to be used as the capture antibody is immobilized on the support, while the monoclonal antibody or the antigen binding fragment thereof according to b) to be used as the detection antibody is labeled.
[0068] The support on which the antibody is to be immobilized, methods for immobilizing the antibody on the support, the labeling compound to be used in labeling the detection antibody, methods for labeling the antibody using the labeling compound, as well as operations for immunoassay using these, such as incubation conditions for the specimen and the support on which the antibody is immobilized, washing, blocking, and detection methods, for example, can be referred to methods well-known to the person skilled in the art, such as description of The Immunoassay Handbook: Theory and Applications of Ligand Binding, ELISA and Related Techniques (4TH), Elsevier, which is incorporated herein by reference in its entirety.
[0069] Examples of the labeling compound include fluorescent substances (e.g., FITC, rhodamine and the like), metal particles such as gold colloid, fluorescent microbeads such as Luminex (registered trademark, Luminex Corporation), pigment proteins (e.g., phycoerythrin, phycocyanin and the like), radioisotopes (e.g., .sup.3H, .sup.14C, .sup.32P, .sup.35S, .sup.1251, .sup.131I and the like), enzymes (for example, peroxidase, alkaline phosphatase and the like), biotin and streptavidin.
[0070] The kit according to one aspect of the present invention comprises the monoclonal antibody or the antigen binding fragment thereof according to a) and the monoclonal antibody or the antigen binding fragment thereof according to b). The kit may further comprise a support such as a plate, and a reagent such as a blocking solution, a washing solution and a coloring substrate.
[0071] The specimen to be used in the immunological detection of ox-HD5 is preferably a biological sample derived from human, and examples thereof include tissues, cells, body fluids (for example, blood, lymph, saliva, mucus, bone marrow fluid, urine, semen, abdominal cavity fluid, and the like), feces and the like. The biological sample may be used as it is collected, or used after being subjected to pretreatment such as crushing, homogenization, centrifugal separation, concentration and dilution.
[0072] In the case of detecting ox-HD5 in feces, it is preferred to use an extract obtained by extracting a freeze-dried and crushed feces with an aqueous medium as the specimen. Such a specimen can be prepared typically by crushing a freeze-dried feces with use of a grinder such as bead grinder, then adding an aqueous medium generally used in the field of biochemistry without causing any negative influence on the biological sample, such as distilled water, physiological saline, phosphate buffer, phosphate buffered saline, for example, to the crushed feces, then shaking the resulting solution at approximately 4° C. for 1 hour to 48 hours, preferably 4 hours to 36 hours, more preferably 8 hours to 24 hours, and then removing a solid content by centrifugal separation or filtration.
[0073] In the case of detecting ox-HD5 in blood, it is preferred to use serum or plasma as the specimen.
[0074] In a particularly preferred embodiment of the present invention, the immunological detection method for ox-HD5 comprises: a step of adding the specimen to the support on which the monoclonal antibody or the antigen binding fragment thereof according to a) is immobilized, the support being prepared by adding a solution containing the monoclonal antibody or the antigen binding fragment thereof according to a) at a concentration of 0.5 mg/ml or more, for example 0.5 to 10 mg/ml, preferably 1 to 10 mg/ml; a step of adding to the support the labeled monoclonal antibody or the antigen binding fragment thereof according to b) at a final concentration of 0.1 mg/ml or more, for example 0.1 to 1 mg/ml, preferably 0.5 to 1 mg/ml in a solution on the support during the addition; and a step of detecting the label of the monoclonal antibody or the antigen binding fragment thereof according to b) that is bound to human α-defensin HD5 with intramolecular disulfide bonds. The final concentration of the labeled monoclonal antibody or the antigen binding fragment thereof according to b) in the solution on the support during the addition can be adjusted by setting the concentration of a solution to be added in consideration of dilution with the residual solution resulting from the preceding. For example, in the case of removing the liquid from the support after the step of adding the specimen, the above final concentration is substantially equal to the concentration of the labeled monoclonal antibody or the antigen binding fragment thereof according to b) in the added solution, in view of almost no residual amount of the liquid on the support.
[0075] The present invention will be described more in detail with reference to the following Examples, but the present invention is not limited thereto.
EXAMPLES
Example 1
Preparation of Anti-ox-HD5 Monoclonal Antibodies
1) Preparation of Anti-ox-HD5
[0076] Chemical synthesis of mature HD5 (SEQ ID NO: 18) was outsourced to Thermo Fisher Scientific. The mature HD5 was dissolved in 0.1% acetic acid, then the pH was adjusted to 8.4 to 8.8 with 10% sodium hydroxide. The resulting solution was gently stirred at 4° C. for 18 hours for an oxidation treatment. Subsequently, the solvent was substituted with 5% acetic acid with use of a dialysis membrane, and then the solution was removed by freeze-drying in vacuum. The resulting sample was dissolved in 0.1% trifluoroacetic acid, and then the solution thereof was subjected to a reverse-phase chromatography (C-18 column) to collect polypeptide fraction.
[0077] The polypeptide fraction and the synthesized polypeptide prior to the oxidation treatment were analyzed by MALDI-TOF MS (
[0078] Instead of the above oxidation treatment, another oxidization treatment was performed by dissolving mature HD5 in a glutathione oxidation solution (reduced glutathione (3 mM), oxidized glutathione (0.3 mM), and urea (8 M)), adjusting the pH to 8.4 with sodium bicarbonate (0.25 M), and then stirring the resulting solution gently for 18 hours at room temperature. This oxidation treatment also yielded ox-HD5 with three intramolecular disulfide bonds, which was confirmed by MALDI-TOF MS. ox-HD5 was used in Examples described below.
2) Preparation of Hybridomas
[0079] Autoimmune disease mice (C3H/HeJJmsSlc-lpr/lpr available from Japan SLC, Inc.) injected with an adjuvant according to a conventional method were immunized with ox-HD5 by three times of intra-abdominal injection (0.2 mg each time). Later, cells were collected from the spleen of the immunized mice according to a conventional method, and then fused with a mouse myeloma cell line P3U1 with use of 50% polyethylene glycol 1500 (Sigma-Aldrich Co. LLC) to prepare hybridomas. Each hybridoma clone was screened by indirect ELISA, and subcloned four times by a limiting dilution method.
[0080] The indirect ELISA was carried out by the following procedures. Wells of a flat-bottomed microtiter plate (Nunc) were coated with 1 μg/ml of ox-HD5 dissolved in Ca.sup.2+/Mg.sup.2+-free phosphate buffered saline (PBS), and then incubated overnight at 4° C. After three times of washing with PBS containing 0.1% Tween 20 (PBS-T), culture supernatant from each hybridoma clone was added to the wells, and incubated at 37° C. for 1 hour. After washing with PBS-T, horseradish peroxidase (HRP)-bound goat anti-mouse IgG (GE Healthcare Biosciences) was added, then the resulting solution was incubated for 45 minutes, and then washed. 100 μL of 3,3′,5,5′-tetramethylbenzidine (TMB) substrate buffer (KPL) was added to each well, then the plate was incubated at 25° C. for 30 minutes, and then absorbance at 405 nm was measured with use of a microplate reader Multiscan FC (Thermo Scientific).
[0081] The isotypes of monoclonal antibodies produced by five types of hybridoma clones (12-1, 16-1, 39E-7, 58-3, 60-10B) selected by the above procedures were determined with use of a mouse monoclonal antibody isotyping kit (F. Hoffmann-La Roche Ltd.). Results are listed in Table 1.
TABLE-US-00001 TABLE 1 Clone No. 12-1 16-1 39E-7 58-3 60-10B Isotype IgG.sub.1k IgG.sub.1k IgG.sub.2ak IgG.sub.1k IgG.sub.1k
Example 2
Establishment of Sandwich Immunoassay
1) Selection of Antibodies for Immunoassay
[0082] Combination of antibodies suitable for immunoassay was selected by performing a sandwich ELISA with use of the five types of the monoclonal antibodies either as a capture antibody or a detection antibody by the following procedures.
[0083] Each of the monoclonal antibodies obtained in Example 1 was dissolved in a 50 mM sodium carbonate-sodium bicarbonate buffer (pH 9.6) to obtain 10 mg/ml solution. 100 μl of this solution was added to each well of the microtiter plate, and then incubated overnight at 4° C. After the plate was washed three times with PBS-T, 200 μl of 25% Block Ace (DS Pharma Biomedical) was added, and blocking was performed at 25° C. for 1 hour. The plate washed with PBS-T was used as a plate on which the capture antibody was immobilized, in the immunoassay. The detection antibody was prepared by labeling each monoclonal antibody with use of biotin (Dojindo Laboratories) according to a manufacturer's protocol.
[0084] As a standard, 100 μl of 10 or 30 ng/ml solution of ox-HD5 dissolved in PBS-T was added to each well of the plate on which the capture antibody was immobilized, and then incubated at 25° C. for 2 hours. After three times of washing with PBS (PBS-T), 100 μl of 0.5 mg/ml solution of the detection antibody was added to the wells and then incubated at 25° C. for 1 hour. Next, 100 μl of Streptavidin-HRP conjugate (GE Healthcare Biosciences, 1:5000 dilution) was added to the wells, and then incubated at 25° C. for 1 hour. After washing, 100 μl of TMB substrate buffer was added to the wells, then incubated at 25° C. for 30 minutes, and then 100 μl of 0.6 N H.sub.2SO.sub.4 was added to quench the reaction. The absorbances at 450 nm (absorption wavelength) and 620 nm (reference wavelength) were measured with use of the microplate reader, and then the difference between both absorbances was calculated as a measurement value. The measurement value was represented as an average value±standard deviation.
[0085] Results are illustrated in
2) Optimization
[0086] For the combination of the capture antibody 12-1 with the detection antibody 39E-7, optimum concentrations of the antibodies were investigated. First, sandwich ELISA was performed in a similar manner to the above 1) with the detection antibody 39E-7 at a concentration of 0.5 mg/ml and the capture antibody 12-1 at a concentration of 0.1, 0.5, 1, 5, or 10 mg/ml, and a standard curve for ox-HD5 at concentrations from 0 to 30 ng/ml was prepared (n=3). The statistical analysis was carried out by Student's t-test, and the P value<0.05 was considered statistically significant.
[0087] Results are illustrated in
[0088] Next, sandwich ELISA was performed in a similar manner with the capture antibody 12-1 at a concentration of 1 mg/ml and the detection antibody 39E-7 at a concentration of 0.1, 0.5, or 1 mg/ml, and a standard curve was prepared (n=8). Results are illustrated in
3) Confirmation of Specificity
[0089] In order to investigate specificity of assay systems constructed in 1) and 2) mentioned above, the reactivity to r-HD5, a reduced form (r-HD6) of HD6 (SEQ ID NO: 19) that is an isoform of HD5, and oxidized and reduced forms (ox-Crp1, r-Crp1, ox-Crp4 and r-Crp4) of two types of mouse α-defensin (Crp1 and Crp4), was studied. Chemical synthesis of all of these peptides was outsourced to Thermo Fisher Scientific. The oxidized forms of Crp1 and Crp4 were prepared according to a previous report (K. Nakamura et al., Analytical biochemistry. 2013, 443 (2), 124-131). Sandwich ELISA was performed in a similar manner with the capture antibody 12-1 at a concentration of 1 mg/ml and the detection antibody 39E-7 at a concentration of 0.5 mg/ml, and a standard curve for each antigen at concentrations from 0 to 60 ng/ml was prepared.
[0090] Results are illustrated in
Example 3
CDR Analysis for Monoclonal Antibodies
[0091] CDR sequences of the monoclonal antibodies 12-1 and 39E-7 were analyzed with use of SMART cDNA library preparation kit (Takara Bio Inc.). Specifically, total RNA was extracted from the hybridoma clones 12-1 and 39E-7. Then, cDNA was prepared with use of the extracted RNA as a template as well as 3′-terminal side IgG1 heavy chain specific primer, IgG2a heavy chain specific primer or K light chain specific primer. PCR amplification was carried out with use of the cDNA as a template as well as 5′-terminal side specific primer included in the kit as a forward primer, 3′-terminal side IgG1 heavy chain specific primer, IgG2a heavy chain specific primer or K light chain specific primer as reverse primers. The nucleic acid sequences of the amplified DNA fragments were analyzed with use of a DNA sequencer, and then the obtained sequence information was searched on igBLAST database (http://www.ncbi.nlm.nih.gov/igblast/). As a result, both of the monoclonal antibodies 12-1 and 39E-7 were confirmed to have new CDR sequence combinations. Table 2 lists the amino acid sequences of the heavy chains CDR1 to 3 and the variable region for each antibody. Table 3 lists the amino acid sequences of the light chains CDR1 to 3 and the variable region.
TABLE-US-00002 TABLE 2 Heavy chain Primary VH sequence CDR1 CDR2 CDR3 12-1 QVQLQQSGAELARPGASVKLSCKASGYT SYGIS EIYPRSGNTYYNEKFKG DYDGFPYFDY FTSYGISWVKQRTGQGLEWIGEIYPRSGN (SEQ ID NO: 1) (SEQ ID NO: 2) (SEQ ID NO: 3) TYYNEKFKGKATLTADKSSSTAYMQLSSL TSEDSAVYFCARDYDGFPYFDYWGQGTT LTVSS (SEQ ID NO: 13) 39E-7 EVQLQOSGPELVKPGASVKISCKASGYSF GSYMN EINPSTGGTTHNQKFKA DYAGSYDWYFDV TGSYMNWVKQSPEKSLEWIGEINPSTGG (SEQ ID NO: 7) (SEQ ID NO: 8) (SEQ ID NO: 9) TTHNQKFKAKATLTVDTSSSTFYMQLKS LTSEDSAVYYCARDYAGSYDWYFDVWG AGTTVTVSS (SEQ ID NO: 15)
TABLE-US-00003 Light chain Primary VL sequence CDR1 CDR2 CDR3 12-1 DIVLTQSPASLAVSLGQRATISCRASESVDS RASESVDSYGYSFMH RASNLES QQSNEDPRT YGYSFMHWYQQKPGQPPKLLIYRASNLES (SEQ ID NO: 4) (SEQ ID NO: 5) (SEQ ID NO: 6) GIPARFSGSGSRTDFTLTINPVEADDVATY YCQQSNEDPRTFGGGTKLEIK (SEQ ID NQ: 14) 39E-7 DIKMTQSPSSMYASLGERVTITCKASQDIN KASQDINSYLS RANRLVD LQYDEFPYT SYLSWFQQKPGKSPKTLIYRANRLVDGVP (SEQ ID NO: 10) (SEQ ID NO: 11) (SEQ ID NO: 12) SRFSGSGSGQDYSLTISSLEYEDMGIYYCL QYDEFPYTFGGGTKLEII (SEQ ID NO: 16)
[0092] The hybridoma clones 12-1 and 39E-7 were internationally deposited with Accession Numbers NITE BP-03086 (identification reference: 12-1) and NITE BP-03087 (identification reference: 39E-7) in Patent Microorganisms Depositary Center of the National Institute of Technology and Evaluation.
Example 4
Quantitative Determination of ox-HD5 in Human Specimen by Sandwich ELISA
[0093] Serum and feces were collected from healthy volunteers (30 to 80 years old, total five volunteers). The feces were freeze-dried for 16 hours, and then crushed using a bead beater type homogenizer (Beads Crusher μT-12) with stainless beads. 500 μL of PBS (−) was added per 50 mg of fecal powders, and shaken for 16 hours and subjected to centrifugal separation (20,400 G, 10 minutes, 4° C.) to obtain the supernatant as the measurement sample. Sandwich ELISA was carried out under the optimum condition determined in Example 2.
[0094] Results are illustrated in
Sequence Listing Free Text
[0095] SEQ ID NO: 1: Amino acid sequence of heavy chain CDR1 of monoclonal antibody 12-1 [0096] SEQ ID NO: 2: Amino acid sequence of heavy chain CDR2 of monoclonal antibody 12-1 [0097] SEQ ID NO: 3: Amino acid sequence of heavy chain CDR3 of monoclonal antibody 12-1 [0098] SEQ ID NO: 4: Amino acid sequence of light chain CDR1 of monoclonal antibody 12-1 [0099] SEQ ID NO: 5: Amino acid sequence of light chain CDR2 of monoclonal antibody 12-1 [0100] SEQ ID NO: 6: Amino acid sequence of light chain CDR3 of monoclonal antibody 12-1 [0101] SEQ ID NO: 7: Amino acid sequence of heavy chain CDR1 of monoclonal antibody 39E-7 [0102] SEQ ID NO: 8: Amino acid sequence of heavy chain CDR2 of monoclonal antibody 39E-7 [0103] SEQ ID NO: 9: Amino acid sequence of heavy chain CDR3 of monoclonal antibody 39E-7 [0104] SEQ ID NO: 10: Amino acid sequence of light chain CDR1 of monoclonal antibody 39E-7 [0105] SEQ ID NO: 11: Amino acid sequence of light chain CDR2 of monoclonal antibody 39E-7 [0106] SEQ ID NO: 12: Amino acid sequence of light chain CDR3 of monoclonal antibody 39E-7 [0107] SEQ ID NO: 13: Amino acid sequence of heavy chain of monoclonal antibody 12-1 [0108] SEQ ID NO: 14: Amino acid sequence of light chain of monoclonal antibody 12-1 [0109] SEQ ID NO: 15: Amino acid sequence of heavy chain of monoclonal antibody 39E-7 [0110] SEQ ID NO: 16: Amino acid sequence of light chain of monoclonal antibody 39E-7 [0111] SEQ ID NO: 17: Amino acid sequence of pre-HD5 [0112] SEQ ID NO: 18: Amino acid sequence of mature HD5 [0113] SEQ ID NO: 19: Amino acid sequence of mature HD6