METHODS FOR PROGNOSING AND PREVENTING METASTATIC LIVER DISEASE
20180231558 ยท 2018-08-16
Inventors
Cpc classification
G01N2333/90245
PHYSICS
G01N2333/70596
PHYSICS
G01N2333/70557
PHYSICS
International classification
Abstract
The present invention is directed to a method for identifying an individual who is at risk for developing metastatic liver disease that involves measuring, in a sample isolated from the individual, exosomal levels of one or more markers of metastatic liver disease. Kits for carrying out this method are also disclosed. The present invention also relates to a method of preventing metastatic liver disease in an individual who are at risk for developing the disease that involves administering one or more inhibitors of liver pre-metastatic niche formation.
Claims
1. A method of identifying a subject having or at risk of developing metastatic liver disease, said method comprising: measuring, in a sample isolated from the subject, exosomal levels of one or more markers of metastatic liver disease selected from the group consisting of Annexin A1 (ANXA1), CD44, CD47, cadherin 1 (CDH1), filamin A (FLNA), high mobility group box 1 (HMGB1), integrin 3 (ITGB3), lectin galactoside-binding soluble 1 (LGALS1), lectin galactoside-binding soluble 3 (LGALS3), macrophage migration inhibitory factor (MIF), matrix metalloproteinase 14 (MMP14), plasminogen activator urokinase receptor (PLAUR), prostaglandin-endoperoxide synthase 2 (PTGS2), and ras-related C3 botulinum toxin substrate 1 (RAC1); comparing the measured exosomal levels of the one or more markers of metastatic liver disease to exosomal levels of the one or more markers of metastatic liver disease in a control sample; and identifying the subject as having or at risk of developing liver metastases when said subject has increased exosomal levels of the one or more markers of metastatic liver disease relative to control levels of the one or more markers of metastatic liver disease.
2. The method of claim 1, wherein the subject has a gastrointestinal tract cancer.
3.-4. (canceled)
5. The method of claim 1, wherein the subject has a pre-tumoral gastrointestinal lesion.
6. (canceled)
7. The method of claim 1, wherein said measuring comprises: measuring exosomal protein levels of the one or more markers of metastatic liver disease in the sample using an immunoassay.
8.-9. (canceled)
10. The method of claim 1, wherein said measuring comprises: measuring exosomal nucleic acid levels of the one or more markers of metastatic liver disease in the sample using a nucleic acid detection assay.
11.-13. (canceled)
14. The method of claim 1, wherein the control sample is a sample derived from non-cancerous cells or tissue.
15. (canceled)
16. The method of claim 1, wherein exosomal levels of MIF are measured.
17. (canceled)
18. The method of claim 1, wherein exosomal levels of at least four of the markers of metastatic liver disease are measured.
19. The method of claim 18, wherein the at least four markers of metastatic liver disease comprise ANXA1, FLNA, LGALS3, and MIF.
20. A method of inhibiting metastatic liver disease in a subject, said method comprising: selecting a subject having increased exosomal levels of one or more markers of metastatic liver disease relative to control exosomal levels of the one or more markers of metastatic liver disease wherein said markers of metastatic liver disease are selected from the group consisting of Annexin A1 (ANXA1), CD44, CD47, cadherin 1 (CDH1), filamin A (FLNA), high mobility group box 1 (HMGB1), integrin 3 (ITGB3), lectin galactoside-binding soluble 1 (LGALS1), lectin galactoside-binding soluble 3 (LGALS3), macrophage migration inhibitory factor (MIF), matrix metalloproteinase 14 (MMP14), plasminogen activator urokinase receptor (PLAUR), prostaglandin-endoperoxide synthase 2 (PTGS2), and ras-related C3 botulinum toxin substrate 1 (RAC1) and administering to the selected subject, an inhibitor of liver pre-metastatic niche (LPMN) formation in an amount effective to inhibit metastatic liver disease in the subject.
21. The method of claim 20, wherein the inhibitor of LPMN formation is selected from the group consisting of a MIF inhibitor, a TGF inhibitor, a fibronectin inhibitor, a macrophage inhibitor, a liver fibrosis inhibitor and any combination thereof.
22. The method of claim 21, wherein the MIF inhibitor is an anti-MIF antibody or a small molecule MIF antagonist.
23.-30. (canceled)
31. The method of claim 20, wherein the selected subject also has a gastrointestinal tract cancer.
32.-35. (canceled)
36. A method of identifying a subject having or at risk of developing metastatic liver disease, said method comprising: measuring, in a liver cell sample isolated from the subject, expression levels of one or more markers of liver pre-metastatic niche formation selected from the group consisting of matrix metallopeptidase 9 (MMP9), S100 protein B (S100B), S100 protein A8 (S100A8), connective tissue growth factor (CTGF), endothelin (EDN), platelet-derived growth factor (PDGF), CC motif chemokine 2 (CCL2), fibroblast growth factor-2 (FGF2), hepatocyte growth factor (HGF), interleukin-1 (IL-1), interleukin-6 (IL-6), insulin-like growth factor (IGF), transforming growth factor-beta (TGF) and vascular endothelial growth factor (VEGF); comparing the measured expression levels of the one or more markers of liver pre-metastatic niche formation to expression levels of the one or more markers of liver pre-metastatic niche formation in a control sample; and identifying the subject as having or at risk of developing liver metastases when said subject has increased expression levels of the one or more markers of liver pre-metastatic niche formation relative to control expression levels of the one or more markers of liver pre-metastatic niche formation.
37. The method of claim 36 further comprising: measuring, in a sample isolated from the subject, exosomal levels of one or more markers of metastatic liver disease selected from the group consisting of Annexin Al (ANXA1), CD44, CD47, cadherin 1 (CDH1), filamin A (FLNA), high mobility group box 1 (HMGB1), integrin 3 (ITGB3), lectin galactoside-binding soluble 1 (LGALS1), lectin galactoside-binding soluble 3 (LGALS3), macrophage migration inhibitory factor (MIF), matrix metalloproteinase 14 (MMP14), plasminogen activator urokinase receptor (PLAUR), prostaglandin-endoperoxide synthase 2 (PTGS2), and ras-related C3 botulinum toxin substrate 1 (RAC1); comparing the measured exosomal levels of the one or more markers of metastatic liver disease to exosomal levels of the one or more markers of metastatic liver disease in a control sample to identify increased exosomal levels of the one or more markers of metastatic liver disease in the sample, wherein said subject is identified as having or at risk of developing liver metastases when said subject has increased expression levels of the one or more markers of liver pre-metastatic niche formation relative to control expression levels and increased exosomal levels of the one or more markers of metastatic liver disease relative to control exosomal levels.
38. A kit suitable for prognosing metastatic liver disease comprising: detection reagents suitable for measuring exosomal levels of one or more markers of metastatic liver disease wherein said markers of metastatic liver disease are selected from the group consisting of Annexin A1 (ANXA1), CD44, CD47, cadherin 1 (CDH1), filamin A (FLNA), high mobility group box 1 (HMGB1), integrin 3 (ITGB3), lectin galactoside-binding soluble 1 (LGALS1), lectin galactoside-binding soluble 3 (LGALS3), macrophage migration inhibitory factor (MIF), matrix metalloproteinase 14 (MMP14), plasminogen activator urokinase receptor (PLAUR), prostaglandin-endoperoxide synthase 2 (PTGS2), and ras-related C3 botulinum toxin substrate 1 (RAC1).
39.-43. (canceled)
44. The kit according to claim 38, wherein said kit comprises detection reagents suitable for measuring exosomal levels of at least four of the markers of metastatic liver disease.
45. The kit according to claim 44, wherein the at least four markers of metastatic liver disease comprise ANXA1, FLNA, LGALS3, and MIF.
46. A kit according to claim 44 further comprising: detection reagents suitable for measuring expression levels of one or more markers of pre-metastatic niche formation wherein said markers of pre-metastatic niche formation are selected from the group consisting of matrix metallopeptidase 9 (MMP9), S100 protein B (S100B), S100 protein A8 (S100A8), connective tissue growth factor (CTGF), endothelin (EDN), platelet-derived growth factor (PDGF), CC motif chemokine 2 (CCL2), fibroblast growth factor-2 (FGF2), hepatocyte growth factor (HGF), interleukin-1 (Il-1), interleukin-6 (Il-6), insulin-like growth factor (IGF), transforming growth factor beta (TGF), and vascular endothelial growth factor (VEGF).
47. A kit suitable for prognosing metastatic liver disease comprising: detection reagents suitable for measuring expression levels of one or more markers of pre-metastatic niche formation wherein said markers of pre-metastatic niche formation are selected from the group consisting of matrix metallopeptidase 9 (MMP9), S100 protein B (S100B), S100 protein A8 (S100A8), connective tissue growth factor (CTGF), endothelin (EDN), platelet-derived growth factor (PDGF), CC motif chemokine 2 (CCL2), fibroblast growth factor-2 (FGF2), hepatocyte growth factor (HGF), interleukin-1 (Il-1), interleukin-6 (Il-6), insulin-like growth factor (IGF), transforming growth factor beta (TGF), and vascular endothelial growth factor (VEGF).
48.-50. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
DETAILED DESCRIPTION OF THE INVENTION
[0030] A first aspect of the present invention is directed to a method of identifying a subject having or at risk of developing metastatic liver disease. This method involves measuring, in a sample isolated from the subject, exosomal levels of one or more markers of metastatic liver disease selected from the group consisting of Annexin A1 (ANXA1), CD44, CD47, cadherin 1 (CDH1), filamin A (FLNA), high mobility group box 1 (HMGB1), integrin 3 (ITGB3), lectin galactoside-binding soluble 1 (LGALS1), lectin galactoside-binding soluble 3 (LGALS3), macrophage migration inhibitory factor (MIF), matrix metalloproteinase 14 (MMP14), plasminogen activator urokinase receptor (PLAUR), prostaglandin-endoperoxide synthase 2 (PTGS2), and ras-related C3 botulinum toxin substrate 1 (RAC1). The measured exosomal levels of the one or more markers of metastatic liver disease are compared to exosomal levels of the one or more markers of metastatic liver disease in a control sample. The method further involves identifying the subject as having or at risk of developing liver metastases when the subject has increased exosomal levels of the one or more markers of metastatic liver disease relative to control levels of the one or more markers of metastatic liver disease.
[0031] In accordance with this and all aspects of the invention, metastatic liver disease encompasses any disease that spreads from one organ or site in the body, i.e., the primary site of disease, to the liver. Metastatic liver disease typically involves, but is not limited to, the spread of malignant or pre-malignant tumor or cancer cells from a primary tumor site (i.e., primary cancer cells) to the liver. Virtually all gastrointestinal cancers have the potential to metastasize to the liver.
[0032] As used herein, subject refers to any animal which may be at risk for metastatic liver disease. In one embodiment, the subject is a mammal. Exemplary mammalian subjects include, without limitation, humans, non-human primates, dogs, cats, rodents (e.g., mouse, rat, guinea pig), horses, cattle and cows, sheep, and pigs.
[0033] In one embodiment, the subject at risk for metastatic liver disease is a subject having a primary tumor. For example, a subject at risk for metastatic liver disease is a subject having a gastrointestinal tract cancer. Gastrointestinal tract cancers include, without limitation, pancreatic cancer, colorectal cancer, intestinal cancer, stomach cancer, anal cancer, esophageal cancer, gallbladder cancer, and rectal cancer. Alternatively, the subject at risk for metastatic liver disease is a subject having lung or breast cancer. In another embodiment, the subject at risk for metastatic liver disease is a subject having leukemia or lymphoma (e.g., Hodgkin lymphoma). The subject at risk for metastatic liver disease maybe in complete or partial remission from the primary cancer or tumor. In another embodiment, the subject at risk for metastatic liver disease is not in complete or partial remission from the primary cancer or tumor.
[0034] In another embodiment, the subject at risk for metastatic liver disease is a subject having a pre-tumoral gastrointestinal lesion, such as, but not limited to pancreatitis, intraductual papillary mucinous neoplasia, pancreatic intraepithelial neoplasia, ulcerative colitis, Chron's disease, inflammatory bowel disease, colon polyps, rectal polyps, helicobacter pylori-associated gastritis, Barrett's esophagus, gallstones, porcelain gallbladder, choledochal cysts, gallbladder polyps, and primary sclerosing cholangitis.
[0035] As described herein, exosomal levels of one or more markers of metastatic liver disease are measured to determine whether a subject has or is at risk of developing metastatic liver disease. The exosomal markers of metastatic liver disease identified herein are listed in Table 1 below by their Gene name, Protein name(s), UniProtKB (Universal Protein Resource Knowledge Base) identification number, and GenBank accession numbers. The mRNA and amino acid sequences for these metastatic liver disease markers are well known in the art and widely available to one of skill in the art via their UniProKB or GenBank records (accessible via their UniProtKB identification number or GenBank accession number), both of which are hereby incorporated by reference in their entirety.
TABLE-US-00001 TABLE 1 Exosomal Markers of Metastatic Liver Disease UniProtKB GenBank Accession No. Gene Identification mRNA and amino acid Name Protein Name Alternative Names No. sequence ANXA1 Annexin A1 Annexin I P04083-1 X05908 mRNA. Annexin-1 Translation: CAA29338.1. Calpactin II BC001275 mRNA. Calpactin-2 Translation: AAH01275.1. Chromobindin-9 BC035993 mRNA. Lipocortin I Translation: AAH35993.1. Phospholipase A2 inhibitory protein p35 CD44 CD44 CDw44 P16070 M24915 mRNA. Epican (19 isoforms) Translation: AAA35674.1 Extracellular matrix P16070-1 thru M59040 mRNA. receptor III P16070-19 Translation: AAA51950.1. GP90 lymphocyte X55150 mRNA. homing/adhesion Translation: CAA38951.1. receptor X56794 mRNA. HUTCH-I Translation: CAA40133.1. Heparan sulfate Translation: CAA47271.1. proteoglycan X66733 mRNA. Hermes antigen Hyaluronate receptor Phagocytic glycoprotein 1 Phagocytic glycoprotein I CD47 Leukocyte Antigenic surface Q08722-1 X69398 mRNA. surface antigen determinant protein Q08722-2 Translation: CAA49196.1 CD47 OA3 Q08722-3 Z25521 mRNA. Integrin-associated Q08722-4 Translation: CAA80977.1 protein (IAP) BT006907 mRNA. Protein MER6 Translation: AAP35553.1 AK289813 mRNA. Translation: BAF82502.1 CDH1 Cadherin 1 CAM 120/80 P12830-1 Z13009 mRNA. Epithelial cadherin P12830-2 Translation: CAA78353.1. (E-cadherin) Z18923 mRNA. Uvomorulin Translation: CAA79356.1. CD324 L08599 mRNA. Translation: AAA61259.1. AB025105 mRNA. Translation: BAA88956.1. AK290012 mRNA. Translation: BAF82701.1 AK312551 mRNA. Translation: BAG35448.1. FLNA Filamin A Actin-binding protein 280 P21333-1 X53416 mRNA. (ABP-280) P21333-2 Translation: CAA37495.1. Alpha-filamin GU727643 mRNA. Endothelial actin-binding Translation: ADU87644.1. protein AK090427 mRNA. Filamin-1 Translation: BAC03408.2. Non-muscle filamin AB593010 mRNA. Translation: BAJ83965.1. HMGB1 High mobility High mobility group P09429-1 X12597 mRNA. group box 1 protein 1 (HMG-1) Translation: CAA31110.1. D63874 mRNA. Translation: BAA09924.1. AY377859 mRNA. Translation: AAQ91389.1. AK291494 mRNA. Translation: BAF84183.1. AK122825 mRNA. Translation: BAG53745.1. CR749614 mRNA. Translation: CAH18408.1. ITGB3 Integrin Beta 3 P05106-1 J02703 mRNA. P05106-2 Translation: AAA52589.1. P05106-3 M20311 mRNA. Translation: AAA60122.1. M35999 mRNA. Translation: AAA35927.1. U95204 mRNA. Translation: AAB71380.1. BC127666 mRNA. Translation: AAI27667.1. BC127667 mRNA. Translation: AAI27668.1. LGALS1 lectin, Galectin-1 P09382-1 X14829 mRNA. galactoside- 14 kDa laminin- Translation: CAA32938.1. binding, soluble, binding protein J04456 mRNA. 1 (HLBP14) Translation: AAA36170.1. 14 kDa lectin X15256 mRNA. Beta-galactoside- Translation: CAA33328.1. binding lectin L-14-I EU363770 mRNA. Galaptin Translation: ACA58297.1. HBL AB097036 mRNA. HPL Translation: BAC77389.1. Lactose-binding lectin CR456511 mRNA. 1 Translation: CAG30397.1. Putative MAPK- AK312161 mRNA. activating protein Translation: BAG35095.1. PM12 BT006775 mRNA. S-Lac lectin 1 Translation: AAP35421.1. LGALS3 lectin, 35 kDa lectin P17931 M57710 mRNA. galactoside- Carbohydrate-binding Translation: AAA35607.1. binding, soluble, protein 35 M35368 mRNA. 3 (CBP 35) Translation: AAA88086.1. Galactose-specific M36682 mRNA. lectin 3 Translation: AAA36163.1. Galactoside-binding S59012 mRNA. protein Translation: AAB26229.1. (GALBP) AB006780 mRNA. IgE-binding protein Translation: BAA22164.1. L-31 AK314929 mRNA. Laminin-binding Translation: BAG37435.1. protein CR456897 mRNA. Lectin L-29 Translation: CAG33178.1. Mac-2 antigen MIF macrophage Glycosylation- P14174-1 M25639 mRNA. migration inhibiting factor (GIF) Translation: AAA36315.1. inhibitory factor L-dopachrome L10612 mRNA. isomerase Translation: AAA35892.1. L-dopachrome Z23063 mRNA. tautomerase (EC:5.3.3. Translation: CAA80598.1. 12) AF469046 mRNA. Phenylpyruvate Translation: AAL78635.1. tautomerase EF611126 mRNA. Translation: ABQ95571.1. CR456520 mRNA. Translation: CAG30406.1. AK311929 mRNA. Translation: BAG34870.1. MMP14 matrix MMP-X1 P50281 D26512 mRNA. metalloproteinase Membrane-type matrix Translation: BAA05519.1. 14 (MMP-14) metalloproteinase 1 X83535 mRNA. (MT-MMP 1) Translation: CAA58519.1. Membrane-type-1 Z48481 mRNA. matrix Translation: CAA88372.1. metalloproteinase U41078 mRNA. (MT1-MMP) Translation: AAA83770.1. X90925 mRNA. Translation: CAA62432.1. AK291325 mRNA. Translation: BAF84014.1. PLAUR plasminogen Urokinase Q03405-1 X51675 mRNA. activator, plasminogen activator Q03405-2 Translation: CAA35981.1. urokinase surface receptor Q03405-3 M83246 mRNA. receptor (uPAR) Translation: AAA59862.1. Monocyte activation X74039 mRNA. antigen Mo3 Translation: CAA52191.1. CD87 U09347 mRNA. Translation: AAA17978.1. U08839 mRNA. Translation: AAB60333.1. PTGS2 prostaglandin- Prostaglandin G/H P35354 L15326 mRNA. endoperoxide synthase 2 Translation: AAA35803.1. synthase 2 Cyclooxygenase-2 M90100 mRNA. (COX-2) Translation: AAA58433.1. PHS II AY462100 mRNA. Prostaglandin H2 Translation: AAR23927.1. synthase 2 (PGH AK292167 mRNA. synthase 2 or PGHS-2 Translation: BAF84856.1. RAC1 ras-related C3 Cell migration- P63000-1 M29870 mRNA. botulinum toxin inducing gene 5 P63000-2 Translation: AAA36537.1. substrate 1 protein M31467 mRNA. Ras-like protein TC25 Translation: AAA36544.1. p21-Rac1 AJ132694 mRNA. Translation: CAA10732.1. AF136373 mRNA. Translation: AAD30547.1. AY279384 mRNA. Translation: AAQ16632.1. AF498964 mRNA. Translation: AAM21111.1. BT007121 mRNA. Translation: AAP35785.1.
[0036] In one embodiment, the expression level of at least one of the metastatic liver disease markers is measured and compared to a control expression level. Suitable control expression values are described infra. In one embodiment, the expression level of at least MIF is measured. In another embodiment, the exosomal expression levels of at least two of the markers are measured and compared to control values. In another embodiment, the exosomal expression levels of at least three of the markers are measured. In another embodiment, the exosomal expression levels of at least four of the markers are measured. In another embodiment the exosomal expression levels of at least 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or 14 of the markers are measured in a sample and compared to corresponding control values. In one embodiment, the expression levels of at least one, at least two, or at least three of the metastatic markers selected from ANXA1, FLNA, LGALS3, and MIF are measured. In another embodiment, the expression levels of at least ANXA1, FLNA, LGALS3, and MIF are measured.
[0037] In accordance with the present invention, exosomal levels of the one or more markers of metastatic liver disease are measured. Exosomes are microvesicles released from a variety of different cells, including cancer cells (i.e., cancer-derived exosomes). These small vesicles (50-100 nm in diameter) derive from large multivesicular endosomes and are secreted into the extracellular milieu. The precise mechanisms of exosome release/shedding remain unclear; however, this release is an energy-requiring phenomenon, modulated by extracellular signals. Exosomes appear to form by invagination and budding from the limiting membrane of late endosomes, resulting in vesicles that contain cytosol and that expose the extracellular domain of membrane-bound cellular proteins on their surface.
[0038] In accordance with the methods of the present invention, exosomes can be isolated or obtained from most biological fluids including, without limitation, blood, serum, plasma, ascites, cyst fluid, pleural fluid, peritoneal fluid, cerebral spinal fluid, tears, urine, saliva, sputum, lymph fluid, fluid of the respiratory, intestinal and genitourinary tracts, breast milk, intra-organ system fluid, or combinations thereof. In one embodiment, the exosomes are isolated or obtained from a gastrointestinal tract fluid, including, but not limited to, pancreatic juice, pancreatic duct fluid, intestinal juice, bile duct fluid, portal vein fluid, lymphatic fluid, and peritoneal fluid.
[0039] An enriched population of exosomes can be obtained from a biological sample using methods as described herein or otherwise known in the art. For example, exosomes may be concentrated or isolated from a biological sample using size exclusion chromatography, density gradient centrifugation, differential centrifugation (Raposo et al. B lymphocytes secrete antigen-presenting vesicles, J Exp Med 183(3): 1161-72 (1996), which is hereby incorporated by reference in its entirety), anion exchange and/or gel permeation chromatography (for example, as described in U.S. Pat. No. 6,899,863 to Dhellin et al., and U.S. Pat. No. 6,812,023 to Lamparski et al., which are hereby incorporated by reference in their entirety), sucrose density gradients or organelle electrophoresis (for example, as described in U.S. Pat. No. 7,198,923), magnetic activated cell sorting (MACS) (Taylor et al., MicroRNA signatures of tumor-derived exosomes as diagnostic biomarkers of ovarian cancer Gynecol Oncol 110(1): 13-21 (2008), which is hereby incorporated by reference in its entirety), nanomembrane ultrafiltration (Cheruvanky et al., Rapid isolation of urinary exosomal biomarkers using a nanomembrane ultrafiltration concentrator, Am J Physiol Renal Physiol 292(5): F1657-61 (2007), which is hereby incorporated by reference in its entirety), immunoaffinity capture using lectins or antibodies against exosomal markers such as CD63, CD81, EpCAM or Rab5, affinity purification, microfluidic separation, or combinations thereof.
[0040] Exosomes isolated from a bodily fluid can be enriched for those originating from a specific cell type, for example, pancreas, stomach, intestine, bladder, kidney, colorectal, prostate, esophagus, or the liver. Because the exosomes often carry surface molecules such as antigens from their donor cells, surface molecules may be used to identify, isolate and/or enrich for exosomes from a specific donor cell type. In this way, the expression levels of metastatic liver disease markers can be measured in exosomes originating from a desired cell population. In one embodiment, tumor (malignant and non-malignant) exosomes carry tumor-associated surface antigens and may be detected, isolated and/or enriched via selection for these specific tumor-associated surface antigens. For example, the cell surface proteoglycan, glypican-1 (GPC1), which is a marker of exosomes derived from pancreatic tumors (Melo et al., Glypican-1 Identified Cancer Exosomes and Detects Early Pancreatic Cancer, Nature 523(7559):177-82 (2015), which is hereby incorporated by reference in its entirety), can be used to enrich for pancreatic cancer derived exosomes. Alternatively, the epithelial-cell-adhesion-molecule (EpCAM), which is a surface antigen specifically expressed on exosomes from carcinomas of lung, colorectal, breast, prostate, head and neck, and hepatic origin (Balzar et al., The Biology of the 17-1A Antigen (Ep-CAM), J Mol Med 77(10): 699-712 (1999); Went et al. Frequent EpCam Protein Expression in Human Carcinomas, Hum Pathol 35(1): 122-8 (2004), which are hereby incorporated by reference in their entirety) can be utilized to enrich for exosomes from these tumor types. In yet another example, the surface antigen is CD70, carcinoembryonic antigen (CEA), EGFR, EGFRvIII and other variants, Fas ligand, TRAIL, transferrin receptor, p38.5, p97 and HSP72. Alternatively, tumor specific exosomes may be characterized by the lack of surface markers, such as the lack of CD80 and CD86 expression.
[0041] The isolation of exosomes from specific cell types can be accomplished, for example, by using antibodies, aptamers, aptamer analogs or molecularly imprinted polymers specific for a desired surface antigen. In one embodiment, the surface antigen is specific for a cancer type. In another embodiment, the surface antigen is specific for a cell type which is not necessarily cancerous. One example of a method of exosome separation based on cell surface antigen is provided in U.S. Pat. No. 7,198,923, which is hereby incorporated by reference in its entirety. As described in, e.g., U.S. Pat. No. 5,840,867 to Toole and U.S. Pat. No. 5,582,981 to Toole, which are hereby incorporated by reference in their entirety, aptamers and their analogs specifically bind surface molecules and can be used as a separation tool for retrieving cell type-specific exosomes. Molecularly imprinted polymers also specifically recognize surface molecules as described in, e.g., U.S. Pat. Nos. 6,525,154, 7,332,553 and 7,384,589, which are hereby incorporated by reference in their entirety, and are a tool for retrieving and isolating cell type-specific exosomes.
[0042] Exosomal expression levels is intended to encompass production of any product by a gene including but not limited to transcription of mRNA and translation of polypeptides, peptides, and peptide fragments. Measuring or detecting expression levels encompasses assaying, measuring, quantifying, scoring, or detecting the amount, concentration, or relative abundance of a gene product. It is recognized that a method of evaluating expression of one type of gene product, such as a polypeptide, may not be suitable for assaying another type of gene product, such as a nucleic acid. It is recognized that methods of assaying a gene product include direct measurements and indirect measurements. One skilled in the art is capable of selecting an appropriate method of evaluating expression of a particular gene product.
[0043] In one embodiment, exosomal expression levels of the one or more markers of metastatic liver disease are measured using a nucleic acid detection assay. In one embodiment, the DNA levels are measure. In another embodiment, RNA, e.g., mRNA, levels are measured. RNA is preferably reverse-transcribed to synthesize complementary DNA (cDNA), which is then amplified and detected or directly detected. The detected cDNA is measured and the levels of cDNA serve as an indicator of the RNA or mRNA levels present in a sample. Reverse transcription may be performed alone or in combination with an amplification step, e.g., reverse transcription polymerase chain reaction (RT-PCR), which may be further modified to be quantitative, e.g., quantitative RT-PCR as described in U.S. Pat. No. 5,639,606, which is hereby incorporated by reference in its entirety.
[0044] In accordance with this embodiment, the exosomal fraction that is isolated from a bodily fluid of a subject can be pre-treated with DNase or RNase to eliminate or substantially eliminate any DNA located on the surface or outside of the exosomes. Without such pre-treatment, short nucleic acid fragments on the outside of the exosomes may remain and co-isolate with nucleic acids extracted from inside the exosomes. Thus, elimination of all or substantially all nucleic acids associated with the outside or surface of the exosomes by pre-treatment of with DNase and/or RNase, has the ability to enrich for internal exosomal nucleic acids (i.e., DNA or RNA).
[0045] It may be beneficial or otherwise desirable to extract DNA or RNA from the exosomes prior to or for analysis. DNA and RNA molecules can be isolated from an exosome and the concentration of each (i.e., total DNA or total RNA) quantified using any number of procedures, which are well-known in the art, the particular extraction procedure chosen based on the particular biological sample. In some instances, with some techniques, it may also be possible to analyze the nucleic acid without extraction from the exosome.
[0046] In one embodiment, the extracted nucleic acids, including DNA and/or RNA, are analyzed directly without an amplification step. Direct analysis may be performed with different methods including, but not limited to, nanostring technology (Geiss et al. Direct Multiplexed Measurement of Gene Expression with Color-Coded Probe Pairs, Nat Biotechnol 26(3): 317-25 (2008), which is hereby incorporated by reference in its entirety). Nanostring technology enables identification and quantification of individual target molecules in a biological sample by attaching a color coded fluorescent reporter to each target molecule. This approach is similar to the concept of measuring inventory by scanning barcodes. Reporters can be made with hundreds or even thousands of different codes allowing for highly multiplexed analysis. In another embodiment, direct analysis can be performed using immunohistochemical techniques.
[0047] In another embodiment, it may be beneficial or otherwise desirable to amplify the nucleic acids of the exosome prior to detection/analysis. Methods of nucleic acid amplification, including quantitative amplification, are commonly used and generally known in the art. Quantitative amplification will allow quantitative determination of relative amounts of the various exosomal nucleic acids.
[0048] Nucleic acid amplification methods include, without limitation, polymerase chain reaction (PCR) (U.S. Pat. No. 5,219,727, which is hereby incorporated by reference in its entirety) and its variants such as in situ polymerase chain reaction (U.S. Pat. No. 5,538,871, which is hereby incorporated by reference in its entirety), quantitative polymerase chain reaction (U.S. Pat. No. 5,219,727, which is hereby incorporated by reference in its entirety), nested polymerase chain reaction (U.S. Pat. No. 5,556,773), self sustained sequence replication and its variants (Guatelli et al. Isothermal, In vitro Amplification of Nucleic Acids by a Multienzyme Reaction Modeled after Retroviral Replication, Proc Natl Acad Sci USA 87(5): 1874-8 (1990), which is hereby incorporated by reference in its entirety), transcriptional amplification and its variants (Kwoh et al. Transcription-based Amplification System and Detection of Amplified Human Immunodeficiency Virus type 1 with a Bead-Based Sandwich Hybridization Format, Proc Natl Acad Sci USA 86(4): 1173-7 (1989), which is hereby incorporated by reference in its entirety), Qb Replicase and its variants (Miele et al. Autocatalytic Replication of a Recombinant RNA. J Mol Biol 171(3): 281-95 (1983), which is hereby incorporated by reference in its entirety), cold-PCR (Li et al. Replacing PCR with COLD-PCR Enriches Variant DNA Sequences and Redefines the Sensitivity of Genetic Testing. Nat Med 14(5): 579-84 (2008), which is hereby incorporated by reference in its entirety) or any other nucleic acid amplification method known in the art. Depending on the amplification technique that is employed, the amplified molecules are detected during amplification (e.g., real-time PCR) or subsequent to amplification using detection techniques known to those of skill in the art. Suitable nucleic acid detection assays include, for example and without limitation, northern blot, microarray, serial analysis of gene expression (SAGE), next-generation RNA sequencing (e.g., deep sequencing, whole transcriptome sequencing, exome sequencing), gene expression analysis by massively parallel signature sequencing (MPSS), immune-derived colorimetric assays, and mass spectrometry (MS) methods (e.g., MassARRAY System).
[0049] In another embodiment of the present invention, exosomal protein levels of the one or more markers of metastatic liver disease are measured. Exosomal protein levels can be measured using an immunoassay. Generally, an immunoassay involves contacting the exosomal sample from the subject with one or more binding reagents, e.g., an antibody, where each binding reagent is capable of binding to one of the one or more markers of metastatic liver disease. The binding reagent is coupled to a detectable label, either directly or indirectly. For example, an antibody can be directly coupled to a detectable label or indirectly coupled to a detectable label via a secondary antibody. The one or more labeled binding reagents bound to their respective marker of metastatic liver disease (i.e., a binding reagent-marker complex) in the sample is detected, and the amount of labeled binding reagent that is detected serves as an indicator of the amount or expression level of marker present in the sample. Immunoassays that are well known in the art and suitable for measuring exosomal protein levels of the one or markers of metastatic liver disease include, for example and without limitation, an immunohistochemical assay, radioimmunoassay, enzyme-linked immunosorbent assay (ELISA), immunoradiometric assay, gel diffusion precipitation reaction, immunodiffusion assay, in situ immunoassay, western blot, precipitation reaction, complement fixation assay, immunofluorescence assay, and immunoelectrophoresis assay.
[0050] In another embodiment, exosomal protein expression levels are measured using one-dimensional and two-dimensional electrophoretic gel analysis, high performance liquid chromatography (HPLC), reverse phase HPLC, Fast protein liquid chromatograph (FPLC), mass spectrometry (MS), tandem mass spectrometry, liquid crystal-MS (LC-MS) surface enhanced laser desorption/ionization (SELDI), MALDI, and/or protein sequencing.
[0051] The exosomal expression levels of the one or more markers of metastatic liver disease is compared to a control expression level of the same one or more markers to identify a subject as one that is at risk for metastatic liver disease. In one embodiment, the control expression level of a marker is the average expression level of the marker in exosomal samples taken from a cohort of healthy individuals (i.e., the average expression level in non-cancerous exosomal samples). In another embodiment, the control expression level is the average expression level of the marker in exosomal samples taken from individuals having a primary tumor, e.g., a gastrointestinal tumor, that never metastasized to the liver or other organ of the body. In another embodiment, the control expression level of a marker is the expression level of the marker in an exosomal sample taken from the subject being tested, but at an earlier time point (e.g., a pre-cancerous time point). In all of these embodiments, an increased expression level of the one or more markers of metastatic liver disease in the sample from the subject relative to the control exosomal expression level identifies the subject as having or at risk of developing metastatic liver disease.
[0052] An increased expression level refers to an expression level (i.e., protein or gene expression level) that is higher than the control level. For example, an increased expression level is at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 80%, at least 100%, at least 2-fold, at least 3-fold, at least 5-fold, at least 10-fold, at least 50-fold or at least 100-fold higher than the control expression level.
[0053] In another embodiment, the control expression level of a marker is the average expression level of the marker in exosomal samples taken from individuals having a primary tumor, e.g., a gastrointestinal tumor, that later metastasized. Alternatively, the control expression level of a marker is the average expression level of the marker in exosomal samples taken from individuals with metastatic liver disease. In accordance with this embodiment, when the exosomal expression level of a marker in the subject being tested is the same as the control expression level, the subject is identified as having or at risk of developing metastatic liver disease.
[0054] Another aspect of the present invention is directed to a method of identifying a subject having or at risk of developing metastatic liver disease. This methods involves measuring, in a liver cell sample isolated from the subject, expression levels of one or more markers of liver pre-metastatic niche formation selected from the group consisting of matrix metallopeptidase 9 (MMP9), S100 protein B (S100B), S100 protein A8 (S100A8), connective tissue growth factor (CTGF), endothelin-1 (EDN1), platelet-derived growth factor-B (PDGFB), CC motif chemokine 2 (CCL2), fibroblast growth factor-2 (FGF2), hepatocyte growth factor (HGF), interleukin-1 (IL-1A and IL-1B), interleukin-6 (IL-6), insulin-like growth factor-1 (IGF1), transforming growth factor beta (TGF) and vascular endothelial growth factor (VEGF). The measured expression levels of the one or more markers of liver pre-metastatic niche formation are compared to expression levels of the one or more markers of liver pre-metastatic niche formation in a control sample and the subject is identified as having or at risk of developing liver metastases when the subject has increased expression levels of the one or more markers of liver pre-metastatic niche formation relative to control expression levels of the one or more markers of liver pre-metastatic niche formation.
[0055] The one or more markers of liver pre-metastatic niche formation can be measured independently or in combination with the one or more exosomal markers of metastatic liver disease as described supra to identify a subject having or at risk of developing liver metastases. As described herein, these markers of liver pre-metastatic niche formation include the gene products (i.e., mRNA or protein) that are upregulated in the Kupffer cells of the liver as a result of exosomal education. A subset of the identified markers of liver pre-metastatic niche formation identified herein are listed in Table 2 below by their Gene name, Protein name(s), UniProtKB (Universal Protein Resource Knowledge Base) identification number, and GenBank accession numbers. The mRNA and amino acid sequences for these pre-metastatic niche formation markers are well known in the art and widely available to one of skill in the art via their UniProtKB or GenBank records (accessible via their UniProtKB identification number or GenBank accession number), both of which are hereby incorporated by reference in their entirety. Additional markers of liver pre-metastatic niche formation (i.e., liver cell genes that are upregulated >1.5 fold upon exosome education) are listed in the
TABLE-US-00002 TABLE 2 Markers of Liver Pre-metastatic Niche Formation UniProtKB GenBank Accession No. Gene Identification mRNA and amino acid Name Protein Name Alternative Names No. sequence MMP9 Matrix 92 kDa gelatinase P14780 J05070 mRNA. metallopeptidase 9 92 kDa type IV Translation: AAA51539.1. collagenase AK313137 mRNA. Gelatinase B Translation: BAG35956.1. (GELB) BC006093 mRNA. Translation: AAH06093.1. S100B S100 protein B S-100 protein beta P04271 CR542123 mRNA. chain Translation: CAG46920.1. S-100 protein BC001766 mRNA. subunit beta Translation: AAH01766.1. S100 calcium- binding protein B S100A8 S100 protein A8 Calgranulin-A P05109 Y00278 mRNA. Calprotectin L1L Translation: CAA68390.1. subunit X06234 mRNA. Cystic fibrosis Translation: CAA29580.1. antigen (CFAG) AK291328 mRNA. Leukocyte L1 Translation: BAF84017.1. complex light chain CR407674 mRNA. Migration inhibitory Translation: CAG28602.1. factor-related protein 8 (MRP-8) (p8) S100 calcium- binding protein A8 Urinary stone protein band A CTGF connective Q5M8T4 BC087839 mRNA. tissue growth Translation: AAH87839.1. factor EDN1 Endothelin-1 Preproendothelin-1 P05305 Y00749 mRNA. (PPET1) Translation: CAA68718.1. S56805 mRNA. Translation: AAB25760.1. PDGFB platelet-derived PDGF-2 P01127 X02811 mRNA. growth factor Platelet-derived Translation: CAA26579.1. subunit B growth factor B X02744 mRNA. chain Translation: CAA26524.1. Platelet-derived M12783 mRNA. growth factor beta Translation: AAA60553.1. polypeptide Proto-oncogene c- Sis CCL2 C-C motif HC11 P13500 M24545 mRNA. chemokine 2 Monocyte Translation: AAA18164.1. chemoattractant M28226 mRNA. protein 1 Translation: AAA60309.1. Monocyte S71513 mRNA. chemotactic and Translation: AAB20651.1. activating factor (MCAF) Monocyte chemotactic protein 1 (MCP-1) Monocyte secretory protein JE Small-inducible cytokine A2 FGF2 fibroblast Basic fibroblast P09038 J04513 mRNA. growth factor-2 growth factor Translation: AAA52531.1. (bFGF) J04513 mRNA. Heparin-binding Translation: AAA52532.1. growth factor 2 J04513 mRNA. (HBGF-2) Translation: AAA52533.1. HGF hepatocyte Hepatopoietin-A P14210 M29145 mRNA. growth factor Scatter factor (SF) Translation: AAA52650.1. X16323 mRNA. Translation: CAA34387.1. M60718 mRNA. Translation: AAA52648.1. IL1A Interleukin-1 IL-1 alpha P01583 X02531 mRNA. alpha Hematopoietin-1 Translation: CAA26371.1. X02851 mRNA. Translation: CAA26604.1. X56086 mRNA. Translation: CAA39566.1. M28983 mRNA. Translation: AAA59134.1. IL1B Interleukin-1 Catabolin P01584 K02770 mRNA. beta Translation: AAA36106.1. X02532 mRNA. Translation: CAA26372.1. M15330 mRNA. Translation: AAA59135.1. IL-6 interleukin-6 B-cell stimulatory P05231 X04430 mRNA. factor 2 (BSF-2) Translation: CAA28026.1. CTL differentiation M14584 mRNA. factor (CDF) Translation: AAA52728.1. Hybridoma growth X04602 mRNA. factor Translation: CAA28268.1. Interferon beta-2 (IFN-beta-2) IGF Insulin-like Mechano growth P05019 M11568 mRNA. growth factor I factor (MGF) Translation: AAA52539.1. Somatomedin-C M37484 mRNA. Translation: AAA52789.1. X57025 mRNA. Translation: CAA40342.1. VEGF vascular Vascular P15692 M32977 mRNA. (VEGFA) endothelial permeability factor Translation: AAA35789.1. growth factor A (VGF) M27281 mRNA. (VEGF-A) Translation: AAA36807.1. X62568 mRNA. Translation: CAA44447.1. AJ010438 mRNA. Translation: CAA09179.1.
[0056] In one embodiment, the expression level of at least one of the pre-metastatic niche formation markers is measured and compared to a control expression level. In another embodiment, the expression levels of at least two of the markers are measured and compared to control values. In another embodiment, the expression levels of at least three of the markers are measured. In another embodiment, the expression levels of at least four of the markers are measured. In another embodiment the expression levels of at least 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or 14 of the markers are measured in a sample and compared to corresponding control values.
[0057] The expression level of the one or more markers of liver pre-metastatic niche formation is compared to a control expression level of the same one or more markers to identify a subject as one that is at risk for metastatic liver disease. In one embodiment, the control expression level of a marker is the average expression level of the marker in liver samples taken from a cohort of healthy individuals (i.e., the average expression level in non-cancerous liver samples). In another embodiment, the control expression level is the average expression level of the marker in liver samples taken from individuals having a primary tumor, e.g., a gastrointestinal tumor that never metastasized to the liver or other organ of the body. In another embodiment, the control expression level of a marker is the expression level of the marker in a liver sample taken from the subject being tested, but at an earlier time point (e.g., a pre-cancerous time point). In all of these embodiments, an increased expression level of the one or more markers of liver pre-metastatic niche formation in the sample from the subject relative to the control exosomal expression level identifies the subject as having or at risk of developing metastatic liver disease.
[0058] As described above, an increased expression level refers to an expression level (i.e., protein or gene expression level) that is higher than the control level. For example, an increased expression level is at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 80%, at least 100%, at least 2-fold, at least 3-fold, at least 5-fold, at least 10-fold, at least 50-fold or at least 100-fold higher than the control expression level.
[0059] In another embodiment, the control expression level of a marker is the average expression level of the marker in liver samples taken from individuals having a primary tumor, e.g., a gastrointestinal tumor, that later metastasized. Alternatively, the control expression level of a marker is the average expression level of the marker in liver samples taken from individuals with metastatic liver disease. In accordance with this embodiment, when the exosomal expression level of a marker in the subject being tested is substantially the same as the control expression level, the subject is identified as having or at risk of developing metastatic liver disease.
[0060] Suitable methods for measuring gene and protein expression levels of the one or more markers of liver pre-metastatic niche formation are described supra.
[0061] Another aspect of the present invention is directed to a method of inhibiting metastatic liver disease in a subject. This method involves selecting a subject having increased exosomal expression levels of one or more markers of metastatic liver disease relative to control exosomal expression levels of the one or more markers of metastatic liver disease. The markers of metastatic liver disease are selected from the group consisting of Annexin A1 (ANXA1), CD44, CD47, cadherin 1 (CDH1), filamin A (FLNA), high mobility group box 1 (HMGB1), integrin 3 (ITGB3), lectin galactoside-binding soluble 1 (LGALS1), lectin galactoside-binding soluble 3 (LGALS3), macrophage migration inhibitory factor (MIF), matrix metalloproteinase 14 (MMP14), plasminogen activator urokinase receptor (PLAUR), prostaglandin-endoperoxide synthase 2 (PTGS2), and ras-related C3 botulinum toxin substrate 1 (RAC1). This method further involves administering to the selected subject, an inhibitor of liver pre-metastatic niche (LPMN) formation in an amount effective to inhibit metastatic liver disease in the subject.
[0062] In an alternative embodiment, the method involves selecting a subject having increased liver cell expression levels of one or more markers of liver pre-metastatic niche formation relative to control liver cell expression levels of the one or more markers of liver pre-metastatic niche formation. The markers of liver pre-metastatic niche formation are selected from the group consisting matrix metallopeptidase 9 (MMP9), S100 protein B (S100B), S100 protein A8 (S100A8), connective tissue growth factor (CTGF), endothelin-1 (EDN1), platelet-derived growth factor-B (PDGFB), CC motif chemokine 2 (CCL2), fibroblast growth factor-2 (FGF2), hepatocyte growth factor (HGF), interleukin-1 (IL-1A and IL-1B), interleukin-6 (IL-6), insulin-like growth factor-1 (IGF1), transforming growth factor beta (TGF) and vascular endothelial growth factor (VEGF)
[0063] In accordance with this aspect of the present invention, the selected subject may also have a primary tumor or cancer, e.g., a gastrointestinal tract cancer, lung tumor, breast tumor, leukemia or lymphoma. In one embodiment, the primary tumor or cancer is in partial remission or complete remission. In another embodiment, the primary cancer or tumor is not in remission. As described supra, gastrointestinal tract cancers, include, without limitation, pancreatic cancer, intestinal cancer, colorectal cancer, stomach cancer, anal cancer, esophageal cancer, gallbladder cancer, and rectal cancer.
[0064] The methods for detecting exosomal expression levels of the one or more markers of metastatic liver disease and liver cell expression levels of the one or more markers of pre-metastatic niche formation that are described supra are suitable for identifying subjects that are candidates for the administration of an LPMN inhibitor in accordance with this aspect of the present invention.
[0065] As described herein, the induction of liver pre-metastatic niche formation is caused by an increase in transforming growth factor (TGF ) secretion from Kupffer cells, an upregulation of fibronectin production by hepatic stellate cells, and the recruitment of bone marrow-derived macrophages. All of these changes are orchestrated by the overexpression of MIF in tumor derived exosomes that are taken up by the Kupffer cells. Accordingly, suitable inhibitors of LPMN formation include MIF inhibitors, TGF inhibitors, fibronectin inhibitors, macrophage inhibitors, liver fibrosis inhibitors, and any combination of these aforementioned inhibitors.
[0066] In one embodiment, the LPMN formation inhibitor is a small molecule MIF antagonist. MIF is a major regulator of inflammation and mediator of the innate immune response. Therefore, MIF has been identified as a therapeutic target for the treatment of various inflammatory and autoimmune diseases. Current development of small molecule inhibitors of MIF has focused on rational structure based design targeting the tautomerase active site of MIF. There are several classes of small molecule MIF tautomerase inhibitors known in the art and suitable for use in accordance with this aspect of the present invention (see Garai and Lrnd, Macrophage Migration Inhibitory Factor (MIF) Tautomerase Inhibitors as Potential Novel Anti-Inflammatory Agents: Current Developments, Curr. Med. Chem. 16: 1091-1114 (2009), which is hereby incorporated by reference in its entirety). These classes of small molecule MIF antagonists include, without limitation, (i) dopachrome derivatives (see e.g., the dopachrome analogues disclosed in Zhang and Bucala, Inhibition of Macrophage Migration Inhibitory Factor (MIF) Tautomerase Activity by Dopachrome Analogs, Bioorg. Med. Chem Lett., 9:3193-8 (1999), which is hereby incorporated by reference in its entirety), (ii) acetaminophen derivatives (see e.g., N-acetyl-p-benzoquinone imine (NAPQI) and 3-hydroxy derivatives as disclosed by Senter et al., Inhibition of Macrophage Migration Inhibitory Factor (MIF) Tautomerase and Biological Activities by Acetaminophen Metabolites, PNAS 99: 144-49 (2002) and U.S. Pat. No. 6,492,428 to Al-Abed et al., which are hereby incorporated by reference in their entirety), (iii) phenylpyruvic acid derivatives (see e.g., the enolacetates described in Haasbroek et al., Enol Tautomer of the Acetate Ester of 3-methoxy-4-hydroxyphenylpyruvic acid: Crystallographic and NMR spectroscopic Evidence, J. Chem. Cryst., 28: 193-96 (1998), and Haasbroek et al., Design and Synthesis of 2,4-difluorophenylpyruvic Acid and of its Azlactone Precursor for Macrophage Migration Inhibitory Factor (MIF) Tautomerase Activity, J. Mol. Struc. 690:89-94 (2004), which are hereby incorporated by reference in their entirety), (iv) substituted Schiff bases (see e.g., the substituted Schiff base condensation products disclosed in U.S. Pat. No. 6,599,938 to Al-Abed and Bucala, which is hereby incorporated by reference in its entirety), (v) isoxazoline derivatives including ISO-1 ((S,R)-3-(4-hydroxyphenyl)-4,5-dihydro-5-isoxazole acetic acid methyl ester), and the substituted isoxazoline ring systems described in U.S. Pat. No. 8,552,040 to Al-Abed, Cheng et al., Critical Modifications of the ISO-1 Scaffold Improve its Potent Inhibition of Macrophage Migration Inhibitory Factor (MIF) Tautomerase Activity, Bioorg. Med. Chem. Lett., 16:3376-79 (2006), and Stojanovic et al., In vitro, Ex vivo, and In vivo Immuno-pharmacological Activities of the Isoxazoline Compound VGX-1027: Modulation of Cytokine Synthesis and Prevention of Both Organ-Specific and Systemic Autoimmune Diseases in Murine Models, Clin. Immunol. 123: 311-23 (2007), which are hereby incorporated by reference in their entirety, (vi) cinnamates, see e.g. (E)-2-fluoro-p-hydroxycynnamate as disclosed by Taylor et al., Crystal Structure of Macrophage Migration Inhibitory Factor Complexed with (E)-2-fluoro-p-hydroxycynnamate at 1.8 Resolution: Implications for Enzymatic Catalysis and Inhibition, Biochemistry 38: 7444-52 (1999), which is hereby incorporated by reference in its entirety, (vii) acetylenic compounds such as 2-oxo-3-pentynoate and 2-oxo-3-butynoate (see Johnson et al., Inactivation of 4-oxalocrotonate Tautomerase by 2-oxo-3-pentynoate, Biochemistry 36: 15724-32 (1997) and Taylor et al., Crystal Structure of 4-oxalocrotonate Tautomerase Inactivated by 2-oxo-3-pentynotate at 2.4 Resolution: Analysis and Implications for the Mechanism of Inactivation and Catalysis, Biochemistry 37: 14692-700 (1998), which are hereby incorporated by reference in their entirety), (viii) , unsaturated ketones and ketone bodies (1,3-diketones) (see Garai et al., MIF Tautomerase Inhibitor Potency of ,-unsaturated Cyclic Ketones, Int. Immunopharmacol. 7: 1741-6 (2007) and Garai et al., Ketone Bodies Affect the Enzymatic Activity of Macrophage Migration Inhibitory Factor, Life Sci. 77:1375-80 (2005), which are hereby incorporated by reference in their entirety), (ix) plant derived compounds, including natural compounds belonging to phenyl propane and coumarin derivatives (see Garai et al., Plant-derived Anti-Inflammatory Compounds Affect MIF Tautomerase Activity, Int. Immunopharmacol. 5:849-56 (2005), which is hereby incorporated by reference in its entirety), (v) curcumin and its derivatives (see Garai et al., Plant-derived Anti-Inflammatory Compounds Affect MIF Tautomerase Activity, Int. Immunopharmacol. 5:849-56 (2005), which is hereby incorporated by reference in its entirety), and (vi) oxygen heterocycles such as 7-hydroxy-coumarins, 7-hydroxychromen-4-ones, 7-hydroxychroman-2,4-diones, and related flavonoids (see Orita et al., Coumarin and Chromen-4-one Analogues as Tautomerase Inhibitors of Macrophage Migration Inhibitory Factor: Discovery and X-ray Crystallography, J. Med. Chem. 44: 540-47 (2001), which is hereby incorporated by reference in its entirety).
[0067] In another embodiment, suitable MIF inhibitors include factors which inhibit MIF release or which inhibit or neutralize MIF activity, such as MIF antisense RNA molecules and MIF monoclonal or polyclonal antibodies and antibody binding fragments and domains thereof. These MIF inhibitors are known in the art and described in, e.g., U.S. Patent Application Publication 2008/0317759 to Bucala and Chesney, which is hereby incorporated by reference in its entirety.
[0068] In another embodiment, the LPMN formation inhibitor is a fibronectin inhibitor, such as an inhibitory fibronectin binding peptide or an inhibitory fibronectin antibody. In one embodiment, the inhibitory fibronectin binding peptide is thrombospondin protein fragment, such as those described in U.S. Pat. No. 5,849,701 to Roberts et al., which is hereby incorporated by reference in its entirety. Other peptides suitable for inhibiting fibronectin polymerization and, subsequently, fibronectin deposition include bacterial adhesin derived peptides. Bacterial adhesin based peptides that bind fibronectin and inhibit polymerization include pUR4, FNZ.sub.r2, and FNBPA.sub.9-10 as shown in Table 2 below and disclosed in Chiang et al., Fibronectin Is an Important Regulator of Flow-Induced Vascular Remodeling, Arterioscler. Thromb. Vasc. Biol. 29(7):1084-9 (2009), Tomasini-Johansson et al., Peptide from Adhesin F1 Inhibits Fibronectin Matrix Assembly, J. Biol. Chem. 276:23430-23439 (2001), Ozeri et al., A Two-Domain Mechanism for Group A Streptococcal Adherence Through Protein F to the Extracellular Matrix, Embo J. 15(5):989-998 (1996), Lindmark et al., Fibronectin-Binding Protein of Streptococcus equi subsp. Zooepidemicus, Infect. Immun. 64(10):3993-3999 (1996), and Meenan et al., The Tandem Beta-zipper Model Defines High Affinity Fibronectin-Binding Repeats within Staphylococcus aureus FNBPA, J. Biol. Chem. 282(35):25893-25902 (2007), which are hereby incorporated by reference in their entirety).
TABLE-US-00003 TABLE3 BacterialAdhesinDerivedFibronectinBinding Peptides pUR4 KDQSPLAGESGETEYITEVYGNQQNPVDIDKKLP NETGFSGNMVETEDT(SEQIDNO:1) FNZr2 RNPHLMGIGGGLAGESGETTPKPGQTGGQGPVIETTEDTQ KGMSGQSGGTIESENTKKPEVMIGGQGQTIETTEDTQKGM SGQSGGTIESEDTKKP(SEQIDNO:2) FNBPA9- YEQGGNIVDIDFDSVPQIHGQNKGNQSFEEDTEKDKPKYE 10 HGGNIIDIDFDSVPHIHGFIBRONECTINKHTEIIEEDTN KDKP(SEQIDNO:3)
[0069] Fibronectin binding proteins or polypeptides that are homologous to the bacterial adhesin peptides of Table 3 are also suitable for use in the methods of the present invention. Homologous proteins or polypeptides are preferably characterized by an amino acid sequence identity of at least about 60 percent, at least about 70 percent, at least 80 percent, at least 85 percent, at least 90 percent, or at least 95 percent as compared to the amino acid sequences of SEQ ID NOs 1-3 above.
[0070] Other fibronectin binding proteins and polypeptides that are suitable for use in the present invention include fibronectin-derived peptides that inhibit fibronectin polymerization, including the 70-kDa amino terminal fibronectin fragment described by Sottile et al., Recombinant 70-kDa Protein from the Amino-Terminal Region of Rat Fibronectin Inhibits Binding of Fibronectin to Cells and Bacteria, Protein Expr. Pur 1(2):104-110 (1990) and Sottile et al., N-Terminal Type I Modules Required for Fibronectin Binding to Fibroblasts and to Fibronectin's III1 Module, Biochem. J. 323:51-60 (1997), which are hereby incorporated by reference in their entirety.
[0071] In another embodiment, the fibronectin inhibitor comprises an RGD containing peptide that blocks fibronectin by binding to its cell surface receptor, i.e., 51. Suitable RGD peptides that inhibit fibronectin are disclosed in, e.g., WO2008045252 to Cochran, WO1998056407 to Cleary, and U.S. Pat. No. 5,627,263 to Ruoslahti, which are hereby incorporated by reference in their entirety.
[0072] Antibodies, including monoclonal, polyclonal, and fragments thereof, that bind to fibronectin and inhibit its deposition directly or inhibit its polymerization are also suitable for use in the methods of the present invention. Chernousov et al., Role of the I-9 and III-1 Modules of Fibronectin in Formation of an Extracellular Fibronectin Matrix, J. Bio. Chem. 266(17):10851-58 (1991), which is hereby incorporated by reference in its entirety, describes the isolation and characterization of the 9D2 antibody, which recognizes the first type III module of fibronectin and inhibits fibronectin polymerization and deposition. The 92D antibody and other antibodies, or antibody fragments thereof, directed to similar epitopes of fibronectin are suitable for use in the methods of the present invention. The L8 antibody, which recognizes the region spanning the type I-9 and type III-1 modules of fibronectin, also inhibits fibronectin deposition (Chernousov et al., Role of the I-9 and III-1 Modules of Fibronectin in Formation of an Extracellular Fibronectin Matrix, J. Bio. Chem. 266(17):10851-58 (1991), which is hereby incorporated by reference in its entirety). The L8 antibody and other antibodies or antibody fragments thereof, recognizing similar epitopes of fibronectin are suitable for use in the methods of the present invention.
[0073] In another embodiment, the LPMN formation inhibitor is a TGF inhibitor. In one embodiment, the TGF inhibitor is a small molecule that antagonizes the TGF type I receptors, i.e., the activin receptor-like kinases (ALKs), and/or the TGF type II receptor. Exemplary TGF receptor antagonists known in the art include, but are not limited to those identified in Table 4 below as well as their derivatives and analogues thereof.
TABLE-US-00004 TABLE 4 TGF Receptor Antagonists Receptor Name Chemical Name Structure Target A83-01.sup.1 3-(6-Methyl-2-pyridinyl)-N-phenyl- 4-(4-quinolinyl)-1H-pyrazole-1- carbothioamide
[0074] Another small molecule TGF inhibitor suitable for use in accordance with this aspect of the present invention is Halofuginone (Hfg). Hfg is a synthetic derivative of the plant alkaloid febrifugine, a traditional Chinese herbal medicine. Hfg increases expression of Smad7, an intracellular inhibitor of TGF-beta signaling (Juarez et al., Halofuginone inhibits the establishment and progression of melanoma bone metastases, Cancer Res., 72(23):6247-56 (2012), which is hereby incorporated by reference in its entirety).
[0075] Other small molecule inhibitors of TFG include any and all of the imidazo[2,1-b][1,3,4]thiadiazole derivatives disclosed in U.S. Pat. No. 8,389,554 to Hoelzemann et al., as well as the small molecule inhibitors of TGF signaling disclosed in U.S. Pat. No. 7,511,056 to Diefenbacher et al. and U.S. Patent Publication No. 20110160210 to Fleenor et al., which are hereby incorporated by reference in their entirety.
[0076] In another embodiment, the TFG inhibitor is an antibody, e.g., monoclonal, polyclonal, and fragments or antibody domains thereof, that bind to TFG and inhibit its signaling activity. Suitable TFG antibodies are known in the art and include, e.g., LY2382770, a neutralizing monoclonal TFG1 antibody, and 1D11, a pan-specific TGF neutralizing antibody. Other antibodies known to inhibit TFG activity or production that are suitable for use in the methods described herein are disclosed in U.S. Pat. No. 8,569,462 to Bedinger and U.S. Pat. No. 7,147,852 to Gilbertson, respectively, which are hereby incorporated by reference in their entirety.
[0077] In another embodiment, the TFG inhibitor is an inhibitory peptide. Suitable inhibitor TFG inhibitory peptides are known in the art and include, without limitation, P17 (Val Leu Ala Leu Tyr Asn Gln His Asn Pro Gly Ala Ser Ala; SEQ ID NO: 4) and P144 (Thr Ser Leu Asp Ala Ser Ile Ile Tip Ala Met Met; SEQ ID NO: 5) and related peptides described in U.S. Pat. No. 7,057,013 to Ezquerro, which is hereby incorporated by reference in its entirety.
[0078] In another embodiment, the TGF inhibitor is an inhibitory nucleic acid molecule, such as, but not limited to AP 11014. AP11014 is a TGF1 antisense oligonucleotide shown to significantly reduce TGF1 secretion in various cancer cell lines (Schlingensiepen et al., The TGF-beta1 antisense oligonucleotide AP 11014 for the treatment of non-small cell lung, colorectal and prostate cancer: Preclinical studies, J. Clin. Oncology, 22(14S): 3132 (2004), which is hereby incorporated by reference in its entirety). Other TGF antisense oligonucleotides or inhibitory nucleic acid molecules known in the art can also be employed in the methods of the present invention.
[0079] In another embodiment, the LPMN formation inhibitor is a macrophage inhibitor that is capable of preventing macrophages from binding to fibronectin enriched hepatic sites. In one embodiment, the macrophage inhibitor is an antibody capable of binding to a macrophage cell membrane protein such as CSF-1, CD40, DRS, CD64, or the like. In one embodiment, the antibody is conjugated to an anti-tumor agent, e.g., a chemotherapeutic agent or an anti-tumor antibiotic. In this embodiment, the chemotherapeutic agent or other anti-tumor agent coupled to the antibody is delivered in a cell specific manner to induce cell death.
[0080] In another embodiment, the macrophage inhibitor is a small molecule. Small molecule macrophage inhibitors that are known in the art and are suitable for use in the methods described herein include, without limitation, doxycycline, GW2580 (5-[[3-Methoxy-4-[(4-methoxyphenyl)methoxy]phenyl]methyl]-2,4-pyrimidinediamine) (Conway et al, Inhibition of Colony-stimulating-factor-1 Signaling In vivo with the Orally Bioavailable cFMS Kinase Inhibitor GW2580, PNAS 102(44): 16078-83 (2005), which is hereby incorporated by reference in its entirety), etodolac (Gervais et al., The Effect of the Non-steroidal Anti-inflammatory Drug Etodolac on Macrophage Migration In vitro and In vivo, J. Immunopharmacol. 6(2):205-14 (1984), which is hereby incorporated by reference in its entirety, and dexamethasone. In another embodiment, the macrophage inhibitor is a liposome containing clodronate. Such liposome specifically target and induce macrophage death (van Rooijen and Hendrikx, Liposomes for Specific Depletion of Macrophages from Organs and Tissue, Methods Mol. Biol. 605: 189-203 (2010), which is hereby incorporated by reference in its entirety).
[0081] In another embodiment, the LPMN formation inhibitor is an inhibitor of liver fibrosis. As described herein exosomal education activates Kupffer cells and induces liver fibrosis pathways that facilitate liver metastasis. Accordingly, inhibitors of proteins that are known to promote liver fibrosis and are shown herein to be upregulated in Kupffer cells are also suitable for inhibiting LPMN formation. These proteins and their known inhibitors are listed in Table 5 below. In another embodiment, the inhibitor is an inhibitor of any one of the genes/proteins listed in
TABLE-US-00005 TABLE 5 Kupffer cell proteins involved in liver fibrosis that are induced by cancer cell exosomes and their known inhibitors Molecule Inhibitors Molecule Inhibitors Connective tissue mAb FG-3019 C-C motif chemokine CCR2 Antagonist growth factor 2 (CCL2) (CAS 445479-97-0) (CTGF) Endothelin (EDN) Sulfisoxazole Fibroblast growth Suramin sodium factor-2 (FGF2), BQ-123, Sodium Salt PD 166866 BQ-610 Hepatocyte growth SU11274 factor (HGF) CI 1020 PHA-665752 Kendomycin JNJ38877605 BMS 182874 Ficlatuzumab hydrochloride Sclerotiorin Rilotumumab Zibotentan TAK-701 Bosentan AMG-208 Ambrisentan BMS-777607 Sitaxsentan Sodium Compound 1 (Amgen) PD 151,242 EMD 1214063/EMD 1204831 h224G11 Bosentan-d4 INC280 Macitentan JNJ38877605 Platelet-derived Imatinib mesylate Onartuzumab growth factor (MetMAb) MK-2461 (PDGF) Imatinib MK-8033 Tyrphostin A23 NK4 Tyrphostin AG 1295 PF4217903 Tyrphostin 9 PHA665752 AG 494 SGX126 Masitinib Tivantinib (ARQ 197) AP 24534 Motesanib Diphosphate Interleukin-1 (IL-1) Suramin sodium DMPQ dihydrochloride Methotrexate-methyl- d3 Oxindole I Methotrexate-methyl- d3, Dimethyl Ester AG-370 7-Hydroxy Methotrexate-d3 RG-13022 Nilvadipine 3-(4- Diacerein Isopropylbenzylidenyl)- indolin-2-one VEGFR Tyrosine Kinase Inhibitor IV PP121 Interleukin-6 (IL-6) Galiellalactone Sunitinib Malate Pazopanib Vascular endothelial Suramin sodium growth factor (VEGF) PD 161570 NVP-BHG712 Dovitinib, Free Base Indole-3-acetamide Tyrphostin 47 Nintedanib esylate 4,4-Bis(4- Lenvatinib aminophenoxy)biphenyl MMP9 GM 6001 5-Amino-2- methylindole ARP 100 Sulochrin Actinonin SB-3CT MMP-9 Inhibitor I MMP Inhibitor II MMP-2/MMP-9 Inhibitor II MMP9 (Cont) Ageladine A, TFA NNGH MMP-2/MMP-9 Inhibitor V Chlorhexidine, Dihydrochloride MMP-2/MMP-9 Inhibitor I MMP-9/MMP-13 inhibitor I CP 471474 MMP Inhibitor V cis-ACCP ARP 101 MMP-9/MMP-13 Inhibitor II 4-Aminobenzoyl-Gly- Pro-D-Leu-D-Ala hydroxamic acid
[0082] In accordance with this aspect of the present invention, the LPMN formation inhibitor may be administered alone, in combination with one or more other LPMN formation inhibitors, and/or in combination with another inhibitor of metastatic disease progression, such as, a chemotherapeutic, a radiotherapeutic, an anti-angiogenic therapeutic, a stromal inhibitor, and an extracellular matrix protein inhibitor.
[0083] Suitable chemotherapeutic agents for combination therapies include, without limitation, alkylating agents (e.g., chlorambucil, cyclophophamide, CCNU, melphalan, procarbazine, thiotepa, BCNU, and busulfan), antimetabolites (e.g., methotrexate, 6-mercaptopurine, and 5-fluorouracil), anthracyclines (e.g., daunorubicin, doxorubicin, idarubicin, epirubicin, and mitoxantrone), antitumor antibiotics (e.g., bleomycin, monoclonal antibodies (e.g., Alemtuzumab, Bevacizumab, Cetuximab, Gemtuzumab, Ibritumomab, Panitumumab, Rituximab, Tositumomab, and Trastuxmab), platinums (e.g., cisplatin and oxaliplatin) or plant alkaloids (e.g., topoisomerase inhibitors, vinca alkaloids, taxanes, and epipodophyllotoxins).
[0084] Anti-angiogenic or anti-vasculogenic therapeutics suitable for use in combination with an LPMN formation inhibitor of the invention include, without limitation a vascular endothelial growth factor (VEGF) inhibitor, basic fibroblast growth factor (bFGF) inhibitor, vascular endothelial growth factor receptor (VEGFR) antagonist, platelet-derived growth factor receptor (PDGFR) antagonist, fibroblast growth factor receptor (FGFR) antagonist, Angiopoietin receptor (Tie-2) antagonist, epidermal growth factor receptor (EGFR, ErbB) antagonist, or any combination thereof. A number of suitable small molecule angiogenic inhibitors are known in the art and are under clinical development (see e.g., Wu et al., Anti-Angiogenic Therapeutic Drugs for the Treatment of Human Cancer, J Cancer Molecules 4(2):37-45 (2008) and Bissell et al., Why Don't We Get More Cancer? A Proposed Role of the Microenvironment in Restraining Cancer Progression, Nat. Med. 17(3):320-329 (2011), which are hereby incorporated by reference in their entirety). These angiogenic inhibitors include, without limitation, Endostatin (an endothelial cell proliferation and angiogenesis inhibitors), Gefitinib (an ErbB inhibitor), Lapatinib (a dual ErbB1/ErbB2 inhibitor), Erlotinib (HER1/EGFR inhibitor), Canertinib (a pan-ErbB inhibitor), Vatalanib (VEGF receptor inhibitor), Imatinib (multi-targeted inhibitor of Bcr-Abl, c-kit, and PDGF-R inhibitor), Sunitinib (multi-targeted inhibitor of VEGFR, PDGFR, Kit, Flt3, Tet and CSF1R), Sorafenib (multi-targeted inhibit of VEGFR and PDGFR), Pazopanib (a multi-targeted inhibitor of VEGFR-1, VEGFR-2, VEGFR-3, PDGF-, PDGFR-, and c-kit). Alternatively, the anti-vasculogenic therapeutic is a monoclonal antibody. Suitable antibody therapeutics include, without limitation, Bevacizumab (VEGF antibody), IMC-1C11 (VEGFR-2 antibody), mF4-31C1 (VEGFR-3 antibody), and Vitaxin (integrin .sub.v.sub.3 antibody).
[0085] Suitable stromal inhibitors for use in the methods described herein are known in the art (see Bissell et al., Why Don't We Get More Cancer? A Proposed Role of the Microenvironment in Restraining Cancer Progression, Nat. Med. 17(3):320-329 (2011), which is hereby incorporated by reference in its entirety) and include, without limitation, MK-2461 (a small molecule inhibit of c-MET kinase), Anastrazole (an aromatase inhibitor), AMD070 (a CXCR4 inhibitor), IPI-926 (a hedgehog pathway inhibitor), AVE1642 (a humanized monoclonal antibody targeting insulin-like growth factor-1 receptor), BGJ398 (a small molecule inhibitor of fibroblast growth factor receptors), Celecoxib (a COX-2 inhibitor), MK0822 (a cathepsin K inhibitor), Bortezomib (a 26S proteasome complex inhibitor), Zoledronate (a small-molecule pyrophosphate analog that inhibits the differentiation of myeloid cells and affects tumor-associated macrophages), Denosumab (a human monoclonal antibody the binds RANKL), and PG545, a heparan sulfate mimetic that inhibits heparanase activity.
[0086] Suitable extracellular matrix protein inhibitors include, without limitation, DX2400, an MMP-14 inhibitor; PEGPH20, a covalently modified form of hyaluronidase which catalyzes the degradation of the extracellular matrix component hyaluronan.
[0087] In another embodiment of the present invention, the LPMN inhibitor is administered as a part of an adjuvant therapy regime. In particular, this involves administration of the LPMN formation inhibitor alone or together with chemotherapy, hormone therapy, radiation therapy, immunotherapy, or a targeted therapy prior to and/or after surgery. In addition, the present invention may be used to treat patients after primary surgery who may not otherwise receive treatment, i.e. those patients with primary complete resection without evidence of residual or distant disease in order to prevent liver pre-metastatic niche formation and, therefore, metastatic spread.
[0088] Pharmaceutical compositions containing LPMN formation inhibitors suitable for use in the methods of the present invention can include a pharmaceutically acceptable carrier and optionally one or more other active agents packaged together in a suitable delivery vehicle. Suitable delivery vehicles include, but are not limited to viruses, bacteria, biodegradable microspheres, microparticles, nanoparticles, liposomes, collagen minipellets, and cochleates.
[0089] In practicing the methods of the present invention, the administering step is carried out to achieve inhibition of liver pre-metastatic niche formation and/or metastatic liver disease progression. Such administration can be carried out systemically or via direct or local administration. By way of example, suitable modes of systemic administration include, without limitation orally, topically, transdermally, parenterally, intradermally, intramuscularly, intraperitoneally, intravenously, subcutaneously, or by intranasal instillation, by intracavitary or intravesical instillation, intraocularly, intraarterialy, intralesionally, or by application to mucous membranes. Suitable modes of local administration include, without limitation, catheterization, implantation, direct injection, dermal/transdermal application, or portal vein administration to relevant tissues, or by any other local administration technique, method or procedure generally known in the art. The mode of affecting delivery of agent will vary depending on the type of therapeutic agent (e.g., an antibody, small molecule, or inhibitory nucleic acid or peptide molecule).
[0090] The agents of the present invention may be orally administered, for example, with an inert diluent, or with an assimilable edible carrier, or it may be enclosed in hard or soft shell capsules, or it may be compressed into tablets, or they may be incorporated directly with the food of the diet. Agents of the present invention may also be administered in a time release manner incorporated within such devices as time-release capsules or nanotubes. Such devices afford flexibility relative to time and dosage. For oral therapeutic administration, the agents of the present invention may be incorporated with excipients and used in the form of tablets, capsules, elixirs, suspensions, syrups, and the like. Such compositions and preparations should contain at least 0.1% of the agent, although lower concentrations may be effective and indeed optimal. The percentage of the agent in these compositions may, of course, be varied and may conveniently be between about 2% to about 60% of the weight of the unit. The amount of an agent of the present invention in such therapeutically useful compositions is such that a suitable dosage will be obtained.
[0091] When the LPMN formation inhibitors of the present invention are administered parenterally, solutions or suspensions of the agent can be prepared in water suitably mixed with a surfactant such as hydroxypropylcellulose. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof in oils. Illustrative oils are those of petroleum, animal, vegetable, or synthetic origin, for example, peanut oil, soybean oil, or mineral oil. In general, water, saline, aqueous dextrose and related sugar solution, and glycols, such as propylene glycol or polyethylene glycol, are preferred liquid carriers, particularly for injectable solutions. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
[0092] Pharmaceutical formulations suitable for injectable use include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. In all cases, the form must be sterile and must be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol), suitable mixtures thereof, and vegetable oils.
[0093] When it is desirable to deliver the agents of the present invention systemically, they may be formulated for parenteral administration by injection, e.g., by bolus injection or continuous infusion. Formulations for injection may be presented in unit dosage form, e.g., in ampoules or in multi-dose containers, with an added preservative. The compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
[0094] Intraperitoneal or intrathecal administration of the agents of the present invention can also be achieved using infusion pump devices. Such devices allow continuous infusion of desired compounds avoiding multiple injections and multiple manipulations.
[0095] In addition to the formulations described previously, the agents may also be formulated as a depot preparation. Such long acting formulations may be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt
[0096] Effective doses of the compositions of the present invention, for the treatment of a primary tumor or metastatic disease vary depending upon many different factors, including type and stage of cancer, means of administration, target site, physiological state of the patient, other medications or therapies administered, and physical state of the patient relative to other medical complications. Treatment dosages need to be titrated to optimize safety and efficacy.
[0097] Another aspect of the present invention is directed to a kit suitable for prognosing metastatic liver disease that includes detection reagents suitable for measuring exosomal levels of one or more markers of metastatic liver disease using any of the detection/quantitation methods described supra. The markers of metastatic liver disease include, without limitation, annexin Al (ANXA1), CD44, CD47, cadherin 1 (CDH1), filamin A (FLNA), high mobility group box 1 (HMGB1), integrin 3 (ITGB3), lectin galactoside-binding soluble 1 (LGALS1), lectin galactoside-binding soluble 3 (LGALS3), macrophage migration inhibitory factor (MIF), matrix metalloproteinase 14 (MMP14), plasminogen activator urokinase receptor (PLAUR), prostaglandin-endoperoxide synthase 2 (PTGS2), and ras-related C3 botulinum toxin substrate 1 (RAC1).
[0098] In one embodiment, the kit contains reagents to detect at least two markers of metastatic liver disease, at least three markers of metastatic liver disease, at least four markers of metastatic liver disease, at least five markers of metastatic liver disease, or at least 6, 7, 8, 9, 10, 11, 12, 13, or all 14 of the markers of metastatic liver disease.
[0099] In one embodiment, the detection reagents of the kit include oligonucleotide primers or probes suitable for measuring the expression of nucleic acid transcripts of the one or more markers of metastatic liver disease by quantitative PCR. In another embodiment, the detection reagents of the kit are oligonucleotide probes suitable for measuring the expression of nucleic acid transcripts of the one or more markers of metastatic liver disease using a nucleic acid hybridization assay, e.g., microarray detection. The kit may include detection reagents for detecting the exosomal expression of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or all 14 markers of metastatic liver disease. In one embodiment, the kit includes oligonucleotide primers or probes suitable for measuring the expression of MIF. In another embodiment, the kit includes oligonucleotide primers or probes suitable for measuring the expression of ANXA1. In another embodiment, the kit includes oligonucleotide primers or probes suitable for measuring the expression of FLNA. In another embodiment, the kit includes oligonucleotide primers or probes suitable for measuring the expression of LGALS3. In yet another embodiment, the kit includes oligonucleotide primers or probes suitable for measuring any combination of MIF, ANXA1, FLNA, and LGALS3. Oligonucleotide primers suitable for qPCR detection and oligonucleotide probes suitable for nucleic acid hybridization based detection can readily be designed based on the mRNA sequences of the metastatic liver disease markers which are known in the art.
[0100] In another embodiment, the detection reagents of the kits are antibodies (e.g., polyclonal or monoclonal) or antibody binding fragments thereof that are suitable for detecting and measuring exosomal levels of the one or more markers of metastatic liver disease using any of the immunoassays described supra. In one embodiment, the kit contains reagents suitable for carrying out an enzyme-linked immunosorbent assay (ELISA), e.g., a solid support coated with antibodies suitable for binding to the one or more markers of metastatic disease, detection antibodies and wash reagents. The kit may include reagents for detecting exosomal protein levels of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or all 14 markers of metastatic liver disease.
[0101] The kit of the present invention may further include detection reagents suitable for measuring expression levels of one or more markers of pre-metastatic niche formation. These markers pre-metastatic niche formation include, without limitation matrix metallopeptidase 9 (MMP9), S100 protein B (S100B), S100 protein A8 (S100A8), connective tissue growth factor (CTGF), endothelin-1 (EDN1), platelet-derived growth factor-B (PDGFB), CC motif chemokine 2 (CCL2), fibroblast growth factor-2 (FGF2), hepatocyte growth factor (HGF), interleukin-1 (IL-1A and IL-1B), interleukin-6 (IL-6), insulin-like growth factor-1 (IGF1), transforming growth factor beta (TGF) and vascular endothelial growth factor (VEGF).
[0102] In another aspect of the present invention, the kit suitable for prognosing metastatic liver disease comprises detection reagents suitable for measuring expression levels of one or more markers of pre-metastatic niche formation using any of the detection/quantitation methods described supra. The one or more markers of pre-metastatic niche formation include, without limitation, matrix metallopeptidase 9 (MMP9), S100 protein B (S100B), S100 protein A8 (S100A8), connective tissue growth factor (CTGF), endothelin-1 (EDN1), platelet-derived growth factor-B (PDGFB), CC motif chemokine 2 (CCL2), fibroblast growth factor-2 (FGF2), hepatocyte growth factor (HGF), interleukin-1 (IL-1A and IL-1B), interleukin-6 (IL-6), insulin-like growth factor-1 (IGF1), transforming growth factor beta (TGF) and vascular endothelial growth factor (VEGF).
[0103] In one embodiment, the kit contains reagents to detect at least two markers of pre-metastatic niche formation, at least three markers of pre-metastatic niche formation, at least four markers of pre-metastatic niche formation, at least five markers of pre-metastatic niche formation, or at least 6, 7, 8, 9, 10, 11, 12, 13, or 14 of the markers of pre-metastatic niche formation. Suitable detection reagents, e.g., oligonucleotide primers, probes, and antibodies are described supra.
[0104] Kits provided herein may comprise a carrier, package or container that is compartmentalized to receive one or more container such as vials, tubes, and the like. A kit provided herein may comprise additional containers comprising materials desirable from a commercial, clinical or user standpoint, including but not limited to, buffers, diluents, filters, needles, syringes, and package inserts with instructions for use. A kit may also contain positive or negative controls and may provide a known sample to be used as a predetermined standard or control. A kit may provide information pertaining to a predetermined standard or control such as information pertaining to a predetermined range.
[0105] Although preferred embodiments have been depicted and described in detail herein, it will be apparent to those skilled in the relevant art that various modifications, additions, substitutions, and the like can be made without departing from the spirit of the invention and these are therefore considered to be within the scope of the invention as defined in the claims which follow.
EXAMPLES
Material and Methods for Examples
[0106] Cells.
[0107] Primary cultures of murine pancreatic ductal adenocarcinomas (PKCY) were obtained by dissociating cells from tumours of a 20-week-old Pdx1 Cre transgenic mouse (Gu et al., Direct Lineage Tracing Reveals the Ontogeny of Pancreatic Cell Fates During Mouse Embryogenesis, Mech. Dev. 120: 35-43 (2003), which is hereby incorporated by reference in its entirety) in which a Rosa.sup.YFP allele is expressed concurrently with pancreas-specific mutations in p53 and Kras, referred to as PKCY mice (Rhim et al., EMT and Dissemination Precede Pancreatic Tumor Formation, Cell 148:349-361 (2012), which is hereby incorporated by reference in its entirety). The murine pancreatic tumour cell line with high metastatic potential to the liver, R6560B, was isolated from tumours of a Pdx1-Cre transgenic mouse (Gu et al., Direct Lineage Tracing Reveals the Ontogeny of Pancreatic Cell Fates During Mouse Embryogenesis, Mech. Dev. 120: 35-43 (2003), which is hereby incorporated by reference in its entirety) with pancreas-specific mutations in p53 and Kras and was generously provided by D. L. Bajor (Vonderheide laboratory, University of Pennsylvania). The C57Bl/6 murine pancreatic adenocarcinoma cell line PAN02 (also identified as Panc 02) was purchased from the DTP, DCTD Tumor Repository, NIH. MIF knockdown PAN02 cells were generated by using MIF shRNA lentiviral particle infection, generating the PAN02 variants shMIF (sc-37138-V, Santa Cruz) and shMIF(2) (iV042354, abmGood). As a control, PAN02 cells were infected with control shRNA lentiviral particles-A (sc-108080, Santa Cruz). In all cases, infected cells were selected with puromycin according to the manufacturer's instructions. For several experiments, exosomes were isolated from human PDAC cell lines BxPC-3 and HPAF-II (ATCC). For in vitro education of human Kupffer cells (Life Technologies) with healthy normal pancreas-derived exosomes (NP), PAN02, or BxPC-3 exosomes, cells were maintained in culture for 14 days, with media containing 0 or 5 g ml.sup.1 of exosomes, replenished every other day. Cells were cultured in RPMI supplemented with 10% exosome-depleted FBS (FBS, Gibco) and penicillin-streptomycin, and maintained in a humid incubator with 5% CO.sub.2 at 37 C. FBS was depleted of bovine exosomes by ultracentrifugation at 100,000 g for 70 min (min). In some experiments, normal pancreas exosomes were obtained by culturing 25 pancreata isolated from healthy 4-6-week-old mice in 3 ml of FBS-free RPMI for 12 hr.
[0108] Exosome Isolation, Characterization and Analyses.
[0109] Isolation of exosomes for mass spectrometry and all other experiments was done by ultracentrifugation. Exosome preparation was verified by electron microscopy. Supernatant fractions collected from 72-h cell cultures or plasma samples were pelleted by centrifugation at 500 g for 10 min. The supernatant was centrifuged at 12,000 g for 20 min. Exosomes were then collected by centrifugation at 100,000 g for 70 min. The exosome pellet was resuspended in 20 ml of phosphate-buffered saline (PBS) and collected by ultracentrifugation at 100,000 g for 70 min (Beckman Ti70). Exosome size and particle number were analyzed using the LM10 or DS500 nanoparticle characterization system (NanoSight) equipped with a blue laser (405 nm). MIF levels in exosomes were measured by ELISA (ab100594, Abcam for human samples; ABIN415583, Antibodies Online for mouse samples), using 2 g of exosomes per 100 l of sample diluent, in duplicate reactions, according to the manufacturer's instructions.
[0110] Proteomics.
[0111] Mass spectrometry analyses of exosomes were performed using 10 g of exosomal protein. Samples were denatured using 8M urea, reduced using 10 mM dithiothreitol, and alkylated using 100 mM iodoacetamide. This was followed by proteolytic digestion with endoproteinase LysC (Wako Chemicals) overnight at room temperature, and subsequent digestion with trypsin (Promega) for 5 h at 37 C. The digestion was quenched with formic acid and the resulting peptide mixtures were desalted using in-house-made C18 Empore (3M) StAGE tips. Samples were dried and solubilized in the sample loading buffer containing 2% acetonitrile and 2% formic acid. Approximately 3-5 g of each sample was analyzed by reversed-phase nano-LC-MS/MS (Ultimate 3000 coupled to QExactive, Thermo Scientific). Following loading on the C18 trap column (5 m beads, Thermo Scientific) at a flow rate of 3 l min.sup.1, peptides were separated using a 75-m-inner-diameter C18 column (3 m beads Nikkyo Technos) at a flow rate of 200 nl min.sup.1, with a gradient increasing from 5% Buffer B (0.1% formic acid in acetonitrile)/95% Buffer A (0.1% formic acid) to 40% Buffer B/60% Buffer A, over 140 min. All LC-MS/MS experiments were performed in data-dependent mode. Precursor mass spectra were recorded in a 300-1,400 m/z mass range at 70,000 resolution, and 17,500 resolution for fragment ions (lowest mass: m/z 100). Data were recorded in profile mode. Up to 20 precursors per cycle were selected for fragmentation and dynamic exclusion was set to 45 s. Normalized collision energy was set to 27. Data were extracted and searched against Uniprot complete Human or Mouse proteome databases (January 2013) concatenated with common contaminants using Proteome Discoverer 1.4 (Thermo Scientific) and Mascot 2.4 (Matrix Science). All cysteines were considered alkylated with acetamide. Amino-terminal glutamate to pyroglutamate conversion, oxidation of methionine, and protein N-terminal acetylation were allowed as variable modifications. Data were first searched using fully tryptic constraints. Matched peptides were filtered using a Percolator-based 1% false discovery rate. Spectra not being matched at a false discovery rate of 1% or better were re-searched allowing for semi-tryptic peptides. The average area of the three most abundant peptides for a matched protein was used to gauge protein amounts within and in between samples.
[0112] Exosome Treatment and Labelling.
[0113] Five micrograms of total exosomal protein was injected into the retro-orbital venous sinus in a total volume of 100 l PBS. For education experiments, mice received 5 g of exosomes every other day, 3 times a week. For exosome-tracking experiments, purified exosomes were fluorescently labelled using PKH67 membrane dye (Sigma). Labelled exosomes were washed in 20 ml of PBS, collected by ultracentrifugation, and resuspended in PBS. In experiments involving evaluation of exosome incorporation, labelled exosomes were injected 24 h before tissue collection and analysis for exosome.sup.+ cells was conducted by flow cytometry or immunofluorescence. For exosome-tracking experiments, 5 g of non-tumour exosomes from normal pancreas were used as controls. Unlabeled exosomes were used as controls of signal specificity. For education experiments, retro-orbital injection of PBS or normal pancreata exosomes was used in control groups.
[0114] Illumina Strand-Specific RNA Sequencing.
[0115] To analyze the genes whose expression was altered in human KC cells as a result of in vitro education with normal pancreas, PAN02, or BxPC-3 exosomes, total RNA was isolated using the RNeasy Mini Kit (QIAGEN). Experiments were performed in triplicate. Illumina sequencing libraries were constructed by following a modified strand-specific RNA-Seq protocol (Zhong et al., High Throughput Illumina Strand-Specific RNA Sequencing Library Preparation, Cold Spring Harb. Protoc. 2011: 940-949 (2011), which is hereby incorporated by reference in its entirety). The library was then PCR amplified with TruSeq-indexed PCR primers and sequenced using the Illumina HiSeq2000 platform (Weill Cornell Medical College).
[0116] Human Studies.
[0117] Human studies were approved by the Weill Cornell Medical College, Institution Review Board no. 0604008488. Human peripheral blood samples were obtained from control healthy subjects and PDAC patients with liver metastasis or from patients without longstanding liver metastasis (approximately 5 years) at Weill Cornell Medical College, Oslo University Hospital, Memorial Sloan Kettering Cancer Center, and University of Nebraska Medical Center, all pathologically confirmed. All individuals provided informed consent for blood donation on approved institutional protocols. Blood was collected in purple-top tubes containing EDTA, and centrifuged at 500 g for 10 min. Plasma exosomes were isolated as described above in the Exosome Isolation, Characterization and Analyses section.
[0118] Mouse Strains and Treatments.
[0119] All mouse work was performed in accordance with institutional, IACUC, and AAALAS guidelines, animal protocol no. 0709-666A. Six-week-old C57Bl/6 female mice were used for all animal experiments. For CD11b.sup.+ cell depletion, B6.FVB-Tg-(ITGAM-DTR) mice (Jackson Laboratories, stock 006000) were injected intraperitoneally with 150 ng of diphtheria toxin diluted in 100 l of PBS every other day during the second week of exosome education. As a control, wild-type C57Bl/6 mice received a similar regimen of treatment. CD11b.sup.+ cell depletion from the liver was verified by immunofluorescence or flow cytometry for F4/80.sup.+ cells and CD11b.sup.+ F4/80.sup.+ cells, respectively.
[0120] To generate inducible FN knockout mice, we crossed B6; 129-Gt(ROSA)26SOR.sup.tm1(cre/ERT2)Tyj/J mice expressing tamoxifen-sensitive Cre under the Gt(Rosa)26or promoter (Jackson Laboratories, stock 008463) with mice homozygous for a floxed allele of fibronectin (Fn.sup.fl/fl, generously provided by R. Fssler, Max Planck Institute of Biochemistry) (Sakai et al., Plasma Fibronectin Supports Neuronal Survival and Reduces Brain Injury Following Transient Focal Cerebral Ischemia but is Not Essential for Skin-Wound Healing and Hemostasis, Nat. Med. 7:324-330 (2001), which is hereby incorporated by reference in its entirety). Cre.sup./Fn.sup.fl/fl mice were then maintained by breeding to Fn.sup.fl/fl mice. Both Cre.sup.+/Fn.sup.fl/fl (CRE.sup.+) and Cre.sup./Fn.sup.fl/fl (CRE.sup.) control mice were treated with intraperitoneal injections of 40 g of tamoxifen (Sigma) per gram of mouse weight (diluted in 100 l of olive oil) every other day for a total of 3 doses, during the second week of PAN02 exosome education. For verification of Fn deletion, liver FN expression was evaluated by immunofluorescence.
[0121] For evaluation of liver pre-metastatic niche formation in a spontaneous mouse model of PDAC, we used the p53- and Kras-driven mouse model of pancreatic cancer (Rhim et al., EMT and Dissemination Precede Pancreatic Tumor Formation, Cell 148:349-361 (2012), which is hereby incorporated by reference in its entirety), termed PKCY. PKCY mice were evaluated at different ages, during the early and late stages of PanIN lesions (4-6 and 8-11 weeks, respectively), and at the PDAC stage (16-20 weeks). As controls, livers isolated from mice that do not develop pancreatic lesions (Cre transgenic lacking activating TP53 and Kras mutations, referred to here as CY) were used.
[0122] For systemic TGF receptor inhibition, mice were treated with intraperitoneal injections of A83-01 (Santa Cruz). Mice were administered 10 g of A83-01 (diluted in 100 l of dimethylsulphoxide) per gram of mouse weight for a total of 9 doses, every other day, for the three weeks of PAN02 exosome education.
[0123] Liver Metastasis Studies.
[0124] To analyze the role of exosome education in tumour metastasis, 6-8-week-old C57Bl/6 female mice pre-educated with PDAC-derived exosomes were injected intrasplenically with 110.sup.6 PAN02 mCherry cells resuspended in 30 l of Matrigel (Corning) as previously described (Little et al., Novel Immunocompetent Murine Models Representing Advanced Local and Metastatic Pancreatic Cancer, J. Surg. Res. 176:359-366 (2012); Suemizu et al., A Versatile Technique for the In Vivo Imaging of Human Tumor Xenografts Using Near-Infrared Fluorochrome-Conjugated Macromolecule Probes, PLoS ONE 8:e82708 (2013); Morikawa et al., In Vivo Selection of Highly Metastatic Cells From Surgical Specimens of Different Primary Human Colon Carcinomas Implanted Into Nude Mice, Cancer Res. 48:1943-1948 (1988), which are hereby incorporated by reference in their entirety). Either 24 h or 21 days later, mice were euthanized and livers were analyzed for metastatic lesions by counting mCherry.sup.+ cells by fluorescence microscopy or measuring liver weights. All animals were monitored for abnormal tissue growth or ill effects according to AAALAS guidelines and euthanized if excessive deterioration of animal health was observed.
[0125] GFP Bone Marrow Transplantation.
[0126] Bone marrow transplantation was performed by reconstituting the bone marrow of lethally irradiated (950 rads) C57Bl/6 female 6-week-old mice through retro-orbital injection of 510.sup.6 total bone marrow cells isolated from eGFP transgenic mice (Jackson Laboratory). After 4 weeks, the eGFP bone marrow-reconstituted C57Bl/6 mice were educated with PBS or PAN02 exosomes for 21 days.
[0127] Tissue Processing and Immunofluorescence.
[0128] For histological analysis, tissues were dissected and fixed in a mix of 2% PFA and 20% sucrose solution overnight, and then embedded in Tissue-tek O.C.T. (Electron Microscopy Sciences). Blocks were frozen in a dry ice and ethanol bath. For immunofluorescence, 6 m O.C.T. tissue cryosections were stained with antibodies against F4/80 (14-4801-85, 1:100, eBioscience), fibronectin (sc59826, 1:50, Santa Cruz), SMA (CBL171, 1:500, EMD Millipore), Gr-1 (ab25377, 1:50, Abcam), CD31 (sc59906, 1:100, Santa Cruz), S100A4 (ab27957, 1:100, Abcam), epCAM (sc59906, 1:50, Santa Cruz) and TGF (ab66043, 1:100, Abcam). In some experiments, ECM evaluation was done by using antibodies directed against collagen I (ab6308, 1:100, Abcam), vitronectin (sc15332, 1:100, Santa Cruz) and tenascin C (ab6346, 1:100, Abcam). Secondary antibodies conjugated to Alexa Fluor 488, 555 or 594 were used (a11007, a11001 or a21424, respectively, 1:1,000, Life Technologies). GFP and mCherry cells were detected by their intrinsic signal. Fluorescent images were obtained using a Nikon confocal microscope (Eclipse TE2000U) and analyzed using Nikon software (EZ-C1 3.6). FN and SMA expression were quantified using ImageJ Software (NIH) by determining the ratio between the areas of FN and DAPI staining, expressed in arbitrary units (a.u.).
[0129] SDS-PAGE and Western Blot.
[0130] Equal amounts of cell lysate or exosome lysate were resuspended in 1.5 Laemmli buffer, subsequently incubated at 95 C. for 5 min and centrifuged in a microcentrifuge at 13,000 g. for 5 min. Samples were separated on a Novex 4-12% Bis-Tris Plus Gel (Life Technologies), and transferred onto a PVDF membrane (Millipore). The membrane was activated in 100% methanol and rinsed with double-distilled H.sub.2O (ddH.sub.2O) before transfer.
[0131] After transfer, membranes were processed for Ponceau red staining. For that, PVDF membranes were rinsed in ddH.sub.2O and immersed in 100% methanol for 5 s. Membranes were dried for 15 min on Whatman paper and reactivated in 100% methanol for 5 s. Reactivated membranes were rinsed in ddH.sub.2O and incubated with Ponceau red solution (BIORAD) for 3 min. The de-stained membranes were then used further for antibody incubations in ready-to-use Odyssey blocking buffer (OBB, LiCOR, Part No. 927-40000) and blocked for 1 h at room temperature. Primary anti-MIF antibody (ab175189, 1:1,500, Abcam) was diluted in OBB containing 0.1% Tween-20, and incubated overnight at 4 C. Membranes were then washed 4 (5 min each) with TBS containing 0.1% Tween-20 (TBS-T) at room temperature. Secondary antibodies conjugated to anti-rabbit IRDye 800CW (LiCOR, 1:20,000) were diluted in OBB containing 0.1% Tween-20 and 0.01% SDS. Membranes were incubated with secondary antibody solutions for 1 h at room temperature with boxes wrapped in aluminium foil to prevent light exposure.
[0132] Afterwards membranes were washed 4 times (5 min each) with TBS-T at room temperature in the dark, and then briefly rinsed 2 times (2 min each) in PBS before scanning Membranes were scanned and analyzed using an OdysseyH IR scanner using OdysseyH imaging software 3.0. Scan settings were lowest image quality, 42 m resolution, auto intensity for both 700 and 800 channels with no offset.
[0133] Flow Cytometry Analysis.
[0134] For labelled exosome tracking and phenotypic analysis of murine organs, femurs were flushed and livers were mechanically dissociated, and single-cell suspensions were filtered through a 40 m strainer. Cells were washed in PBS with 1% BSA and incubated with anti-CD11b-PerCP-Cyanine5.5 (clone M1/70, 1:100, BD Biosciences) and anti-F4/80-APC (clone BM8, 1:100, eBioscience) antibodies at predetermined saturating concentrations. PKH67-labelled exosome-positive cells were detected using blue laser excitation and 488 nm emission. Data for 1,000,000 cells were acquired on a BD FACS Canto cytometer with Diva software (BD) and were analyzed using FlowJo software (TreeStar).
[0135] Statistical and Pathway Analysis.
[0136] Error bars in graphical data represent meanss.e.m. Statistical significance was determined using a two-tailed Student's t-test or by ANOVA. P<0.05 was considered statistically significant. Statistical analyses were performed using GraphPad Prism software. Pathway analyses were performed using Ingenuity IPA software (Ingenuity Systems). No statistical method was used to predetermine sample size. The experiments were not randomized, and the investigators were not blinded to allocation during experiments and outcome assessment.
[0137] Accession Codes.
[0138] The raw sequencing data for human Kupffer cells treated in vitro with PAN02 or normal pancreas exosomes or BxPC-3 exosomes have been deposited in the GEO database under accession number GSE66876. The raw data for proteomic analysis of PAN02 tumour exosomes have been deposited in the FigShare database.
Example 1Pancreatic Ductal Adenocarcinoma-Derived Exosomes Preferentially Fuse with Kupffer Cells and Enhance Metastatic Burden in Liver
[0139] To determine if PDAC-derived exosomes play a role in liver metastasis, an experimental model of intra-splenic injection of PAN02 murine PDAC cells (Corbett et al., Induction and Chemotherapeutic Response of Two Transplantable Ductal Adenocarcinomas of the Pancreas in C57BL/6 Mice, Cancer Res. 44:717-726 (1984); Little et al., Novel Immunocompetent Murine Models Representing Advanced Local and Metastatic Pancreatic Cancer, J. Surg. Res. 176:359-366 (2012), which are hereby incorporated by reference in their entirety) was used. This model typically generates metastases restricted to the liver. The structure of PAN02-derived exosomes was first analyzed by electron microscopy, which revealed a typical exosome structure and size of approximately 100 nm (
[0140] The cells that uptake tumor exosomes in the liver following retro-orbital injection of labeled PDAC-derived exosomes in nave mice were evaluated. Fluorescently labeled exosomes isolated from several PDAC models were used, including PAN02, PKCY and R6560B, as well as human BxPC-3 and HPAF-II PDAC cells. The frequency of exosome positive cells in a million cells from each organ was analyzed. Although PDAC-derived exosomes first circulate through the lung due to the retro-orbital injection methodology, they were more frequently represented in the liver than in the lung (
[0141] To further define mechanisms involved in liver pre-metastatic niche formation by KCs, human KCs were educated with PAN02 or BxPC-3 exosomes in vitro and gene expression analysis was performed by mRNA sequencing. Of more than 300 canonical pathways, the liver fibrosis pathwaysparticularly those associated with the upregulation of genes encoding soluble factors such as MMP9, S100B, S100A8, CTGF, EDN, IGF, PDGF, and TGF (
Example 2Fibronectin Upregulation by Hepatic Stellate Cells is Important for Liver Pre-Metastatic Niche Formation by Pancreatic Ductal Adenocarcinoma-Derived Exosomes
[0142] To determine how PDAC-derived exosomes elicit a fibrotic liver microenvironment, the changes in expression of different extracellular matrix (ECM) proteins following PAN02 exosome education were examined by immunofluorescence. A downregulation of vitronectin and tenascin C, a stable but minimal expression level of collagen type I, and a marked increase in fibronectin (FN) expression were observed (
Example 3Pancreatic Ductal Adenocarcinoma-Derived Exosomes Induce Bone Marrow-Derived Cell Migration to Liver
[0143] To evaluate if PDAC-derived exosomes play a role in preparing the liver microenvironment for the arrival of metastatic cells by eliciting macrophage recruitment, wild-type mice were educated with exosomes isolated from PAN02, PKCY, or R6560B cells. Interestingly, PDAC exosomes, but not NP exosomes, were sufficient to increase the frequency of macrophage marker F4/80-expressing cells in the liver (
Example 4Macrophage Recruitment to the Liver Pre-Metastatic Niche Follows TGF Signaling-Induced Fibronectin Upregulation
[0144] Upon KC education with PDAC-derived exosomes in vitro, TGF was among the most highly upregulated soluble factor related to liver fibrosis and hStCs activation (60-148% increase) produced by KCs (
[0145] To further define the sequential events involved in liver pre-metastatic niche development, a conditional FN knockout murine model was used in which tamoxifen-driven Cre recombinase expression depletes FN during PAN02 exosome education. It was verified that FN deposition in the liver was reduced to control Rosa-CreER.sup.;Fn.sup.fl/fl levels upon tamoxifen treatment of Rosa-CreER.sup.+;Fn.sup.fl/fl, while SMA expression was not affected (
Example 5Macrophage Ablation Blocks the Pro-Metastatic Effect of Pancreatic Ductal Adenocarcinoma-Derived Exosomes in the Liver
[0146] Bone-marrow macrophages are recruited to the liver during the early stages of exosome-mediated liver pre-metastatic niche formation. Therefore, whether macrophages present in the liver pre-metastatic niche are physically associated with liver metastatic lesions was investigated. To this end, disseminated PAN02 cells were tracked in the liver of mice educated for three weeks with PAN02 exosomes, 24 hours after splenic injection. Metastatic cells localized adjacent to F4/80.sup.+ macrophages (
Example 6MIF Depletion in Pancreatic Ductal Adenocarcinoma-Derived Exosomes Inhibits Liver Pre-Metastatic Niche Initiation
[0147] To gain insight into the mechanisms through which PDAC-derived exosomes promote KC activation and subsequent liver pre-metastatic niche formation, pancreatic exosome mass spectrometry data was mined for potential inflammatory mediators. Among the candidates with previously described roles in either or both macrophage activation and inflammatory modulation, macrophage migration inhibitory factor (MIF) was found to be highly expressed in PDAC-derived exosomes. MIF knockdown in PAN02 cells did not affect exosome size, quantity of protein per exosome, or the binding of these exosomes to liver CD11b.sup.+ F4/80.sup.+ cells (
[0148] To further evaluate the functional role of exosomal MIF in liver metastatic progression, the consequences of intra-splenic injection of PAN02 cells into non-educated mice versus pre-educated mice that were treated with either PAN02 or PAN02 MIF knockdown exosomes for three weeks were compared. In addition to preventing KC education and the sequential steps in liver pre-metastatic niche induction by PAN02 exosomes (
[0149] To determine the clinical relevance of these findings, the variation in MIF levels between exosomes isolated from plasma samples of control healthy subjects and PDAC patients with liver metastasis, with either no evidence of disease five years post diagnosis (NED) or progression of disease post diagnosis (POD) was determined. POD patients expressed significantly higher exosomal MIF levels compared to NED patients and healthy control subjects, indicating that exosomal MIF can be used as a biomarker of PDAC prognosis. A trend toward lower MIF levels was apparent in exosomes isolated from PDAC patients with liver metastasis versus those with POD, although the difference between patient groups was not statistically significant (
Example 7Liver Pre-Metastatic Niche Formation Precedes the Establishment of Pancreatic Ductal Adenocarcinoma Lesions
[0150] To further characterize changes in the liver niche during metastatic progression, the livers of PKCY mice that develop PDAC with reproducible kinetics were analyzed, starting with early PanIN (Pancreatic Intraepithelial Neoplasia) lesions at 4-6 weeks, more advanced PanINs at 8-11 weeks, and invasive cancers at 16-20 weeks that metastasizes to the liver (Rhim et al., EMT and Dissemination Precede Pancreatic Tumor Formation, Cell 148:349-361 (2012), which is hereby incorporated by reference in its entirety). Livers isolated from mice that do not develop pancreatic lesions (Cre transgenic mice lacking activating p53 Kras mutations, from hereon referred to as CY mice) were used as controls. An increase in SMA.sup.+ cells (6-fold), FN accumulation (7-fold), and an infiltration of F4/80.sup.+ cells (2-fold) in PKCY mice was found at the late PanIN stage (
[0151] Consistent with these results,
Discussion of Examples 1-7
[0152] Circulating exosomes can be used as biological markers for pancreatic cancers (Arscott & Camphausen, EGFR Isoforms in Exosomes as a Novel Method for Biomarker Discovery in Pancreatic Cancer, Biomark. Med. 5:821 (2011); Lau et al., Role of Pancreatic Cancer-Derived Exosomes in Salivary Biomarker Development, J. Biol. Chem. 288:26888-26897 (2013), which are hereby incorporated by reference in their entirety). However, the cellular and molecular mechanisms through which PDAC-derived exosomes affect metastasis have yet to be determined. Here, delineated for the first time, are the sequential steps of liver pre-metastatic niche formation by PDAC-derived exosomes. PDAC-derived exosomes induce TGF signaling in KCs, leading to activation of hStCs and ECM remodeling. In turn, FN accumulation promotes an influx of BM-derived macrophages (and potentially neutrophils) to the liver, providing a favorable niche for liver metastasis (
[0153] Unbiased mass spectrometry analysis of PDAC-derived exosome protein cargo led to the identification of MIF as a candidate mediator of liver education. Although one study has described MIF as an anti-fibrotic factor in a chemically induced liver fibrosis model (Heinrichs et al., Macrophage Migration Inhibitory Factor (MIF) Exerts Antifibrotic Effects in Experimental Liver Fibrosis via CD74, Proc. Nat'l. Acad. Sci. U.S.A. 108:17444-17449 (2011), which is hereby incorporated by reference in its entirety), MIF is a well-known mediator of liver inflammation and fibrosis, of BM cell recruitment to the liver and liver metastasis, and furthermore MIF tissue and plasma levels correlate with PDAC aggressiveness (Barnes et al., Macrophage Migration Inhibitory Factor Contributes to Ethanol-Induced Liver Injury by Mediating Cell Injury, Steatohepatitis, and Steatosis, Hepatology 57:1980-1991 (2013); Funamizu et al., Macrophage Migration Inhibitory Factor Induces Epithelial to Mesenchymal Transition, Enhances Tumor Aggressiveness and Predicts Clinical Outcome in Resected Pancreatic Ductal Adenocarcinoma, International J. Cancer. Journal International du Cancer (2012); Nanji et al., Macrophage Migration Inhibitory Factor Expression in Male and Female Ethanol-Fed Rats, Journal of Interferon & Cytokine Research: The Official Journal of the International Society for Interferon and Cytokine Research 21:1055-1062 (2001); Shin et al., Stromal Cell-Derived Factor-1 alpha and Macrophage Migration-Inhibitory Factor Induce Metastatic Behavior in CXCR4-Expressing Colon Cancer Cells, International J. Mol. Med. 30:1537-1543 (2012); Zhang et al., Macrophage Migration Inhibitory Factor Expression Correlates With Inflammatory Changes in Human Chronic Hepatitis B Infection, Liver International: Official Journal of the International Association for the Study of the Liver 25:571-579 (2005), which are hereby incorporated by reference in their entirety). The data presented herein show that MIF-positive PDAC exosomes bind preferentially to the liver, delivering their cargo specifically to Kupffer cells. This exosome-mediated transport of MIF is distinct from the circulation of this protein in a soluble form, as it permits highly specific and enhanced delivery of MIF to Kupffer cells. Thus, soluble MIF levels could not predict the ability of this protein to bind to Kupffer cells and induce liver pre-metastatic niche formation.
[0154] The functional experiments in murine models of pancreatic ductal adenocarcinoma demonstrate that exosomal MIF upregulation is an early event during cancer progression and can be detected in plasma-derived exosomes isolated from mice with pre-tumoral pancreatic lesions. Importantly, high exosomal MIF levels were present in plasma from patients with stage I PDAC, prior to liver metastasis, indicating its potential prognostic value. In contrast, exosomal MIF levels had a bimodal distribution in patients with established liver metastatic disease. The presence of low exosomal MIF levels in a subset of PDAC patients with liver metastasis indicates that MIF-dependent mechanisms may be more important during earlier stages of liver metastasis. Taken together, these observations indicate that exosomal MIF levels can serve as an early biomarker for liver pre-metastatic niche formation and a prognostic factor for metastatic risk in patients with pre-tumoral lesions, such as pancreatitis, PanINs, intra-ductal papillary mucinous neoplasms (IPMNs), and pre-metastatic PDACs. Moreover, these results also indicate that high MIF levels may be an indicator of risk for liver pre-metastatic niche formation and liver metastasis in other gastrointestinal tract tumors, such as colorectal and gastric cancer. MIF inhibition by either small molecules or neutralizing antibodies has been shown to prevent macrophage activation, TGF expression, and tissue fibrosis (Adamali et al., Macrophage Migration Inhibitory Factor Enzymatic Activity, Lung Inflammation, and Cystic Fibrosis, Am. J. Respiratory Crit. Care Med. 186:162-169 (2012); Kobayashi et al., Prevention of Lethal Acute Hepatic Failure by Antimacrophage Migration Inhibitory Factor Antibody in Mice Treated With Bacille Calmette-Guerin and Lipopolysaccharide, Hepatology 29:1752-1759 (1999); Yaddanapudi et al., Control of Tumor-Associated Macrophage Alternative Activation by Macrophage Migration Inhibitory Factor, J. Immunol. 190:2984-2993 (2013); Chen et al., ISO-1, a Macrophage Migration Inhibitory Factor Antagonist, Inhibits Airway Remodeling in a Murine Model of Chronic Asthma, Mol. Med. 16:400-408 (2010), which are hereby incorporated by reference in their entirety).
[0155] High levels of TGF in patients with pancreatic cancers is associated with poor prognosis (Javle et al., Biomarkers of TGF-Beta Signaling Pathway and Prognosis of Pancreatic Cancer, PloS one 9:e85942 (2014), which is hereby incorporated by reference in its entirety). Anti-TGF compounds have shown efficacy in preclinical and clinical studies (Ellermeier et al., Therapeutic Efficacy of Bifunctional siRNA Combining TGF-Beta1 Silencing With RIG-I Activation in Pancreatic Cancer, Cancer Res. 73:1709-1720 (2013); Gaspar et al., Inhibition of Transforming Growth Factor Beta Signaling Reduces Pancreatic Adenocarcinoma Growth and Invasiveness, Mol. Pharmacol. 72:152-161 (2007), which are hereby incorporated by reference in their entirety), suppressing liver metastasis by acting on both incoming tumor cells and the liver microenvironment (Melisi et al., LY2109761, a Novel Transforming Growth Factor Beta Receptor Type I and Type II Dual Inhibitor, as a Therapeutic Approach to Suppressing Pancreatic Cancer Metastasis, Mol. Cancer Therapeutics 7:829-840 (2008), which is hereby incorporated by reference in its entirety). However, systemic TGF inhibition carries a substantial risk for patients as this pathway is implicated in multiple homeostatic processes and may also have tumor-suppressor functions depending on the tumor stage and stromal activation status (Pickup et al., The Roles of TGFbeta in the Tumour Microenvironment, Nature Reviews. Cancer 13:788-799 (2013); Ijichi et al., Aggressive Pancreatic Ductal Adenocarcinoma in Mice Caused by Pancreas-Specific Blockade of Transforming Growth Factor-Beta Signaling in Cooperation with Active Kras Expression, Genes & Development 20:3147-3160 (2006); Hezel et al., TGF-Beta and Alphavbeta6 Integrin Act in a Common Pathway to Suppress Pancreatic Cancer Progression, Cancer Re. 72:4840-4845 (2012), which are hereby incorporated by reference in their entirety). Although the data presented herein suggest that targeting TGF signaling may be beneficial for preventing liver pre-metastatic niche formation, given the context-dependent roles of TGF, its potential anti-tumorigenic effects need to be excluded before TGF inhibitors are considered for metastasis prevention in PDAC patients in the clinic.
[0156] Several studies have correlated KC (Bayon et al., Role of Kupffer Cells in Arresting Circulating Tumor Cells and Controlling Metastatic Growth in the Liver, Hepatology 23:1224-1231 (1996); Kruse et al., Macrophages Promote Tumour Growth and Liver Metastasis in an Orthotopic Syngeneic Mouse Model of Colon Cancer, Int. J. Colorectal Disease 28:1337-1349 (2013); Wen et al., Bimodal Role of Kupffer Cells During Colorectal Cancer Liver Metastasis, Cancer Biology & Therapy 14:606-613 (2013), which are hereby incorporated by reference in their entirety) and ECM changes (Grzesiak et al., Knockdown of the Beta(1) Integrin Subunit Reduces Primary Tumor Growth and Inhibits Pancreatic Cancer Metastasis, Int. J. Cancer. Journal international du Cancer 129:2905-2915 (2011); Saito et al., Inhibition of Hepatic Metastasis in Mice Treated With Cell-Binding Domain of Human Fibronectin and Angiogenesis Inhibitor TNP-470. Int. J. Clin. Oncol. 6:215-220 (2001); Zvibel et al., Extracellular Matrix Modulates Expression of Growth Factors and Growth-Factor Receptors in Liver-Colonizing Colon-Cancer Cell Lines, Int. J. Cancer. Journal international du Cancer 77:295-301 (1998), which are hereby incorporated by reference in their entirety) with circulating tumor cell arrest and liver metastasis. In addition, myeloid cell recruitment to the liver was also shown to precede liver metastasis (Porembka et al., Pancreatic Adenocarcinoma Induces Bone Marrow Mobilization of Myeloid-Derived Suppressor Cells Which Promote Primary Tumor Growth, Cancer Immunol. Immunother.: CII 61:1373-1385 (2012); Yamamoto et al., TSU68 Prevents Liver Metastasis of Colon Cancer Xenografts by Modulating the Premetastatic Niche, Cancer Res. 68:9754-9762 (2008); Zhang et al., Development and Characterization of a Reliable Mouse Model of Colorectal Cancer Metastasis to the Liver, Clin. Exper. Metastasis 30:903-918 (2013); Seubert et al., Tissue Inhibitor of Metalloproteinases (TIMP)-1 Creates a Premetastatic Niche in the Liver Through SDF-1/CXCR4-Dependent Neutrophil Recruitment in Mice, Hepatology 61:238-248 (2015), which are hereby incorporated by reference in their entirety). As demonstrated here for the first time, liver pre-metastatic niche formation during PDAC metastasis depends on tumor exosome-derived MIF. Moreover, this process is driven by TGF-signaling, FN deposition, and recruitment of BM-derived macrophages to future liver metastatic niches. By individually targeting MIF, FN, and macrophages, the effects of PDAC-derived exosome education was reverted at various steps during liver pre-metastatic niche formation. Strategies aimed at targeting these particular molecules (TGF, MIF, FN) and cell types (BM-derived cells) have been previously explored (Kruse et al., Macrophages Promote Tumour Growth and Liver Metastasis in an Orthotopic Syngeneic Mouse Model of Colon Cancer, Int. J. Colorectal Disease 28:1337-1349 (2013); Kato et al., A New Type of Antimetastatic Peptide Derived From Fibronectin, Clin. Cancer Res.: An Official Journal of the American Association for Cancer Research 8:2455-2462 (2002); Bissell, D. M., Therapy for Hepatic Fibrosis: Revisiting the Preclinical Models, Clinics and Res. Hepatol. Gastroenterol. 35:521-525 (2011); Korpal & Kang, Targeting the Transforming Growth Factor-Beta Signalling Pathway in Metastatic Cancer, European J. Cancer 46:1232-1240 (2010); Noy & Pollard, Tumor-Associated Macrophages: From Mechanisms to Therapy. Immunity 41:49-61 (2014), which are hereby incorporated by reference in their entirety). The detailed dissection of the sequential events of PDAC metastasis initiation shown herein provides an understanding of how tumor secreted factors, specifically exosomes, orchestrate this process and these findings open new avenues for early detection, prevention, and therapeutic intervention.
Example 8Colorectal Cancer-Derived Exosomes Preferentially Fuse with Kupffer Cells and Enhance Metastatic Burden in Liver
[0157] Like pancreatic cancer derived exosome, colorectal and gastric cancer derived exosomes are also capable of inducing liver metastatic disease.
Example 9Exosomal Mediators of Liver Pre-Metastatic Niche Formation
[0158] In addition to MIF, other potential exosomal mediators of liver premetastatic niche formation were investigated in not only pancreatic cancer derived exosomes, but also colorectal and gastric cancer derived exosomes. Table 6 below provides a list of the exosomal markers of metastatic liver disease that have both prognostic and therapeutic utility in accordance with the methods of the present invention.
TABLE-US-00006 TABLE 6 Exosomal Mediators of Metastatic Liver Disease COLORECTAL Pancreatic Cancer CANCER MOUSE HUMAN MOUSE Symbol Enterez Gene Name PAN02 PDAC BxPc3 HPAF-II AsPC-1 Mia-PaCa2 CT26 CT26-R3 ANXA1 Annexin A1 + + + + + + + + CD44 CD44 + + + + + + CD47 CD47 + + + + + + + CDH1 Cadherin 1 + + + + + FLNA Filamin A + + + + + + + + HMGB1 High mobility group box 1 + + + ITGB3 Integrin Beta 3 + + + + + LGALS1 lectin, galactoside-binding, soluble, 1 + + + + + + + LGALS3 lectin, galactoside-binding, soluble, 3 + + + + + + + + MIF mecrophage migration inhibitory factor + + + + + + + + MMP14 matrix metalloproteinase 14 + + + + PLAUR plasminogen activator, urokinase receptor + + PTGS2 prostagiandin-endoperoxide symthase 2 + + RAC1 ras-related C3 botulinum toxin substrate 1 + + + + + + + COLORECTAL CANCER GASTRIC CANCER HUMAN HUMAN Symbol Enterez Gene Name HT29 HCT116 SW620 SNU-1 SNU-16 % ANXA1 Annexin A1 + + + + + 69.2307692 CD44 CD44 + + + 69.2307692 CD47 CD47 + 61.5384615 CDH1 Cadherin 1 + + + 61.5384615 FLNA Filamin A + + + + 92.3076923 HMGB1 High mobility group box 1 + + + 46.1538462 ITGB3 Integrin Beta 3 + + 53.8461538 LGALS1 lectin, galactoside-binding, soluble, 1 + + + + 84.6153846 LGALS3 lectin, galactoside-binding, soluble, 3 + + + + + 100 MIF mecrophage migration inhibitory factor + + + + + 100 MMP14 matrix metalloproteinase 14 30.7692308 PLAUR plasminogen activator, urokinase receptor + 23.0769231 PTGS2 prostagiandin-endoperoxide symthase 2 15.3846154 RAC1 ras-related C3 botulinum toxin substrate 1 + + + + 84.6153846