DNA METHYLTRANSFERASE 1 TRANSITION STATE STRUCTURE AND USES THEREOF
20180239878 ยท 2018-08-23
Assignee
Inventors
Cpc classification
G16B15/00
PHYSICS
G16C20/10
PHYSICS
International classification
Abstract
Methods and systems for obtaining inhibitors of human DNA methyltransferase 1 (DNMT1) are disclosed where the methods involve designing compounds that resemble the DNMT1 transition state.
Claims
1. A computer-implemented, experimentally-guided kinetic isotope effect method for detecting or screening for a compound that is an inhibitor of human DNA methyltransferase 1 (DNMT1), the method comprising the steps of: (i) inputting into the computer values for the molecular electrostatic potential at a van der Waals surface computed from a wave function of a DNMT1 transition state and values for a geometric atomic volume of the DNMT1 transition state, wherein the DNMT1 transition state comprises the structure ##STR00007## (ii) using chemical logic aided by computer design to obtain a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state; (iii) optionally synthesizing the compound; and (iv) optionally testing the compound for inhibitory activity to DNMT1; to thereby detect or screen for a compound that is an inhibitor of DNMT1.
2. A method of detecting, screening for or designing an inhibitor of human DNA methyltransferase 1 (DNMT1), the method comprising the steps of: (i) measuring kinetic isotope effects on the DNMT1-catalyzed methylation of hemimethylated DNA to obtain the DNMT1 transition state structure, wherein the DNMT1 transition state comprises the structure ##STR00008## (ii) determining the molecular electrostatic potential at the van der Waals surface computed from a wave function of the DNMT1 transition state and a geometric atomic volume of the DNMT1 transition state; (iii) obtaining a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state; and (iv) testing the compound for inhibitory activity to DNMT1 by determining if the compound inhibits DNMT1-catalyzed methylation of hemimethylated DNA; wherein a compound that inhibits DNMT1-catalyzed methylation of hemimethylated DNA is an inhibitor of DNMT1; thereby detecting, screening for or designing an inhibitor of human DNA methyltransferase 1 (DNMT1).
3. A system comprising a non-transitory computer-readable medium coupled to one or more data processing apparatus having instructions stored thereon which, when executed by the one or more data processing apparatus, cause the one or more data processing apparatus to perform a method comprising: (i) using experimental kinetic isotope effects and quantum chemical analysis on human DNA methyltransferase 1 (DNMT1)-catalyzed methylation of hemimethylated DNA to obtain the DNMT1 transition state structure, wherein the DNMT1 transition state comprises the structure ##STR00009## (ii) calculating a molecular electrostatic potential at a van der Waals surface computed from a wave function of the DNMT1 transition state and a geometric atomic volume of the DNMT1 transition state; and (iii) identifying in silico from a library of compounds a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state; wherein the chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state is a putative inhibitor of DNMT1.
4. A system comprising a non-transitory computer-readable medium coupled to one or more data processing apparatus having instructions stored thereon which, when executed by the one or more data processing apparatus, cause the one or more data processing apparatus to perform a method comprising: (i) determining a molecular electrostatic potential at the van der Waals surface computed from a wave function of a human DNA methyltransferase 1 (DNMT1) transition state and a geometric atomic volume of the DNMT1 transition state, wherein the DNMT1 transition state comprises the structure ##STR00010## and (ii) designing a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state; wherein a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state is a putative inhibitor of DNMT1.
5. A computer-implemented method performed using a system comprising a non-transitory computer-readable medium coupled to one or more data processing apparatus having instructions stored thereon, the methods comprising: (i) using kinetic isotope effects on human DNA methyltransferase 1 (DNMT1)-catalyzed methylation of hemimethylated DNA to obtain the DNMT1 transition state structure, wherein the DNMT1 transition state comprises the structure ##STR00011## (ii) determining a molecular electrostatic potential at the van der Waals surface computed from a wave function of the DNMT1 transition state and a geometric atomic volume of the DNMT1 transition state; and (iii) identifying from a library of compounds a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state; wherein the chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state is a putative inhibitor of DNMT1.
6. A computer implemented method performed using a system comprising a non-transitory computer-readable medium coupled to one or more data processing apparatus having instructions stored thereon, the methods comprising: (i) determining the molecular electrostatic potential at the van der Waals surface computed from a wave function of a human DNA methyltransferase 1 (DNMT1) transition state and a geometric atomic volume of the DNMT1 transition state, wherein the DNMT1 transition state comprises the structure ##STR00012## and (ii) designing a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the DNMT1 transition state; wherein a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state is a putative inhibitor of DNMT1.
7. A method of manufacturing an inhibitor of human DNA methyltransferase 1 (DNMT1); the method comprising: (i) obtaining information regarding the design of a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state according to claim 1; (ii) synthesizing the compound; and (iii) optionally testing the compound for inhibitory activity to DNMT1; to thereby manufacture a compound that is an inhibitor of DNMT1.
8. A method of manufacturing an inhibitor of human DNA methyltransferase 1 (DNMT1); the method comprising: (i) obtaining information regarding the design of a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state according to claim 2; (ii) synthesizing the compound; and (iii) optionally testing the compound for inhibitory activity to DNMT1; to thereby manufacture a compound that is an inhibitor of DNMT1.
9. A method of manufacturing an inhibitor of human DNA methyltransferase 1 (DNMT1); the method comprising: (i) obtaining information regarding the design of a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state according to claim 3; (ii) synthesizing the compound; and (iii) optionally testing the compound for inhibitory activity to DNMT1; to thereby manufacture a compound that is an inhibitor of DNMT1.
10. A method of manufacturing an inhibitor of human DNA methyltransferase 1 (DNMT1); the method comprising: (i) obtaining information regarding the design of a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state according to claim 4; (ii) synthesizing the compound; and (iii) optionally testing the compound for inhibitory activity to DNMT1; to thereby manufacture a compound that is an inhibitor of DNMT1.
11. A method of manufacturing an inhibitor of human DNA methyltransferase 1 (DNMT1); the method comprising: (i) obtaining information regarding the design of a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state according to claim 5; (ii) synthesizing the compound; and (iii) optionally testing the compound for inhibitory activity to DNMT1; to thereby manufacture a compound that is an inhibitor of DNMT1.
12. A method of manufacturing an inhibitor of human DNA methyltransferase 1 (DNMT1); the method comprising: (i) obtaining information regarding the design of a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state according to claim 6; (ii) synthesizing the compound; and (iii) optionally testing the compound for inhibitory activity to DNMT1; to thereby manufacture a compound that is an inhibitor of DNMT1.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0006]
[0007]
[0008]
[0009]
[0010]
DETAILED DESCRIPTION OF THE INVENTION
[0011] The invention provides a computer-implemented, experimentally-guided kinetic isotope effect method of obtaining an inhibitor of human DNA methyltransferase 1 (DNMT1), the method comprising using a computer to design a chemically stable compound that resembles the charge and geometry of the DNMT1 transition state, wherein the compound is a putative inhibitor of DNMT1.
[0012] The invention also provides a system for obtaining a putative inhibitor of a human DNA methyltransferase 1 (DNMT1) comprising one or more data processing apparatus and a computer-readable medium coupled to the one or more data processing apparatus having instructions stored thereon that when executed by the one or more data processing apparatus cause the one or more data processing apparatus to perform a method comprising designing a chemically stable compound that resembles the charge and geometry of the DNMT1 transition state, wherein the compound is a putative inhibitor of DNMT1.
[0013] The invention further provides a computer-implemented method for detecting or screening for a compound that is an inhibitor of human DNA methyltransferase 1 (DNMT1), the method comprising the steps of:
[0014] (i) inputting into the computer values for the molecular electrostatic potential at the van der Waals surface computed from the wave function of a DNMT1 transition state and values for the geometric atomic volume of the DNMT1 transition state, wherein the DNMT1 transition state comprises the structure
##STR00001##
[0015] (ii) using chemical logic aided by computer design to obtain a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state;
[0016] (iii) optionally synthesizing the compound; and
[0017] (iv) optionally testing the compound for inhibitory activity to DNMT1;
[0018] to thereby detect or screen for a compound that is an inhibitor of DNMT1.
[0019] The invention further provides a method of detecting, screening for or designing an inhibitor of human DNA methyltransferase 1 (DNMT1), the method comprising the steps of:
[0020] (i) measuring kinetic isotope effects on the DNMT1-catalyzed methylation of hemimethylated DNA to obtain the DNMT1 transition state structure,
[0021] wherein the DNMT1 transition state comprises the structure
##STR00002##
[0022] (ii) determining the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state;
[0023] (iii) obtaining a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state; and
[0024] (iv) testing the compound for inhibitory activity to DNMT1 by determining if the compound inhibits DNMT1-catalyzed methylation of hemimethylated DNA;
[0025] wherein a compound that inhibits DNMT1-catalyzed methylation of hemimethylated DNA is an inhibitor of DNMT1;
[0026] thereby detecting, screening for or designing an inhibitor of human DNA methyltransferase 1 (DNMT1).
[0027] The invention also provides a system comprising a non-transitory computer-readable medium coupled to one or more data processing apparatus having instructions stored thereon which, when executed by the one or more data processing apparatus, cause the one or more data processing apparatus to perform a method comprising:
[0028] (i) using experimental kinetic isotope effects and quantum chemical analysis on human DNA methyltransferase 1 (DNMT1)-catalyzed methylation of hemimethylated DNA to obtain the DNMT1 transition state structure,
[0029] wherein the DNMT1 transition state comprises the structure
##STR00003##
[0030] (ii) calculating a molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state; and
[0031] (iii) identifying in silico from a library of compounds a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state;
[0032] wherein the chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state is a putative inhibitor of DNMT1.
[0033] The invention also provides a system comprising a non-transitory computer-readable medium coupled to one or more data processing apparatus having instructions stored thereon which, when executed by the one or more data processing apparatus, cause the one or more data processing apparatus to perform a method comprising:
[0034] (i) determining the molecular electrostatic potential at the van der Waals surface computed from the wave function of a human DNA methyltransferase 1 (DNMT1) transition state and the geometric atomic volume of the DNMT1 transition state, wherein the DNMT1 transition state comprises the structure
##STR00004##
and
[0035] (ii) designing a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state;
[0036] wherein a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state is a putative inhibitor of DNMT1.
[0037] The invention also provides a computer-implemented method performed using a system comprising a non-transitory computer-readable medium coupled to one or more data processing apparatus having instructions stored thereon, the methods comprising:
[0038] (i) using kinetic isotope effects on human DNA methyltransferase 1 (DNMT1)-catalyzed methylation of hemimethylated DNA to obtain the DNMT1 transition state structure,
[0039] wherein the DNMT1 transition state comprises the structure
##STR00005##
[0040] (ii) determining the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state; and
[0041] (iii) identifying from a library of compounds a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state;
[0042] wherein the chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state is a putative inhibitor of DNMT1.
[0043] The invention also provides a computer implemented method performed using a system comprising a non-transitory computer-readable medium coupled to one or more data processing apparatus having instructions stored thereon, the methods comprising:
[0044] (i) determining the molecular electrostatic potential at the van der Waals surface computed from the wave function of a human DNA methyltransferase 1 (DNMT1) transition state and the geometric atomic volume of the DNMT1 transition state, wherein the DNMT1 transition state comprises the structure
##STR00006##
and
[0045] (ii) designing a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the DNMT1 transition state;
[0046] wherein a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state is a putative inhibitor of DNMT1.
[0047] The DNMT1 transition state can have the following structure:
[0048] The methods can also comprise synthesizing the putative inhibitor compound and/or testing the compound for inhibitory activity to DNMT1.
[0049] The invention also provides a method of manufacturing an inhibitor of human DNA methyltransferase 1 (DNMT1); the method comprising:
[0050] (i) obtaining information regarding the design of a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the DNMT1 transition state and the geometric atomic volume of the DNMT1 transition state according to any of the methods or systems disclosed herein;
[0051] (ii) synthesizing the compound; and
[0052] (iii) optionally testing the compound for inhibitory activity to DNMT1; to thereby manufacture a compound that is an inhibitor of DNMT1.
[0053] The invention also provides methods of inhibiting DNMT1 comprising obtaining a DNMT1 inhibitor compound by any of the methods disclosed herein or by using any of the systems disclosed herein, and contacting DNMT1 with the compound.
[0054] The invention further provides methods of treating a subject having a cancer comprising obtaining a DNMT1 inhibitor by any of the methods disclosed herein or by using any of the systems disclosed herein, and administering the compound to the subject in an amount effective to inhibit DNMT1. The subjects can have different types of cancers, including but not limited to, a multiple myeloma, a neuroblastoma, a glioblastoma, prostate cancer and/or breast cancer.
[0055] The invention still further provides compounds obtained by any of the methods disclosed herein or by using any of the systems disclosed herein.
[0056] As used herein, a compound resembles the DNMT1 transition state molecular electrostatic potential at the van der Waals surface computed from the wave function of the transition state and the geometric atomic volume if that compound has an S.sub.e and S.sub.g0.5, where S.sub.e and S.sub.g are determined as in Formulas (1) and (2) on page 8831 of Bagdassarian, Schramm and Schwartz, 1996 (38).
[0057] Page 8831 of Bagdassarian et al. 1996 (58) sets forth in part [a] molecule can be compared to another either geometrically or electrostatically, but ideally, a similarity measure will contain a mixture of both. Consider first the measure
where .sub.i.sup.A is the electrostatic potential at surface point i of molecule A, .sub.j.sup.B defines point j of molecule B, and in the numerator r.sub.ij.sup.2 is the spatial distance squared between point i on A and j on B. nA and nB refer to the number of surface points on each molecule. The double summation is therefore over all possible interactions between points on the two molecules, and is the length scale for the interaction between i and j. The numerator compares A to B for a particular orientation of molecule B relative to molecule A. The denominator serves as a normalization factor for the comparison of A to itself and for B to itself. Here, r.sub.ij.sup.2 refers to the distance between i and j on the same molecule. The distance between points is squared to decrease computation time. Consider also a second, purely geometrical measure:
[0058] The invention provides methods and systems that provide a technical solution to enable obtaining inhibitors for DNMT1, particularly ones that will be effective in cancer therapy. The disclosed methods enhance the performance of the system in obtaining the inhibitors.
[0059] This invention will be better understood from the Experimental Details that follow. However, one skilled in the art will readily appreciate that the specific methods and results discussed are merely illustrative of the invention as described more fully in the claims that follow thereafter.
Experimental Details
EXAMPLE 1
Overview
[0060] Example 1 was previously published by the inventors as Human DNMT1 transition state structure in the Proceedings of the National Academy of Sciences, Vol. 113, No. 11, pages 2916-2921, 2016, Epub 2016 Feb. 29.
Summary
[0061] DNA methyltransferase 1 (DNMT1) is the major enzyme responsible for maintenance of DNA CpG methylation marks in human cells. Human DNMT1 maintains the epigenetic state of DNA by replicating CpG methylation signatures from parent to daughter strands, producing heritable methylation patterns through cell divisions. The enzyme is a validated target for cancer, but current treatments are mutagenic. Knowledge of the transition state (TS) structure of DNMT1 will inform the chemical reaction mechanism and provide information for TS analog design. The proposed catalytic mechanism of DNMT1 involves nucleophilic attack of Cys1226 to cytosine (Cyt) C6, methyl transfer from S-adenosyl-1-methionine (SAM) to Cyt C5, and proton abstraction from C5 to form methylated CpG in DNA. The subangstrom geometric and electrostatic character of the TS for the DNMT1 methylation of hemimethylated DNA are described. The experimental and computational TS analysis indicates methyl transfer is the rate-limiting chemical step for the reaction. Experimental kinetic isotope effects were used to guide quantum mechanical calculations to solve the TS structure. Methyl transfer occurs after Cys1226 attack to Cyt C6, and the methyl transfer step is chemically rate-limiting for DNMT1. Electrostatic potential maps were compared for the TS and ground states, providing the electronic basis for interactions between the protein and reactants at the TS. Methyl group transfer can be characterized as a loose nucleophilic substitution TS. TS analysis of DNMT1 demonstrates an approach to understand a complex epigenetic enzyme.
Introduction
[0062] Human DNA methyltransferases (DNMTs) catalyze the formation of 5-methylcytosine (5 mC) at CpG sites on DNA, a key epigenetic mark present in the human genome (1). DNA methylation is involved in transcriptional silencing, cellular differentiation, genomic imprinting, and X-chromosome inactivation. In addition, hypermethylation of CpG islands at gene promoter regions has been associated with carcinogenesis (2). Maintenance of DNA methylation patterns is conducted by human DNMT1, a multidomain protein of 1,616 amino acids. The C-terminal methyltransferase domain shows sequence similarities to the bacterial methyltransferases (3). Crystal structures of mouse and human DNMT1 complexed with different substrates have provided a structural basis for DNMT1-mediated maintenance DNA methylation (4, 5). Domain interactions and large conformational changes are responsible for properly positioning hemimethylated DNA within the active site and catalyze methyl transfer from S-adenosyl-1-methionine (SAM) to DNA. Site-directed mutations have offered insights into the structure-function relationship of DNMTs (6, 7), but their transition state (TS) structures have remained unknown.
[0063] DNMT1 has been proposed to follow a catalytic mechanism shared by bacterial DNA-(cytosine C5)-methyltransferases (4, 8-10): nucleophilic attack of cytosine (Cyt) C6 by Cys1226 of DNMT1, methyl transfer from SAM to Cyt C5, and -elimination of H5 to produce 5 mC in the final step (
[0064] Enzymes catalyze reactions by forming short-lived TSs from their reactants held in Michaelis complexes (13). The lifetime of a chemical TS is typically around 10.sup.14 s, on the time scale of chemical bond vibrations. No spectroscopic method is generally available to observe the chemical structure of TSs directly for enzymatic reactions (14). TS analysis based on experimental KIEs has provided detailed chemical insights into the catalytic mechanisms of enzymes acting mostly on small molecules and has led to the design of some of the most powerful enzyme inhibitors (15, 16). Enzymes in epigenetic regulations often involve large and complex substrates, creating experimental challenges in both ME measurements and computational models. Nonetheless, TS analysis can be applied to complex enzyme systems, including the 50S ribosomes (17), as long as the chemical steps can be interrogated with the appropriate isotope labels.
[0065] In the present study, 10 experimental KIEs were measured to investigate the TS and catalytic mechanisms of human DNMT1. By combining these experimental KIE values with QM calculations, the subangstrom TS structure was established for human DNMT1. The results also show methyl transfer to be the major chemical barrier in the reaction coordinate, rather than the Cys attack, -elimination from the C5-position, or departure of the 5-methyl Cyt from the catalytic site Cys. The work demonstrates an experimental approach to analyze the TS structures of complex epigenetic enzymes, for unraveling their catalytic mechanisms, and for advancing target-specific drug designs.
Materials and Methods
[0066] Human DNMT1 has the following amino acid sequence (NCBI Reference Sequence: NP_001370.1, SEQ ID NO:1):
TABLE-US-00001 1 mpartaparvptlavpaislpddvrrrlkdlerdslteke cvkeklnllheflqteiknq 61 lcdletklrkeelseegylakvksllnkdlslengahayn revngrlengnqarsearrv 121 gmadansppkplskprtprrsksdgeakpepspspritrk strqttitshfakgpakrkp 181 qeeseraksdesikeedkdqdekrrrvtsrervarplpae eperaksgtrtekeeerdek 241 eekrirsqtkeptpkqklkeepdrearagvqadededgde kdekkhrsqpkdlaakrrpe 301 ekepekvnpqisdekdedekeekrrkttpkeptekkmara ktvmnskthppkciqcgqyl 361 ddpdlkygqhppdavdepqmltneklsifdanesgfesye alpqhkltcfsvyckhghlc 421 pidtglieknielffsgsakpiydddpsleggvngknlgp inewwitgfdggekaligfs 481 tsfaeyilmdpspeyapifglmqekiyiskivveflqsns dstyedlinkiettvppsgl 541 nlnrftedsllrhaqfvveqvesydeagdsdeqpifltpc mrdliklagvtlgqrraqar 601 rqtirhstrekdrgptkatttklvyqifdtffaeqiekdd redkenafkrrrcgvcevcq 661 qpecgkckackdmvkfggsgrskqacqerrcpnmamkead ddeevddnipempspkkmhq 721 gkkkkqnknriswvgeavktdgkksyykkvcidaetlevg dcvsvipddsskplylarvt 781 alwedssngqmfhahwfcagtdtvlgatsdplelflvdec edmqlsyihskvkviykaps 841 enwameggmdpesllegddgktyfyqlwydqdyarfespp ktqptednkfkfcvscarla 901 emrqkeiprvleqledldsrvlyysatkngilyrvgdgvy lppeaftfniklsspvkrpr 961 kepvdedlypehyrkysdyikgsnldapepyrigrikeif cpkksngrpnetdikirvnk 1021 fyrpenthkstpasyhadinllywsdeeavvdfkavqgrc tveygedlpecvqvysmggp 1081 nrfyfleaynaksksfedppnharspgnkgkgkgkgkgkp ksqacepsepeieiklpklr 1141 tldvfsgcgglsegfhqagisdtlwaiemwdpaaqafrln npgstvftedcnillklvma 1201 gettnsrgqrlpqkgdvemlcggppcqgfsgmnrfnsrty skfknslvvsflsycdyyrp 1261 rffllenvrnfvsfkrsmvlkltlrclvrmgyqctfgvlq agqygvaqtrrraiilaaap 1321 geklplfpeplhvfapracqlsvvvddkkfvsnitrlssg pfrtitvrdtmsdlpevrng 1381 asaleisyngepqswfqrqlrgaqyqpilrdhickdmsal vaarmrhiplapgsdwrdlp 1441 nievrlsdgtmarklrythhdrkngrsssgalrgvcscve agkacdpaarqfntlipwcl 1501 phtgnrhnhwaglygrlewdgffsttvtnpepmgkqgrvl hpeqhrvvsvrecarsqgfp 1561 dtyrlfgnildkhrqvgnavppplakaigleiklcmlaka resasakikeeeaakd.
[0067] Human DNMT1. Full-length human DNMT1 protein (amino acids 1-1,616) containing an N-terminal His6-tag was expressed in a Sf9 insect cell line as described previously (33). The expressed human DNMT1 was purified by nickel-nitrilotriacetic acid column chromatography on FPLC. The concentrated DNMT1 was further purified through a gel filtration column (200 pg, Hiload 16/600 Superdex; Amersham) in 50 mM Hepes (pH 7.4), 150 mM NaCl, and 1mMDTT to remove low-molecular-weight contaminants. Purified DNMT1 appeared as a single band on SDS/PAGE with an apparent size of 190 kDa. Aliquots were frozen and stored at 80 C.
[0068] Forward Commitment Values. The Cf values were measured by substrate trapping procedures. The formation of radiolabeled product was quantitated after chasing enzyme-bound labeled substrate with a large excess of unlabeled substrate. The procedures involved HPLC separation and liquid scintillation counting (LSC) of the [5-.sup.3H]-labeled 5 m-dC or the [1-.sup.3H]-labeled S-adenosylhomocysteine product in respective experiments.
[0069] Measurement of DNA Cyd KIEs. KIEs were measured by internal competition using a mixture of isotope-labeled (heavy) and remote-labeled (light) DNA substrates. .sup.14C- and .sup.3H-labeled hemimethylated 26-bp DNA and 1.0 mM nonlabeled SAM were incubated in a buffer of 20 mMTris.HCl (pH 7.4), 100 mM KCl, and 1 mM DTT at 37 C. The methylation reaction was initiated by the addition of human DNMT1. Reactions were quenched at different reaction intervals by placing tubes in a 95 C. heat block for 10 min, followed by cooling on ice. The quenched reactions (100 L) were treated with 20 L of 10 mM Tris.HCl (pH 7.9), 50 mM NaCl, 10 mM MgCl.sub.2, 1 mM DTT, 10 units of exonuclease III, 0.1 unit of snake venom phosphodiesterase I, and 0.5 unit of alkaline phosphatase. The DNA digestion (37 C. overnight) converted all DNA to mononucleosides (
[0070] The nucleoside mixture from each reaction aliquot was separated by a C18 column on an HPLC system equipped with a photodiode array detector. Cold carriers of dC and 5m-dC were added to samples to facilitate detection and collection. The dC and 5 m-dC were collected in glass scintillation vials and dried on a vacuum concentrator. The samples were dissolved in water and mixed thoroughly with 10 mL of scintillation fluid. The .sup.14C and .sup.3H radiation levels in both dC and 5 m-dC from each reaction were measured by LSC (five or more cycles). 14C-labeled dC nucleoside was used to standardize the scintillation channel energy crossover with .sup.3H in the low-energy range of 0-25 kiloelectron volts. Specific counts of the .sup.14C and .sup.3H isotopes were calculated by using the observed counts in both channels and the crossover ratio.
[0071] During each KIE experiment, control reactions that convert 100% of the labeled species to product were also conducted. Complete reactions (f=1) were achieved by extended incubation periods (24 h) with additional enzyme. These reactions were used to confirm the purity of radiolabels in the substrate (f=0) and to detect any nonreactive labels.
[0072] Measurement of SAM KIEs. KIEs were measured by internal competition using a mixture of isotope-labeled (heavy) and remote-labeled (light) SAM substrates. .sup.14C- and .sup.3H-labeled SAM and nonlabeled 26-bp hemimethylated DNA substrate were incubated in 100-t solutions with 20 mM Tris.HCl (pH 7.4), 100 mM KCl, and 1 mM DTT at 37 C. Methylation reactions were initiated by the addition of human DNMT1. Enzyme-free control reactions (n5) were incubated simultaneously to the enzyme reaction samples. Control samples quantitated the slow chemical degradation of SAM during the reaction and sample handling. Reactions were quenched by adding 20 L of 0.5 mM cold SAM and 50 mM H.sub.2SO.sub.4, and were stored immediately at 31 80 C. until HPLC purification.
[0073] Remaining unreacted SAM substrate from each reaction and control sample was purified by HPLC in ammonium formate buffer. The ds-DNA was trapped on the C18 guard column and was not observed as a defined peak. The .sup.14C and .sup.3H counts in the purified SAM were measured by LSC. Experimental KIEs were calculated from the isotope ratios present in the unreacted SAM substrate.
[0074] Computational Methods. The general procedures previously established (16) were followed to perform QM computational TS analysis of DNMT1. All of the geometry optimizations and frequency calculations were performed with Gaussian 09. In the final QM models, the GS of SAM was simulated using a density functional theory [with M06-2X functional (34) and 6-31+G(d,p) basis set], and the GS of DNA-Cyt and the TS of the methyl transfer were simulated using a two-layer ONIOM method (35, 36) [M062X/6-31+G(d,p):PM6] as implemented in Gaussian 09. The calculated vibrational frequencies were scaled by 0.967 to reproduce the true vibrational zero-point energies (37) for calculations of theoretical KIEs in the ISOEFF program (21) at the experimental temperature (37 C.).
Results
[0075] Isotope Labeling of DNA and SAM as DNMT1 Substrates. A library of six hemimethylated DNA and eight SAM substrates with site-specific isotope labels was synthesized to measure the respective KIEs. The isotopic labels were placed in chemical bond positions such that all atoms directly involved in the chemical steps of DNMT1-catalyzed reaction were represented. Six isotopically labeled dCTPs were prepared as the building blocks for the DNA substrates [5-.sup.2H, 5-.sup.14C]-, [5-.sup.13C, 5-.sup.14C]-, [6-.sup.3H]-, [6-.sup.14C]-, [5-.sup.3H.sub.2]-, and [5-.sup.14C]-dCTPs through coupled reactions using up to 14 different enzymes (18). Each isotopically labeled dCTP was incorporated into a 26-bp DNA by in vitro replication using Klenow fragment extension (
[0076] DNA and SAM Show Low Substrate Commitments in Vitro. In enzymatic reactions, the rate of chemical bond changes can be similar to the rates of substrate binding and product release. These rate similarities (called commitment factors) can obscure the values of the intrinsic chemical isotope effects and must be quantitated to permit calculation of intrinsic isotope effects. The forward commitment factor (C.sub.f) values for DNA and SAM were measured by isotope trapping experiments. These experiments used pulse-chase analysis to trace radiolabeled product formation over the course of the reaction. The C.sub.f values for DNA and SAM bound to DNMT1 were found to be small and insignificant (0.016 and 0.0013, respectively). The small C.sub.f values establish that DNA and SAM bind to and release from DNMT1 63 and 770 times, respectively, before each catalytic turnover and are not highly committed to the chemical steps. Small C.sub.f values demonstrate that DNMT1-catalyzed methyl transfer is much slower than substrate binding and release steps. DNA binding requires Cyt base-flipping by DNMT1, and with dsDNA, multiple excursions into the catalytic site are required to achieve the proper catalytic site geometry for methylation. As a result of small C.sub.f values, the experimental KIE values are not significantly reduced by the C.sub.fs and are within experimental error of intrinsic KIEs reporting on the rate-limiting chemical step(s) (
[0077] Ten KIEs at Nine Atomic Positions Define the TS Parameters. Ten KIEs were measured at nine atomic positions in experiments to determine the rate-limiting TS of DNMT1-catalyzed DNA methylation (
[0078] Intrinsic KIEs report on the chemical structure of the dominant TS for DNMT1. The KIEs from the methyl carbon (Me-C) and sulfur of SAM report directly on the extent of methyl transfer to C5 of Cyt at the TS. The KIEs of [Me-.sup.14C] (1.107), [Me-.sup.13C] (1.069), and [.sup.36S] (1.019) for SAM are near theoretical limits for their respective isotopic masses and establish a TS dominated by the methyl transfer step (
[0079] Methyl Transfer Is the Rate-Limiting Chemical Step. A quantitative demonstration of the TS for the DNMT1 reaction was obtained by comparing experimental KIEs with computationally predicted KIEs for each chemical TS as the highest barrier on the reaction coordinate, namely, the Cys1226 attack, methyl transfer, and -elimination (TS1, TS2, and TS3 in
[0080] TS Structure Reveals Stepwise DNMT1 Catalysis and Symmetrical Nucleophilic Substitution Methyl Transfer. A subangstrom structure of the DNMT1 TS was obtained by including close-contact protein residues and water molecules from the DNMT1 catalytic site (
[0081] The TS of DNMT1 is defined by 10 experimental and QM-predicted KIEs, and provides excellent agreement for all primary atomic positions (Table 1). Both the GS of DNA-Cyt and the TS of DNMT1 were simulated by a two-layer ONIOM [M062X/6-31+G(d,p):PM6] method. Cyt in free DNA was modeled by double-strand TCG (thymine, cytosine, guanine) base stacking (23, 24), and DNMT1 TS was simulated by a model, including SAM, deoxycytidine 5-monophosphate, eight DNMT1 residues, and three water molecules (196 atoms in total). Heavy atoms ([5-.sup.14C]- and [6-.sup.14C]-Cyt and [Me-.sup.13C]-, [Me-.sup.14C]-, and [.sup.36S]-SAM) KIEs are only influenced by covalent bond changes, not by binding interactions, and therefore reliably define the TS geometry. The final TS model describes a near-symmetrical nucleophilic substitution (S.sub.N2) TS for methyl transfer from the sulfur of SAM to C5 of Cyt of DNA. The bond distances from the Me-C to its donor and acceptor are d1=2.29 and d2=2.22 , with bond orders of 0.52 and 0.34, respectively. It is significant that these bond orders sum to less than 1.0 (0.86), indicating a loose (noncompressed) nucleophilic substitution reaction.
[0082] The DNMT1 methyl transfer TS involves a nearly complete covalent bond between the sulfur of Cys1226 and C6 with a bond distance of d3=1.93 and a bond order of 0.92. This TS structure is consistent with the stepwise mechanism depicted in
[0083] Natural bond orbital analysis (22) of the methyl transfer TS permits construction of an electrostatic potential surface that visualizes the polarity, electronegativity, and bond characteristics of the TS. The TS of DNMT1 shows a distribution of the positive charge in the direction of methyl transfer, originating from the SAM sulfonium ion and extending toward the Cyt ring. The electrostatic character of the reaction center at the TS is different from the SAM substrate and sinefungin, a relatively weak binding analog of SAM.
Discussion
[0084] DNA Cyt methyltransferases have been identified in organisms ranging from bacteria to humans. The bacterial enzymes perform DNA methylation to protect themselves from endogenous restriction enzymes. In mammalian cells, DNMTs have extensive N-terminal regulatory domains in addition to the catalytic domain, and the genomic methylation patterns are generally associated with gene regulation. Despite their differences in overall size and biological roles, the bacterial enzymes (exemplified by M.HhaI methyltransferase) and mammalian DNMT1 share a conserved set of active site residues in the covalent complex (4). They also catalyze similar steps (
[0085] The TS formed by DNMT1, resolved here to subangstrom resolution, is the most complex enzyme system yet analyzed by a combination of KIEs and quantum chemistry. In this TS structure, a nearly full bond is formed between Cys1226 and Cyt C6 (bond order=0.92), whereas the sum of two bond orders on the methyl transfer path (d1 and d2) is less than 1 (0.86). Whether the Cys attack occurs before or simultaneously with methyl transfer during DNMT catalysis has been debated. These results suggest a stepwise mechanism for DNMT1, where the Cys attack is not fully synchronized with methyl transfer. This evidence is also believed to be the first combined experimental and computational evidence that addresses concertedness for a DNMT.
[0086] Compression of the methyl donor and acceptor at the TS has been proposed for catechol-O-methyltransferases (COMTs) (25, 26), but has been disputed in theoretical studies (27, 28). In the DNMT1 TS, bond orders on the methyl transfer path (d1 and d2) sum to less than 1, indicating a loose S.sub.N2 substitution for the methyl transfer, in contrast to a compression-type TS claimed on COMT (25, 26). This discrepancy is not entirely surprising, given the major differences in the methyl acceptors and the catalytic mechanisms involved. Comparative results from COMT and DNMT1 suggest that diverse TS mechanisms exist among the SAM-dependent methyltransferases.
[0087] Inhibitors of human DNMT have been used in cancer therapy (29), because elevated CpG methylation in tumor repressors can result in carcinogenesis. However, all U.S. Food and Drug Administration-approved DNMT inhibitors are cytotoxic and mutagenic. Those inhibitors (i.e., 5-aza-cytidine, 5-aza-deoxycytidine) promote DNA demethylation by incorporation into host DNA to form covalent adducts between DNMTs and DNA. Other DNMT inhibitors have been identified from chemical library screening, but they often lack specificity against DNMTs (30). The subangstrom geometry and electrostatics details of the DNMT1 TS described here will assist the design of mechanism-based TS analog inhibitors for DNMT1. Solving the TS of DNMT1 provides proof of concept to gain mechanistic and chemical insights into complex enzyme reactions involved in epigenetic control (31, 32) and other macromolecular modifications.
TABLE-US-00002 TABLE 1 Experimental and theoretical KIEs KIEs predicted from simple Experiment model analysis.sup. Theoretical Position V/K KIEs* TS1 TS2 TS3 KIEs using ONIOM.sup. 5-.sup.13C 1.010 0.004 1.007 1.013 0.997 1.009 5-.sup.2H 0.991 0.005.sup. 1.048 0.973 4.036 0.955 6-.sup.14C 1.038 0.005 1.073 1.029 0.994 1.036 6-.sup.3H 0.94 0.01 0.971 0.874 1.066 0.901 Me.sup.14C 1.107 0.006 ND 1.106 0.980 1.110 Me.sup.13C 1.07 0.01 ND 1.055 0.989 1.057 Me.sup.3H.sub.3 0.980 0.006 ND 0.814 0.993 0.964 5-.sup.14C 0.979 0.008 ND 1.030 ND
0.996 5-.sup.3H.sub.2 1.073 0.003 ND 1.318 ND 1.066 .sup.36S 1.019 0.006 ND 1.016 ND 1.017 ND, not determined; V/K, maximum catalytic rate/Michaelis constant. * Intrinsic KIEs measured experimentally, represented by an average SD. .sup.KIEs predicted with the traditional TS theory, based on the vibrational differences between the GS structures and TS structures of each chemical step (FIG. 4). .sup.KIEs predicted for the methyl transfer TS structure by ONIOM (Gaussian's our own N-layered integrated molecular orbital and molecular mechanics) simulations (FIG. 5). No geometry constraints were necessary in the final model to reach the agreement with experimental KIEs. .sup.Representative primary data from six individual experiments, with the values 0.98798, 0.98422, 0.99363, 0.99452, 0.99435, and 0.98974, were used to calculate the experimental KIE for 5-.sup.2H shown in the table.
These atoms do not participate in this chemical step and will not contribute KIE values.
indicates data missing or illegible when filed
REFERENCES
[0088] 1. Bird A (2002) DNA methylation patterns and epigenetic memory. Genes Dev 16(1):6-21. [0089] 2. Jones P A, Baylin S B (2002) The fundamental role of epigenetic events in cancer. Nat Rev Genet 3(6):415-428. [0090] 3. Bestor T H (2000) The DNA methyltransferases of mammals. Hum Mol Genet 9(16):2395-2402. [0091] 4. Song J, Teplova M, Ishibe-Murakami S, Patel D J (2012) Structure-based mechanistic insights into DNMT1-mediated maintenance DNA methylation. Science 335(6069): 709-712. [0092] 5. Takeshita K, et al. (2011) Structural insight into maintenance methylation by mouse DNA methyltransferase 1 (Dnmt1). Proc Natl Acad Sci USA 108(22):9055-9059. [0093] 6. Song J, Rechkoblit O, Bestor T H, Patel D J (2011) Structure of DNMT1-DNA complex reveals a role for autoinhibition in maintenance DNA methylation. Science 331(6020):1036-1040. [0094] 7. Bashtrykov P, et al. (2012) Specificity of Dnmt1 for methylation of hemimethylated CpG sites resides in its catalytic domain. Chem Biol 19(5):572-578. [0095] 8. Wu J C, Santi D V (1987) Kinetic and catalytic mechanism of HhaI methyltransferase. J Biol Chem 262(10):4778-4786. [0096] 9. Chen L, Macmillan A M, Verdine G L (1993) Mutational separation of DNA-binding from catalysis in a DNA cytosine methyltransferase. J Am Chem Soc 115(12):5318-5319. [0097] 10. Klimasauskas S, Kumar S, Roberts R J, Cheng X (1994) HhaI methyltransferase flips its target base out of the DNA helix. Cell 76(2):357-369. [0098] 11. Zhang X, Bruice T C (2006) The mechanism of M.HhaI DNA C5 cytosine methyltransferase enzyme: A quantum mechanics/molecular mechanics approach. Proc Natl Acad Sci USA 103(16):6148-6153. [0099] 12. Yang J, Lior-Hoffmann L, Wang S, Zhang Y, Broyde S (2013) DNA cytosine methylation: Structural and thermodynamic characterization of the epigenetic marking mechanism. Biochemistry 52(16):2828-2838. [0100] 13. Pauling L (1946) Molecular architecture and biological reactions. Chem Eng News 24(10): 1375-1377. [0101] 14. Pearson A D, et al. (2015) Transition states. Trapping a transition state in a computationally designed protein bottle. Science 347(6224):863-867. [0102] 15. Cleland W W (1995) Isotope effects: Determination of enzyme transition state structure. Methods Enzymol 249:341-373. [0103] 16. Schramm V L (2011) Enzymatic transition states, transition-state analogs, dynamics, thermodynamics, and lifetimes. Annu Rev Biochem 80:703-732. [0104] 17. Hiller D A, Singh V, Zhong M, Strobel S A (2011) A two-step chemical mechanism for ribosome-catalysed peptide bond formation. Nature 476(7359):236-239. [0105] 18. Scott L G, Tolbert T J, Williamson J R (2000) Preparation of specifically 2H- and 13C-labeled ribonucleotides. Methods Enzymol 317:18-38. [0106] 19. Poulin M B, Du Q, Schramm V L (2015) Chemoenzymatic Synthesis of (36)S Isotopologues of Methionine and S-Adenosyl-L-methionine. J Org Chem 80(10):5344-5347. [0107] 20. Wu S E, Huskey W P, Borchardt R T, Schowen R L (1983) Chiral instability at sulfur of S-adenosylmethionine. Biochemistry 22(12):2828-2832. [0108] 21. Anisimov V, Paneth P (1999) ISOEFF98. A program for studies of isotope effects using Hessian modifications. J Math Chem 26(1-3):75-86. [0109] 22. Frisch M J, et al. (2009) Gaussian 09 (Gaussian, Inc., Wallingford, Conn.). [0110] 23. Cern-Carrasco J P, et al. (2011) Combined effect of stacking and solvation on the spontaneous mutation in DNA. Phys Chem Chem Phys 13(32):14584-14589. [0111] 24. Galano A, Alvarez-Idaboy J R (2012) On the evolution of one-electron-oxidized deoxyguanosine in damaged DNA under physiological conditions: A DFT and ONIOM study on proton transfer and equilibrium. Phys Chem Chem Phys 14(36):12476-12484. [0112] 25. Hegazi M F, Borchardt R T, Schowen R L (1979) -Deuterium and carbon-13 isotope effects for methyl transfer catalyzed by catechol O-methyltransferase. S.sub.N2-like transition state. J Am Chem Soc 101(15):4359-4365. [0113] 26. Zhang J, Klinman J P (2011) Enzymatic methyl transfer: Role of an active site residue in generating active site compaction that correlates with catalytic efficiency. J Am Chem Soc 133(43):17134-17137. [0114] 27. Ruggiero G D, Williams I H, Roca M, Moliner V, Tun I (2004) QM/MM determination of kinetic isotope effects for COMT-catalyzed methyl transfer does not support compression hypothesis. J Am Chem Soc 126(28):8634-8635. [0115] 28. Lameira J, Bora R P, Chu Z T, Warshel A (2015) Methyltransferases do not work by compression, cratic, or desolvation effects, but by electrostatic preorganization. Proteins 83(2):318-330. [0116] 29. Christman J K (2002) 5-Azacytidine and 5-aza-2-deoxycytidine as inhibitors of DNA methylation: Mechanistic studies and their implications for cancer therapy. Oncogene 21(35):5483-5495.
[0117] 30. Gros C, et al. (2012) DNA methylation inhibitors in cancer: Recent and future approaches. Biochimie 94(11):2280-2296. [0118] 31. Baylin S B, Jones P A (2011) A decade of exploring the cancer epigenomebiological and translational implications. Nat Rev Cancer 11(10):726-734. [0119] 32. Wigle T J, Copeland R A (2013) Drugging the human methylome: An emerging modality for reversible control of aberrant gene transcription. Curr Opin Chem Biol 17(3): 369-378. [0120] 33. Hemeon I, Gutierrez J A, Ho M C, Schramm V L (2011) Characterizing DNA methyltransferases with an ultrasensitive luciferase-linked continuous assay. Anal Chem 83(12):4996-5004. [0121] 34. Zhao Y, Truhlar D (2008) The M06 suite of density functionals for main group thermochemistry, thermochemical kinetics, noncovalent interactions, excited states, and transition elements: Two new functionals and systematic testing of four M06-class functionals and 12 other functionals. Theor Chem Acc 120(1-3):215-241. [0122] 35. Dapprich S, Komromi I, Byun K S, Morokuma K, Frisch M J (1999) A new ONIOM implementation in Gaussian 98. Part I. The calculation of energies, gradients, vibrational frequencies and electric field derivatives. Journal of Molecular Structure: THEOCHEM 461-462:1-21. [0123] 36. Vreven T, Morokuma K, Farkas O, Schlegel H B, Frisch M J (2003) Geometry optimization with QM/MM, ONIOM, and other combined methods. I. Microiterations and constraints. J Comput Chem 24(6):760-769. [0124] 37. Alecu I M, Zheng J, Zhao Y, Truhlar D G (2010) Computational Thermochemistry: Scale Factor Databases and Scale Factors for Vibrational Frequencies Obtained from Electronic Model Chemistries. J Chem Theory Comput 6(9):2872-2887. [0125] 38. Bagdassarian, C. K., Schramm, V. L., and Schwartz, S. D. (1996) Molecular electrostatic potential analysis for enzymatic substrates, competitive inhibitors and transition-state inhibitors, J. Am. Chem. Soc. 118, 8825-8836.