Compositions for inhibiting MASP-2 dependent complement activation
10047165 ยท 2018-08-14
Assignee
Inventors
- Thomas Dudler (Bellevue, WA)
- Wayne R. Gombotz (Kenmore, WA)
- James Brian Parent (Bainbridge Island, WA, US)
- Clark E. Tedford (Poulsbo, WA)
- Anita Kavlie (Oslo, NO)
- Urs Beat Hagemann (Oslo, NO)
- Herald Reiersen (Sofiemyr, NO)
- Sergej Kiprijanov (Olso, NO)
Cpc classification
C07K2317/33
CHEMISTRY; METALLURGY
A61P43/00
HUMAN NECESSITIES
C12Y304/21104
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
A61P37/06
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention relates to anti-MASP-2 inhibitory antibodies and compositions comprising such antibodies for use in inhibiting the adverse effects of MASP-2 dependent complement activation.
Claims
1. A nucleic acid encoding complementarity determining regions (CDRs) of heavy and light chain variable regions of an antibody, or antigen-binding fragment thereof, that binds to human MASP-2, wherein the heavy and light chain variable regions comprise the amino acid sequences set forth in SEQ ID NO:20 and SEQ ID NO:24, respectively.
2. A nucleic acid comprising a nucleotide sequence encoding heavy and light chain variable regions of an antibody, or antigen-binding fragment thereof, that binds to human MASP-2, wherein the heavy and light chain variable regions, comprise the amino acid sequences set forth in SEQ ID NO:20 and SEQ ID NO:24, respectively.
3. An expression vector comprising the nucleic acid according to claim 1 or claim 2.
4. A cell comprising the expression vector according to claim 3.
5. A method for producing an antibody, or antigen-binding fragment thereof, that binds to human MASP-2, the method comprising culturing the cell of claim 4 under conditions and for a time sufficient to allow expression by the cell of the antibody, or antigen-binding fragment thereof, encoding by the nucleic acid.
6. The method of claim 5, further comprising isolating the antibody, or antigen-binding fragment thereof.
7. A cell comprising: (a) a nucleic acid encoding complementarity determining regions (CDRs) of a heavy chain variable region of an antibody, or antigen-binding fragment thereof, that binds to human MASP-2, wherein the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO:20; and (b) a nucleic acid encoding complementarity determining regions (CDRs) of a light chain variable region of an antibody, or antigen-binding fragment thereof, that binds to human MASP-2, wherein the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO:24.
8. A method for producing an antibody, or antigen-binding fragment thereof, that binds to human MASP-2, the method comprising culturing the cell of claim 7 under conditions and for a time sufficient to allow expression by the cell of the antibody, or antigen-binding fragment thereof, encoded by the nucleic acid.
9. The method of claim 8, further comprising isolating the antibody, or antigen-binding fragment thereof.
Description
DESCRIPTION OF THE DRAWINGS
(1) The foregoing aspects and many of the attendant advantages of this invention will become more readily appreciated as the same become better understood by reference to the following detailed description, when taken in conjunction with the accompanying drawings, wherein:
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
(37)
DESCRIPTION OF THE SEQUENCE LISTING
(38) SEQ ID NO:1 human MASP-2 cDNA
(39) SEQ ID NO:2 human MASP-2 protein (with leader)
(40) SEQ ID NO:3 human MASP-2 protein (mature)
(41) SEQ ID NO:4 rat MASP-2 cDNA
(42) SEQ ID NO:5 rat MASP-2 protein (with leader)
(43) SEQ ID NO:6 rat MASP-2 protein (mature)
(44) Antigens (in Reference to Human MASP-2 Mature Protein)
(45) SEQ ID NO:7 CUBI domain of human MASP-2 (aa 1-121)
(46) SEQ ID NO:8 CUBI/EGF domains of human MASP-2 (aa 1-166)
(47) SEQ ID NO:9 CUBI/EGF/CUBII domains of human MASP-2 (aa 1-277)
(48) SEQ ID NO:10 EGF domain of human MASP-2 (aa 122-166)
(49) SEQ ID NO:11 CCPI/CCPII/SP domains of human MASP-2 (aa 278-671)
(50) SEQ ID NO:12 CCPI/CCPII domains of human MASP-2 (aa 278-429)
(51) SEQ ID NO:13 CCPI domain of human MASP-2 (aa 278-347)
(52) SEQ ID NO:14 CCPII/SP domain of human MASP-2 (aa348-671)
(53) SEQ ID NO:15 CCPII domain of human MASP-2 (aa 348-429)
(54) SEQ ID NO:16 SP domain of human MASP-2 (aa 429-671)
(55) SEQ ID NO:17: Serine-protease inactivated mutant (aa 610-625 with mutated Ser 618)
(56) Anti-MASP-2 Monoclonal Antibodies VII Chains
(57) SEQ ID NO:18 17D20mc heavy chain variable region (VH) polypeptide
(58) SEQ ID NO:19 DNA encoding 17D20_dc35VH21N11VL (OMS646) heavy chain variable region (VH) (without signal peptide)
(59) SEQ ID NO:20 17D20_dc35VH21N11VL (OMS646) heavy chain variable region (VH) polypeptide
(60) SEQ ID NO:21 17N16mc heavy chain variable region (VH) polypeptide
(61) Anti-MASP-2 Monoclonal Antibodies VL Chains
(62) SEQ ID NO:22 17D20mc light chain variable region (VL) polypeptide
(63) SEQ ID NO:23 DNA encoding 17D20_dc21N11VL (OMS644) light chain variable region (VL) (without signal peptide)
(64) SEQ ID NO:24 17D20_dc21N11VL (OMS644) light chain variable region (VL) polypeptide
(65) SEQ ID NO:25 17N16mc light chain variable region (VL) polypeptide
(66) SEQ ID NO:26 DNA encoding 17N16_dc17N9 (OMS641) light chain variable region (VL) (without signal peptide)
(67) SEQ ID NO:27 17N16_dc17N9 (OMS641) light chain variable region (VL) polypeptide
(68) Anti-MASP-2 Monoclonal Antibodies Heavy Chain CDRS
(69) SEQ ID NOS:28-31 CDR-H1
(70) SEQ ID NOS:32-35 CDR-H2
(71) SEQ ID NOS:36-40 CDR-H3
(72) Anti-MASP-2 Monoclonal Antibodies Light Chain CDRS
(73) SEQ ID NOS:41-45 CDR-L1
(74) SEQ ID NOS:46-50 CDR-L2
(75) SEQ ID NOS:51-54 CDR-L3
(76) MASP-2 Antibody Sequences
(77) SEQ ID NO:55: scFv mother clone 17D20 full length polypeptide
(78) SEQ ID NO:56: scFv mother clone 18L16 full length polypeptide
(79) SEQ ID NO:57: scFv mother clone 4D9 full length polypeptide
(80) SEQ ID NO:58: scFv mother clone 17L20 full length polypeptide
(81) SEQ ID NO:59: scFv mother clone 17N16 full length polypeptide
(82) SEQ ID NO:60: scFv mother clone 3F22 full length polypeptide
(83) SEQ ID NO:61: scFv mother clone 9P13 full length polypeptide
(84) SEQ ID NO:62: DNA encoding wild type IgG4 heavy chain constant region
(85) SEQ ID NO:63: wild type IgG4 heavy chain constant region polypeptide
(86) SEQ ID NO:64 DNA encoding IgG4 heavy chain constant region with mutant S228P
(87) SEQ ID NO:65: IgG4 heavy chain constant region with mutant S228P polypeptide
(88) SEQ ID NO:66: scFv daughter clone 17N16m_d17N9 full length polypeptide
(89) SEQ ID NO:67: scFv daughter clone 17D20m_d21N11 full length polypeptide
(90) SEQ ID NO:68: scFv daughter clone 17D20m_d3521N11 full length polypeptide
(91) SEQ ID NO:69: DNA encoding wild type IgG2 heavy chain constant region
(92) SEQ ID NO:70: wild type IgG2 heavy chain constant region polypeptide
(93) SEQ ID NO:71: 17N16m_d17N9 light chain gene sequence (with signal peptide encoded by nt 1-57))
(94) SEQ ID NO:72: 17N16m_d17N9 light chain protein sequence (with signal peptide aa1-19)
(95) SEQ ID NO:73: 17N16m_d17N9 IgG2 heavy chain gene sequence (with signal peptide encoded by nt 1-57)
(96) SEQ ID NO:74: 17N16m_d17N9 IgG2 heavy chain protein sequence (with signal peptide aa 1-19)
(97) SEQ ID NO:75: 17N16m_d17N9 IgG4 heavy chain gene sequence (with signal peptide encoded by nt 1-57)
(98) SEQ ID NO:76: 17N16m_d17N9 IgG4 heavy chain protein sequence (with signal peptide aa 1-19)
(99) SEQ ID NO:77: 17N16m_d17N9 IgG4 mutated heavy chain gene sequence (with signal peptide encoded by nt 1-57)
(100) SEQ ID NO:78: 17N17m_d17N9 IgG4 mutated heavy chain protein sequence (with signal peptide aa 1-19)
(101) SEQ ID NO:79: 17D20_3521N11 light chain gene sequence (with signal peptide encoded by nt 1-57)
(102) SEQ ID NO:80: 17D20_3521N11 light chain protein sequence (with signal peptide aa 1-19)
(103) SEQ ID NO:81: 17D20_3521N11 IgG2 heavy chain gene sequence (with signal peptide encoded by nt 1-57)
(104) SEQ ID NO:82: 17D20_3521N11 IgG2 heavy chain protein sequence (with signal peptide aa 1-19)
(105) SEQ ID NO:83: 17D20_3521N11 IgG4 heavy chain gene sequence (with signal peptide encoded by nt 1-57)
(106) SEQ ID NO:84: 17D20_3521N11 IgG4 heavy chain protein sequence (with signal peptide aa 1-19)
(107) SEQ ID NO:85: 17D20_3521N11 IgG4 mutated heavy chain gene sequence (with signal peptide encoded by nt 1-57)
(108) SEQ ID NO:86: 17D20_3521N11 IgG4 mutated heavy chain protein sequence (with signal peptide aa 1-19)
(109) SEQ ID NO:87: scFv daughter clone 17N16m_d17N9 DNA encoding full length polypeptide (without signal peptide)
(110) SEQ ID NO:88: scFv daughter clone 17D20m_d21N11 DNA encoding full length polypeptide (without signal peptide)
(111) SEQ ID NO:89: scFv daughter clone 17D20m_d3521N11 DNA encoding full length polypeptide (without signal peptide)
(112) SEQ ID NO:90: consensus heavy chain CDR-H3 of 17D20m and d3521N11
(113) SEQ ID NO:91: consensus light chain CDR-L1 of 17D20m and d3521N11
(114) SEQ ID NO:92: consensus light chain CDR-L1 of 17N16m and d17N9
(115) SEQ ID NO:93: consensus light chain CDR-L2 of 17D20m, d3521N11, 17N16m and d17N9
(116) SEQ ID NO:94: consensus light chain CDR-L3 of 17N16m and d17N9
DETAILED DESCRIPTION
(117) The present invention provides fully human antibodies that bind to human MASP-2 and inhibit lectin-mediated complement activation while leaving the classical (C1q-dependent) pathway component of the immune system intact. The human anti-MASP-2 antibodies have been identified by screening a phage display library, as described in Examples 2-9. As described in Examples 10-12, high affinity anti-MASP-2 antibodies have been identified with the ability to inhibit lectin-mediated complement activation, as demonstrated in both in vitro assays and in vivo. The variable light and heavy chain fragments of the antibodies have been isolated in both a scFv format and in a full length IgG format. The human anti-MASP-2 antibodies are useful for inhibiting cellular injury associated with lectin-mediated complement pathway activation while leaving the classical (C1q-dependent) pathway component of the immune system intact.
I. Definitions
(118) Unless specifically defined herein, all terms used herein have the same meaning as would be understood by those of ordinary skill in the art of the present invention. The following definitions are provided in order to provide clarity with respect to the terms as they are used in the specification and claims to describe the present invention.
(119) As used herein, the term MASP-2-dependent complement activation comprises MASP-2-dependent activation of the lectin pathway, which occurs under physiological conditions (i.e., in the presence of Ca.sup.++) leading to the formation of the lectin pathway C3 convertase C4b2a and upon accumulation of the C3 cleavage product C3b subsequently to the C5 convertase C4b2a(C3b)n.
(120) As used herein, the term alternative pathway refers to complement activation that is triggered, for example, by zymosan from fungal and yeast cell walls, lipopolysaccharide (LPS) from Gram negative outer membranes, and rabbit erythrocytes, as well as from many pure polysaccharides, rabbit erythrocytes, viruses, bacteria, animal tumor cells, parasites and damaged cells, and which has traditionally been thought to arise from spontaneous proteolytic generation of C3b from complement factor C3.
(121) As used herein, the term lectin pathway refers to complement activation that occurs via the specific binding of serum and non-serum carbohydrate-binding proteins including mannan-binding lectin (MBL), CL-11 and the ficolins (H-ficolin, M-ficolin, or L-ficolin).
(122) As used herein, the term classical pathway refers to complement activation that is triggered by an antibody bound to a foreign particle and requires binding of the recognition molecule C1q.
(123) As used herein, the term MASP-2 inhibitory antibody refers to any anti-MASP-2 antibody, or MASP-2 binding fragment thereof, that binds to or directly interacts with MASP-2 and effectively inhibits MASP-2-dependent complement activation. MASP-2 inhibitory antibodies useful in the method of the invention may reduce MASP-2-dependent complement activation by greater than 20%, such as greater than 30%, or greater than 40%, or greater than 50%, or greater than 60%, or greater than 70%, or greater than 80%, or greater than 90%, or greater than 95%.
(124) As used herein, the term MASP-2 blocking antibody refers to MASP-2 inhibitory antibodies that reduce MASP-2-dependent complement activation by greater than 90%, such as greater than 95%, or greater than 98% (i.e., resulting in MASP-2 complement activation of only 10%, such as only 9%, or only 8%, or only 7%, or only 6%, such as only 5% or less, or only 4%, or only 4%, or only 3% or only 2% or only 1%).
(125) The terms antibody and immunoglobulin are used interchangeably herein. These terms are well understood by those in the field, and refer to a protein consisting of one or more polypeptides that specifically binds an antigen. One form of antibody constitutes the basic structural unit of an antibody. This form is a tetramer and consists of two identical pairs of antibody chains, each pair having one light and one heavy chain. In each pair, the light and heavy chain variable regions are together responsible for binding to an antigen, and the constant regions are responsible for the antibody effector functions.
(126) As used herein, the term antibody encompasses antibodies and antibody fragments thereof, derived from any antibody-producing mammal (e.g., mouse, rat, rabbit, and primate including human), or from a hybridoma, phage selection, recombinant expression or transgenic animals (or other methods of producing antibodies or antibody fragments), that specifically bind to MASP-2 polypeptides or portions thereof. It is not intended that the term antibody be limited as regards to the source of the antibody or manner in which it is made (e.g., by hybridoma, phage selection, recombinant expression, transgenic animal, peptide synthesis, etc). Exemplary antibodies include polyclonal, monoclonal and recombinant antibodies; multispecific antibodies (e.g., bispecific antibodies); humanized antibodies; murine antibodies; chimeric, mouse-human, mouse-primate, primate-human monoclonal antibodies; and anti-idiotype antibodies, and may be any intact molecule or fragment thereof. As used herein, the term antibody encompasses not only intact polyclonal or monoclonal antibodies, but also fragments thereof (such as dAb, Fab, Fab, F(ab).sub.2, Fv), single chain (ScFv), synthetic variants thereof, naturally occurring variants, fusion proteins comprising an antibody portion with an antigen-binding fragment of the required specificity, humanized antibodies, chimeric antibodies, and any other modified configuration of the immunoglobulin molecule that comprises an antigen-binding site or fragment (epitope recognition site) of the required specificity.
(127) As used herein, the term antigen-binding fragment refers to a polypeptide fragment that contains at least one CDR of an immunoglobulin heavy and/or light chains that binds to human MASP-2. In this regard, an antigen-binding fragment of the herein described antibodies may comprise 1, 2, 3, 4, 5, or all 6 CDRs of a VH and VL sequence set forth herein from antibodies that bind MASP-2. An antigen-binding fragment of the herein described MASP-2-specific antibodies is capable of binding to MASP-2. In certain embodiments, an antigen-binding fragment or an antibody comprising an antigen-binding fragment, mediates inhibition of MASP-2 dependent complement activation.
(128) As used herein the term anti-MASP-2 monoclonal antibodies refers to a homogenous antibody population, wherein the monoclonal antibody is comprised of amino acids that are involved in the selecting binding of an epitope on MASP-2. Anti-MASP-2 monoclonal antibodies are highly specific for the MASP-2 target antigen. The term monoclonal antibody encompasses not only intact monoclonal antibodies and full-length monoclonal antibodies, but also fragments thereof (such as Fab, Fab, F(ab).sub.2, Fv), single chain (ScFv), variants thereof, fusion proteins comprising an antigen-binding portion, humanized monoclonal antibodies, chimeric monoclonal antibodies, and any other modified configuration of the immunoglobulin molecule that comprises an antigen-binding fragment (epitope recognition site) of the required specificity and the ability to bind to an epitope.
(129) As used herein, the modifier monoclonal indicates the character of the antibody as being obtained from a substantially homogenous population of antibodies, and is not. intended to be limited as regards the source of the antibody or the manner in which it is made (e.g., by hybridoma, phage selection, recombinant expression, transgenic animals, etc.). The term includes whole immunoglobulins as well as the fragments etc. described above under the definition of antibody. Monoclonal antibodies can be obtained using any technique that provides for the production of antibody molecules by continuous cell lines in culture, such as the hybridoma method described by Kohler, G., et al., Nature 256:495, 1975, or they may be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567 to Cabilly). Monoclonal antibodies may also be isolated from phage antibody libraries using the techniques described in Clackson, T., et al., Nature 352:624-628, 1991, and Marks, J. D., et al., J. Mol. Biol. 222:581-597, 1991. Such antibodies can be of any immunoglobulin class including IgG, IgM, IgE, IgA, IgD and any subclass thereof.
(130) The recognized immunoglobulin polypeptides include the kappa and lambda light chains and the alpha, gamma (IgG1, IgG2, IgG3, IgG4), delta, epsilon and mu heavy chains or equivalents in other species. Full-length immunoglobulin light chains (of about 25 kDa or about 214 amino acids) comprise a variable region of about 110 amino acids at the NH.sub.2-terminus and a kappa or lambda constant region at the COOH-terminus. Full-length immunoglobulin heavy chains (of about 50 kDa or about 446 amino acids) similarly comprise a variable region (of about 116 amino acids) and one of the aforementioned heavy chain constant regions, e.g., gamma (of about 330 amino acids).
(131) The basic four-chain antibody unit is a heterotetrameric glycoprotein composed of two identical light (L) chains and two identical heavy (H) chains. An IgM antibody consists of 5 of the basic heterotetramer units along with an additional polypeptide called the J chain, and therefore contains 10 antigen binding sites. Secreted IgA antibodies can polymerize to form polyvalent assemblages comprising 2-5 of the basic 4-chain units along with J chain. Each L chain is linked to an H chain by one covalent disulfide bond, while the two H chains are linked to each other by one or more by one or more disulfide bonds, depending on the H chain isotype. Each H and L chain also has regularly spaced intrachain disulfide bridges. The pairing of a VH and VL together forms a single antigen-binding site.
(132) Each H chain has at the N-terminus, a variable domain (VH), followed by three constant domains (CH) for each of the ? and ? chains, and four CH domains (CH) for ? and ? isotypes.
(133) Each L chain has at the N-terminus, a variable domain (VL) followed by a constant domain (CL) at its other end. The VL is aligned with the VH and the CL is aligned with the first constant domain of the heavy chain (CH1). The L chain from any vertebrate species can be assigned to one of two clearly distinct types, called kappa (?) and lambda (?), based on the amino acid sequences of their constant domains (CL).
(134) Depending on the amino acid sequence of the constant domain of their heavy chains (CH), immunoglobulins can be assigned to different classes or isotypes. There are five classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, having heavy chains designated alpha (?), delta (?), epsilon (?), gamma (?) and mu (?), respectively. The ? and ? classes are further divided into subclasses on the basis of minor differences in CH sequence and function, for example, humans express the following subclasses: IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2.
(135) For the structure and properties of the different classes of antibodies, see, e.g., Basic and Clinical Immunology, 8th Edition, Daniel P. Stites, Abba I. Terr and Tristram G. Parslow (eds); Appleton and Lange, Norwalk, Conn., 1994, page 71 and Chapter 6.
(136) The term variable refers to that fact that certain segments of the V domains differ extensively in sequence among antibodies. The V domain mediates antigen binding and defines specificity of a particular antibody for its particular antigen. However, the variability is not evenly distributed across the 110 amino acid span of the variable domains. Rather, the V regions consist of relatively invariant stretches called framework regions (FRs) of 15-30 amino acids separated by shorter regions of extreme variability called hypervariable regions that are each 9-12 amino acids long. The variable domains of native heavy and light chains each comprise four FRs, largely adopting a beta-sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the n-sheet structure. The hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat, et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)). The constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody dependent cellular cytotoxicity (ADCC).
(137) As used herein, the term hypervariable region refers to the amino acid residues of an antibody that are responsible for antigen binding. The hypervariable region generally comprises amino acid residues from a complementary determining region or CDR (i.e., from around about residues 24-34 (L1), 50-56 (L2) and 89-97 (L3) in the light chain variable domain, and around about 31-35 (H1), 50-65 (H2) and 95-102 (H3) in the heavy chain variable domain when numbering in accordance with the Kabat numbering system as described in Kabat, et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)); and/or those residues from a hypervariable loop (i.e., residues 24-34 (L1), 50-56 (L2) and 89-97 (L3) in the light chain variable domain, and 26-32 (H1), 52-56 (H2) and 95-101 (H3) in the heavy chain variable domain when numbered in accordance with the Chothia numbering system, as described in Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)); and/or those residues from a hypervariable loop/CDR (e.g., residues 27-38 (L1), 56-65 (L2) and 105-120 (L3) in the VL, and 27-38 (H1), 56-65 (H2), and 105-120 (H3) in the VH when numbered in accordance with the IMGT numbering system as described in Lefranc, J. P., et al., Nucleic Acids Res 27:209-212; Ruiz, M., et al., Nucleic Acids Res 28:219-221 (2000)).
(138) As used herein, the term antibody fragment refers to a portion derived from or related to a full-length anti-MASP-2 antibody, generally including the antigen binding or variable region thereof. Illustrative examples of antibody fragments include Fab, Fab, F(ab).sub.2, F(ab).sub.2 and Fv fragments, scFv fragments, diabodies, linear antibodies, single-chain antibody molecules, bispecific and multispecific antibodies formed from antibody fragments.
(139) Where bispecific antibodies are to be used, these may be conventional bispecific antibodies, which can be manufactured in a variety of ways (Holliger, P. and Winter G. Current Opinion Biotechnol. 4, 446-449 (1993)), e.g. prepared chemically or from hybrid hybridomas, or may be any of the bispecific antibody fragments mentioned above.
(140) As used herein, a single-chain Fv or scFv antibody fragment comprises the V.sub.H and V.sub.L domains of an antibody, wherein these domains are present in a single polypeptide chain. Generally, the Fv polypeptide further comprises a polypeptide linker between the V.sub.H and V.sub.L domains, which enables the scFv to form the desired structure for antigen binding. See Pluckthun in The Pharmacology of Monoclonal Antibodies, Vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994). Fv is the minimum antibody fragment that contains a complete antigen-recognition and binding site. This fragment consists of a dimer of one heavy and one light chain variable region domain in tight, noncovalent association. From the folding of these two domains emanate six hypervariable loops (three loops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
(141) As used herein, the term specific binding refers to the ability of an antibody to preferentially bind to a particular analyte that is present in a homogeneous mixture of different analytes. In certain embodiments, a specific binding interaction will discriminate between desirable and undesirable analytes in a sample, in some embodiments more than about 10 to 100-fold or more (e.g., more than about 1000- or 10,000-fold). In certain embodiments, the affinity between a capture agent and analyte when they are specifically bound in a capture agent/analyte complex is characterized by a K.sub.D (dissociation constant) of less than about 100 nM, or less than about 50 nM, or less than about 25 nM, or less than about 10 nM, or less than about 5 nM, or less than about 1 nM.
(142) As used herein, the term variant anti-MASP-2 antibody refers to a molecule which differs in amino acid sequence from a parent or reference antibody amino acid sequence by virtue of addition, deletion, and/or substitution of one or more amino acid residue(s) in the parent antibody sequence. In one embodiment, a variant anti-MASP-2 antibody refers to a molecule which contains variable regions that are identical to the parent variable domains, except for a combined total of 1, 2, 3, 4, 5, 6, 7, 8 9 or 10 amino acid substitutions within the CDR regions of the heavy chain variable region, and/or up to a combined total of 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid substitutions with said CDR regions of the light chain variable region. In some embodiments, the amino acid substitutions are conservative sequence modifications.
(143) As used herein, the term parent antibody refers to an antibody which is encoded by an amino acid sequence used for the preparation of the variant. Preferably, the parent antibody has a human framework region and, if present, has human antibody constant region(s). For example, the parent antibody may be a humanized or fully human antibody.
(144) As used herein, the term isolated antibody refers to an antibody that has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes. In preferred embodiments, the antibody will be purified (1) to greater than 95% by weight of antibody as determined by the Lowry method, and most preferably more than 99% by weight; (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator; or (3) to homogeneity by SDS-PAGE under reducing or nonreducing conditions using Coomassie blue or, preferably, silver stain. Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
(145) As used herein, the term epitope refers to the portion of an antigen to which a monoclonal antibody specifically binds. Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. More specifically, the term MASP-2 epitope, as used herein refers to a portion of the corresponding polypeptide to which an antibody immunospecifically binds as determined by any method well known in the art, for example, by immunoassays. Antigenic epitopes need not necessarily be immunogenic. Such epitopes can be linear in nature or can be a discontinuous epitope. Thus, as used herein, the term conformational epitope refers to a discontinuous epitope formed by a spatial relationship between amino acids of an antigen other than an unbroken series of amino acids.
(146) As used herein, the term mannan-binding lectin (MBL) is equivalent to mannan-binding protein (MBP).
(147) As used herein, the membrane attack complex (MAC) refers to a complex of the terminal five complement components (C5-C9) that inserts into and disrupts membranes. Also referred to as C5b-9.
(148) As used herein, a subject includes all mammals, including without limitation, humans, non-human primates, dogs, cats, horses, sheep, goats, cows, rabbits, pigs and rodents.
(149) As used herein, the amino acid residues are abbreviated as follows: alanine (Ala;A), asparagine (Asn;N), aspartic acid (Asp;D), arginine (Arg;R), cysteine (Cys;C), glutamic acid (Glu;E), glutamine (Gln;Q), glycine (Gly;G), histidine (His;H), isoleucine (Ile;I), leucine (Leu;L), lysine (Lys;K), methionine (Met;M), phenylalanine (Phe;F), proline (Pro;P), serine (Ser;S), threonine (Thr;T), tryptophan (Trp;W), tyrosine (Tyr;Y), and valine (Val;V).
(150) In the broadest sense, the naturally occurring amino acids can be divided into groups based upon the chemical characteristic of the side chain of the respective amino acids. By hydrophobic amino acid is meant either Ile, Leu, Met, Phe, Trp, Tyr, Val, Ala, Cys or Pro. By hydrophilic amino acid is meant either Gly, Asn, Gln, Ser, Thr, Asp, Glu, Lys, Arg or His. This grouping of amino acids can be further subclassed as follows. By uncharged hydrophilic amino acid is meant either Ser, Thr, Asn or Gln. By acidic amino acid is meant either Glu or Asp. By basic amino acid is meant either Lys, Arg or His.
(151) As used herein the term conservative amino acid substitution is illustrated by a substitution among amino acids within each of the following groups: (1) glycine, alanine, valine, leucine, and isoleucine, (2) phenylalanine, tyrosine, and tryptophan, (3) serine and threonine, (4) aspartate and glutamate, (5) glutamine and asparagine, and (6) lysine, arginine and histidine.
(152) As used herein, an isolated nucleic acid molecule is a nucleic acid molecule (e.g., a polynucleotide) that is not integrated in the genomic DNA of an organism. For example, a DNA molecule that encodes a growth factor that has been separated from the genomic DNA of a cell is an isolated DNA molecule. Another example of an isolated nucleic acid molecule is a chemically-synthesized nucleic acid molecule that is not integrated in the genome of an organism. A nucleic acid molecule that has been isolated from a particular species is smaller than the complete DNA molecule of a chromosome from that species.
(153) As used herein, a nucleic acid molecule construct is a nucleic acid molecule, either single- or double-stranded, that has been modified through human intervention to contain segments of nucleic acid combined and juxtaposed in an arrangement not existing in nature.
(154) As used herein, an expression vector is a nucleic acid molecule encoding a gene that is expressed in a host cell. Typically, an expression vector comprises a transcription promoter, a gene, and a transcription terminator. Gene expression is usually placed under the control of a promoter, and such a gene is said to be operably linked to the promoter. Similarly, a regulatory element and a core promoter are operably linked if the regulatory element modulates the activity of the core promoter.
(155) As used herein, the terms approximately or about in reference to a number are generally taken to include numbers that fall within a range of 5% in either direction (greater than or less than) of the number unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value). Where ranges are stated, the endpoints are included within the range unless otherwise stated or otherwise evident from the context.
(156) As used herein the singular forms a, an and the include plural aspects unless the context clearly dictates otherwise. Thus, for example, reference to a cell includes a single cell, as well as two or more cells; reference to an agent includes one agent, as well as two or more agents; reference to an antibody includes a plurality of such antibodies and reference to a framework region includes reference to one or more framework regions and equivalents thereof known to those skilled in the art, and so forth.
(157) Each embodiment in this specification is to be applied mutatis mutandis to every other embodiment unless expressly stated otherwise.
(158) Standard techniques may be used for recombinant DNA, oligonucleotide synthesis, and tissue culture and transformation (e.g., electroporation, lipofection). Enzymatic reactions and purification techniques may be performed according to manufacturer's specifications or as commonly accomplished in the art or as described herein. These and related techniques and procedures may be generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the present specification. See e.g., Sambrook et al., 2001, MOLECULAR CLONING: A LABORATORY MANUAL, 3d ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Current Protocols in Molecular Biology (Greene Publ. Assoc. Inc. & John Wiley & Sons, Inc., NY, N.Y.); Current Protocols in Immunology (Edited by: John E. Coligan, Ada M. Kruisbeek, David H. Margulies, Ethan M. Shevach, Warren Strober 2001 John Wiley & Sons, NY, N.Y.); or other relevant Current Protocol publications and other like references. Unless specific definitions are provided, the nomenclature utilized in connection with, and the laboratory procedures and techniques of, molecular biology, analytical chemistry, synthetic organic chemistry, and medicinal and pharmaceutical chemistry described herein are those well known and commonly used in the art. Standard techniques may be used for recombinant technology, molecular biological, microbiological, chemical syntheses, chemical analyses, pharmaceutical preparation, formulation, and delivery, and treatment of patients.
(159) It is contemplated that any embodiment discussed in this specification can be implemented with respect to any method, kit, reagent, or composition of the invention, and vice versa. Furthermore, compositions of the invention can be used to achieve methods of the invention.
II. Overview
(160) Lectins (MBL, M-ficolin, H-ficolin, L-ficolin and CL-11) are the specific recognition molecules that trigger the innate complement system and the system includes the lectin initiation pathway and the associated terminal pathway amplification loop that amplifies lectin-initiated activation of terminal complement effector molecules. C1q is the specific recognition molecule that triggers the acquired complement system and the system includes the classical initiation pathway and associated terminal pathway amplification loop that amplifies C1q-initiated activation of terminal complement effector molecules. We refer to these two major complement activation systems as the lectin-dependent complement system and the C1q-dependent complement system, respectively.
(161) In addition to its essential role in immune defense, the complement system contributes to tissue damage in many clinical conditions. Thus, there is a pressing need to develop therapeutically effective complement inhibitors to prevent these adverse effects.
(162) As described in U.S. Pat. No. 7,919,094, co-pending U.S. patent application Ser. No. 12/905,972 (published as US 2011/0091450), and co-pending U.S. patent application Ser. No. 13/083,441 (published as US2011/0311549), each of which is assigned to Omeros Corporation, the assignee of the instant application, and each of which is hereby incorporated by reference, it was determined through the use of a MASP-2?/? mouse model that it is possible to inhibit the lectin mediated MASP-2 pathway while leaving the classical pathway intact. With the recognition that it is possible to inhibit the lectin mediated MASP-2 pathway while leaving the classical pathway intact comes the realization that it would be highly desirable to specifically inhibit only the complement activation system causing a particular pathology without completely shutting down the immune defense capabilities of complement. For example, in disease states in which complement activation is mediated predominantly by the lectin-dependent complement system, it would be advantageous to specifically inhibit only this system. This would leave the C1q-dependent complement activation system intact to handle immune complex processing and to aid in host defense against infection.
(163) The preferred protein component to target in the development of therapeutic agents to specifically inhibit the lectin-dependent complement system is MASP-2. Of all the known protein components of the lectin-dependent complement system (MBL, H-ficolin, M-ficolin, L-ficolin, MASP-2, C2-C9, Factor B, Factor D, and properdin), only MASP-2 is both unique to the lectin-dependent complement system and required for the system to function. The lectins (MBL, H-ficolin, M-ficolin, L-ficolin and CL-11) are also unique components in the lectin-dependent complement system. However, loss of any one of the lectin components would not necessarily inhibit activation of the system due to lectin redundancy. It would be necessary to inhibit all five lectins in order to guarantee inhibition of the lectin-dependent complement activation system. Furthermore, since MBL and the ficolins are also known to have opsonic activity independent of complement, inhibition of lectin function would result in the loss of this beneficial host defense mechanism against infection. In contrast, this complement-independent lectin opsonic activity would remain intact if MASP-2 was the inhibitory target. An added benefit of MASP-2 as the therapeutic target to inhibit the lectin-dependent complement activation system is that the plasma concentration of MASP-2 is among the lowest of any complement protein 500 ng/ml); therefore, correspondingly low concentrations of high-affinity inhibitors of MASP-2 is sufficient to obtain full inhibition, as demonstrated in the Examples herein.
(164) In accordance with the foregoing, as described herein, the present invention provides monoclonal fully human anti-MASP-2 antibodies that bind to human MASP-2 with high affinity and are capable of inhibiting lectin-mediated complement pathway activation.
III. MASP-2 Inhibitory Antibodies
(165) In one aspect, the invention provides a monoclonal fully human anti-MASP-2 antibody, or antigen binding fragment thereof, that specifically binds to human MASP-2 and inhibits or blocks MASP-2-dependent complement activation. MASP-2 inhibitory antibodies may effectively inhibit or effectively block the MASP-2-dependent complement activation system by inhibiting or blocking the biological function of MASP-2. For example, an inhibitory antibody may effectively inhibit or block MASP-2 protein-to-protein interactions, interfere with MASP-2 dimerization or assembly, block Ca.sup.2+ binding, or interfere with the MASP-2 serine protease active site.
(166) MASP-2 Epitopes
(167) The invention provides fully human antibodies that specifically bind to human MASP-2. The MASP-2 polypeptide exhibits a molecular structure similar to MASP-1, MASP-3, and C1r and C1s, the proteases of the C1 complement system. The cDNA molecule set forth in SEQ ID NO:1 encodes a representative example of MASP-2 (consisting of the amino acid sequence set forth in SEQ ID NO:2) and provides the human MASP-2 polypeptide with a leader sequence (aa 1-15) that is cleaved after secretion, resulting in the mature form of human MASP-2 (SEQ ID NO:3). As shown in
(168) Those skilled in the art will recognize that the sequences disclosed in SEQ ID NO:1 and SEQ ID NO:4 represent single alleles of human and rat MASP-2, respectively, and that allelic variation and alternative splicing are expected to occur. Allelic variants of the nucleotide sequences shown in SEQ ID NO:1 and SEQ ID NO:4, including those containing silent mutations and those in which mutations result in amino acid sequence changes, are within the scope of the present invention. Allelic variants of the MASP-2 sequence can be cloned by probing cDNA or genomic libraries from different individuals according to standard procedures.
(169) The domains of the human MASP-2 protein (SEQ ID NO:3) are shown in
(170) Several proteins have been shown to bind to, or interact with MASP-2 through protein-to-protein interactions. For example, MASP-2 is known to bind to, and form Ca.sup.2+ dependent complexes with, the lectin proteins MBL, H-ficolin and L-ficolin. Each MASP-2/lectin complex has been shown to activate complement through the MASP-2-dependent cleavage of proteins C4 and C2 (Ikeda, K., et al., J. Biol. Chem. 262:7451-7454, 1987; Matsushita, M., et al., J. Exp. Med. 176:1497-2284, 2000; Matsushita, M., et al., J. Immunol. 168:3502-3506, 2002). Studies have shown that the CUB1-EGF domains of MASP-2 are essential for the association of MASP-2 with MBL (Thielens, N. M., et al., J. Immunol. 166:5068, 2001). It has also been shown that the CUB1EGFCUBII domains mediate dimerization of MASP-2, which is required for formation of an active MBL complex (Wallis, R., et al., J. Biol. Chem. 275:30962-30969, 2000). Therefore, MASP-2 inhibitory antibodies can be identified that bind to or interfere with MASP-2 target regions known to be important for MASP-2-dependent complement activation.
(171) TABLE-US-00001 TABLE 1 MASP-2 Polypeptide Domains SEQ ID NO: Amino Acid Sequence SEQ ID NO: 2 human MASP-2 protein (w/leader) SEQ ID NO: 3 human MASP-2 mature protein SEQ ID NO: 5 rat MASP-2 protein (w/leader) SEQ ID NO: 6 rat MASP-2 mature protein SEQ ID NO: 7 CUBI domain of human MASP-2 (aa 1-121 of SEQ ID NO: 3) SEQ ID NO: 8 CUBI/EGF domains of human MASP-2 (aa 1-166 of SEQ ID NO: 3) SEQ ID NO: 9 CUBI/EGF/CUBII domains of human MASP-2 (aa 1-277 of SEQ ID NO: 3) SEQ ID NO: 10 EGF domain of human MASP-2 (aa 122-166 of SEQ ID NO: 3) SEQ ID NO: 11 CCPI/CCPII/SP domains of human MASP-2 (aa 278-671 aa of SEQ ID NO: 3) SEQ ID NO: 12 CCPI/CCPII domains of human MASP-2 (aa 278-429 of SEQ ID NO: 3) SEQ ID NO: 13 CCPI domain of human MASP-2 (aa 278-347 of SEQ ID NO: 3) SEQ ID NO: 14 CCPII/SP domains of human MASP-2 (aa 348-671 of SEQ ID NO: 3) SEQ ID NO: 15 CCPII domain of human MASP-2 (aa 348-429 of SEQ ID NO: 3) SEQ ID NO: 16 SP domain of human MASP-2 (aa 429-671 of SEQ ID NO: 3) SEQ ID NO: 17 Serine-protease inactivated mutant form (GKDSCRGDAGGALVFL) (aa 610-625 of SEQ ID NO: 3 with mutated Ser 618)
(172) In one embodiment, the anti-MASP-2 inhibitory antibodies of the invention bind to a portion of the full length human MASP-2 protein (SEQ ID NO:3), such as CUBI, EGF, CUBII, CCPI, CCPII, or SP domain of MASP-2. In some embodiments, the anti-MASP-2 inhibitory antibodies of the invention bind to an epitope in the CCP1 domain (SEQ ID NO:13 (aa 278-347 of SEQ ID NO:3)). For example, anti-MASP-2 antibodies (e.g., OMS646) have been identified that only bind to MASP-2 fragments containing the CCP1 domain and inhibit MASP-2 dependent complement activation, as described in Example 9.
(173) Binding Affinity of MASP-2 Inhibitory Antibodies
(174) The anti-MASP-2 inhibitory antibodies specifically bind to human MASP-2 (set forth as SEQ ID NO:3, encoded by SEQ ID NO:1), with an affinity of at least ten times greater than to other antigens in the complement system. In some embodiments, the MASP-2 inhibitory antibodies specifically bind to human MASP-2 with a binding affinity of at least 100 times greater than to other antigens in the complement system.
(175) In some embodiments, the MASP-2 inhibitory antibodies specifically bind to human MASP-2 with a K.sub.D (dissociation constant) of less than about 100 nM, or less than about 50 nM, or less than about 25 nM, or less than about 10 nM, or less than about 5 nM, or less than or equal to about 1 nM, or less than or equal to 0.1 nM. The binding affinity of the MASP-2 inhibitory antibodies can be determined using a suitable binding assay known in the art, such as an ELISA assay, as described in Examples 3-5 herein.
(176) Potency of MASP-2 Inhibitory Antibodies
(177) In one embodiment, a MASP-2 inhibitory antibody is sufficiently potent to inhibit MASP-2 dependent complement activation at an IC.sub.50?30 nM, preferably less than or about 20 nM, or less than about 10 nM or less than about 5 nM, or less than or equal to about 3 nM, or less than or equal to about 1 nM when measured in 1% serum.
(178) In one embodiment, a MASP-2 inhibitory antibody is sufficiently potent to inhibit MASP-2 dependent complement activation at an IC.sub.50?30 nM, preferably less than or about 20 nM, or less than about 10 nM or less than about 5 nM, or less than or equal to about 3 nM, or less than or equal to about 1 nM, when measured in 90% serum.
(179) The inhibition of MASP-2-dependent complement activation is characterized by at least one of the following changes in a component of the complement system that occurs as a result of administration of a MASP-2 inhibitory antibody: the inhibition of the generation or production of MASP-2-dependent complement activation system products C4a, C3a, C5a and/or C5b-9 (MAC) (measured, for example, as described in Example 2 of U.S. Pat. No. 7,919,094) as well as their catabolic degradation products (e.g., C3desArg), the reduction of C4 cleavage and C4b deposition (measured, for example, as described in Example 5) and its subsequent catabolic degradation products (e.g., C4bc or C4d), or the reduction of C3 cleavage and C3b deposition (measured, for example, as described in Example 5), or its subsequent catabolic degradation products (e.g., C3bc, C3d, etc).
(180) In some embodiments, the MASP-2 inhibitory antibodies of the invention are capable of inhibiting C3 deposition in full serum to less than 80%, such as less than 70%, such as less than 60%, such as less than 50%, such as less than 40%, such as less than 30%, such as less than 20%, such as less than 15%, such as less than 10% of control C3 deposition.
(181) In some embodiments, the MASP-2 inhibitory antibodies of the invention are capable of inhibiting C4 deposition in full serum to less than 80%, such as less than 70%, such as less than 60%, such as less than 50%, such as less than 40%, such as less than 30%, such as less than 20%, such as less than 15%, such as less than 10% of control C4 deposition.
(182) In some embodiments, the anti-MASP-2 inhibitory antibodies selectively inhibit MASP-2 complement activation (i.e., bind to MASP-2 with at least 100-fold or greater affinity than to C1r or C1s), leaving the C1q-dependent complement activation system functionally intact (i.e., at least 80%, or at least 90%, or at least 95%, or at least 98%, or 100% of the classical pathway activity is retained).
(183) In some embodiments, the subject anti-MASP-2 inhibitory antibodies have the following characteristics: (a) high affinity for human MASP-2 (e.g., a K.sub.D of 10 nM or less, preferably a K.sub.D of 1 nM or less), and (b) inhibit MASP-2 dependent complement activity in 90% human serum with an IC.sub.50 of 30 nM or less, preferably an IC.sub.50 of 10 nM or less).
(184) As described in Examples 2-12, fully human antibodies have been identified that bind with high affinity to MASP-2 and inhibit lectin-mediated complement activation while leaving the classical (C1q-dependent) pathway component of the immune system intact. The variable light and heavy chain fragments of the antibodies have been sequenced, isolated and analyzed in both a scFv format and in a full length IgG format.
(185) Substitutable positions of a human anti-MASP-2 inhibitory antibody, as well the choice of amino acids that may be substituted into those positions, are revealed by aligning the heavy and light chain amino acid sequences of the anti-MASP-2 inhibitory antibodies discussed above, and determining which amino acids occur at which positions of those antibodies. In one exemplary embodiment, the heavy and light chain amino acid sequences of
(186) TABLE-US-00002 TABLE 2 Sequences of representative anti-MASP-2 antibodies ID Reference: mother/daughter VH VL antibody type 17D20 mother clone SEQ ID NO: 18 SEQ ID NO: 22 scFv 17D20_35VH- daughter clone SEQ ID NO: 20 SEQ ID NO: 24 IgG2 21N11VL (one aa change (10 aa changes (OMS644) in VH (A to R) from parent VL) at position 102 of SEQ ID NO: 18) 17D20_35VH- daughter clone SEQ ID NO: 20 SEQ ID NO: 24 IgG4 21N11VL (one aa change (OMS645) in VH (A to R) at position 102 of SEQ ID NO: 18) 17D20_35VH- daughter clone SEQ ID NO: 20 SEQ ID NO: 24 IgG4 (mutant 21N11VL (one aa change IgG4 hinge (OMS646) in VH (A to R) region) at position 102 of SEQ ID NO: 18) 17N16 mother SEQ ID NO: 21, SEQ ID NO: 25 scFv 17N16_17N9 daughter SEQ ID NO: 21 SEQ ID NO: 27 IgG2 (OMS641) (17aa changes from SEQ ID NO: 25) 17N16_17N9 daughter SEQ ID NO: 21 SEQ ID NO: 27 IgG4 (OMS642) 17N16_17N9 daughter SEQ ID NO: 21 SEQ ID NO: 27 IgG4 (mutant (OMS643) IgG4 hinge region)
(187) In certain embodiments, a subject human anti-MASP-2 monoclonal inhibitory antibody has a heavy chain variable domain that is substantially identical (e.g., at least about 70%, at least 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 96% identical, or at least about 97% identical, or at least about 98% identical, or at least 99% identical), to that of any of the heavy chain variable domain sequences set forth in TABLE 2.
(188) In some embodiments, a subject human anti-MASP-2 monoclonal inhibitory antibody has a heavy chain variable domain that is substantially identical (e.g., at least about 70%, at least 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 96% identical, or at least about 97% identical, or at least about 98% identical, or at least 99% identical) to 17D20 (VH), set forth as SEQ ID NO:18. In some embodiments, the subject human anti-MASP-2 monoclonal inhibitory antibody has a heavy chain variable domain that comprises, or consists of SEQ ID NO:18.
(189) In some embodiments, a subject human anti-MASP-2 monoclonal inhibitory antibody has a heavy chain variable domain that is substantially identical (e.g. at least about 70%, at least 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96% identical, at least about 97% identical, at least about 98% identical, or at least 99% identical) to 17D20_cd35VH2N11 (VH), set forth as SEQ ID NO:20. In some embodiments, the subject human anti-MASP-2 monoclonal inhibitory antibody has a heavy chain variable domain that comprises, or consists of SEQ ID NO:20.
(190) In some embodiments, a subject human anti-MASP-2 monoclonal inhibitory antibody has a heavy chain variable domain that is substantially identical (e.g., at least about 70%, at least 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 96% identical, or at least about 97% identical, or at least about 98% identical, or at least 99% identical) to 17N16 (VH), set forth as SEQ ID NO:21. In some embodiments, the subject human anti-MASP-2 monoclonal inhibitory antibody has a heavy chain variable domain that comprises, or consists of SEQ ID NO:21.
(191) In some embodiments, a subject human anti-MASP-2 monoclonal inhibitory antibody has a light chain variable domain that is substantially identical (e.g., at least about 70%, at least 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 96% identical, or at least about 97% identical, or at least about 98% identical, or at least 99% identical), to that of any of the light chain variable domain sequences set forth in TABLE 2.
(192) In some embodiments, a subject human anti-MASP-2 monoclonal inhibitory antibody has a light chain variable domain that is substantially identical (e.g., at least about 70%, at least 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 96% identical, or at least about 97% identical, or at least about 98% identical, or at least 99% identical) to 17D20 (VL), set forth as SEQ ID NO:22. In some embodiments, the subject human anti-MASP-2 monoclonal inhibitory antibody has a light chain that comprises, or consists of SEQ ID NO:22.
(193) In some embodiments, a subject human anti-MASP-2 monoclonal inhibitory antibody has a light chain variable domain that is substantially identical (e.g., at least about 70%, at least 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 96% identical, or at least about 97% identical, or at least about 98% identical, or at least 99% identical) to 17D20_35VH-21N11VL (VL), set forth as SEQ ID NO:24. In some embodiments, the subject human anti-MASP-2 monoclonal inhibitory antibody has a light chain that comprises, or consists of SEQ ID NO:24.
(194) In some embodiments, a subject human anti-MASP-2 monoclonal inhibitory antibody has a light chain variable domain that is substantially identical (e.g., at least about 70%, at least 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 96% identical, or at least about 97% identical, or at least about 98% identical, or at least 99% identical) to 17N16 (VL), set forth as SEQ ID NO:25. In some embodiments, the subject human anti-MASP-2 monoclonal inhibitory antibody has a light chain that comprises, or consists of SEQ ID NO:25.
(195) In some embodiments, a subject human anti-MASP-2 monoclonal inhibitory antibody has a light chain variable domain that is substantially identical (e.g., at least about 70%, at least 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 96% identical, or at least about 97% identical, or at least about 98% identical, or at least 99% identical) to 17N16_17N9 (VL), set forth as SEQ ID NO:27. In some embodiments, the subject human anti-MASP-2 monoclonal inhibitory antibody has a light chain that comprises, or consists of SEQ ID NO:27.
(196) In some embodiments, the anti-MASP-2 antibodies of the invention contain a heavy or light chain that is encoded by a nucleotide sequence that hybridizes under high stringency conditions to a nucleotide sequence encoding a heavy or light chain, as set forth in TABLE 2. High stringency conditions include incubation at 50? C. or higher in 0.1?SSC (15 mM saline/0.15 mM sodium citrate).
(197) In some embodiments, the anti-MASP-2 inhibitory antibodies of the invention have a heavy chain variable region comprising one or more CDRs (CDR1, CDR2 and/or CDR3) that are substantially identical (e.g., at least about 70%, at least 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 96% identical, or at least about 97% identical, or at least about 98% identical, or at least 99% identical), or comprise or consist of the identical sequence as compared to the amino acid sequence of the CDRs of any of the heavy chain variable sequences shown in
(198) In some embodiments, the anti-MASP-2 inhibitory antibodies of the invention have a light chain variable region comprising one or more CDRs (CDR1, CDR2 and/or CDR3) that are substantially identical (e.g., at least about 70%, at least 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 96% identical, or at least about 97% identical, or at least about 98% identical, or at least 99% identical), or comprise or consist of the identical sequence as compared to the amino acid sequence of the CDRs of any of the light chain variable sequences shown in
(199) Heavy Chain Variable Region
(200) TABLE-US-00003 TABLE 3A Heavy chain (aa 1-20) Heavy chain aa 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 17D20m Q V T L K E S G P V L V K P T E T L T L (SEQ: 18) d3521N11 Q V T L K E S G P V L V K P T E T L T L (SEQ: 20) 17N16m Q V Q L Q Q S G P G L V K P S Q T L S L (SEQ: 21) d17N9 Q V Q L Q Q S G P G L V K P S Q T L S L (SEQ: 21)
(201) TABLE-US-00004 TABLE 3B Heavy chain (aa 21-40) Heavy chain CDR-H1 aa 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 17D20m T C T V S G F S L S R G K M G V S W I R (SEQ: 18) d3521N11 T C T V S G F S L S R G K M G V S W I R (SEQ: 20) 17N16m T C A I S G D S V S S T S A A W N W I R (SEQ: 21) d17N9 T C A I S G D S V S S T S A A W N W I R (SEQ: 21)
(202) TABLE-US-00005 TABLE 3C Heavy chain (aa 41-60) Heavy chain CDR-H2 aa 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 17D20m Q P P G K A L E W L A H I F S S D E K S (SEQ: 18) d3521N11 Q P P G K A L E W L A H I F S S D E K S (SEQ: 20) 17N16m Q S P S R G L E W L G R T Y Y R S K W Y (SEQ: 21) d17N9 Q S P S R G L E W L G R T Y Y R S K W Y (SEQ: 21)
(203) TABLE-US-00006 TABLE 3D Heavy chain (aa 61-80) Heavy chain CDR-H2 (cont'd) aa 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 17D20m Y R T S L K S R L T I S K D T S K N Q V (SEQ: 18) d3521N11 Y R T S L K S R L T I S K D T S K N Q V (SEQ: 20) 17N16m N D Y A V S V K S R I T I N P D T S K N (SEQ: 21) d17N9 N D Y A V S V K S R I T I N P D T S K N (SEQ: 21)
(204) TABLE-US-00007 TABLE 3E Heavy chain (aa 81-100) Heavy chain CDR-H3 aa 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 17D20m V L T M T N M D P V D T A T Y Y C A R I (SEQ: 18) d3521N11 V L T M T N M D P V D T A T Y Y C A R I (SEQ: 20) 17N16m Q F S L Q L N S V T P E D T A V Y Y C A (SEQ: 21) d17N9 Q F S L Q L N S V T P E D T A V Y Y C A (SEQ: 21)
(205) TABLE-US-00008 TABLE 3F heavy chain (aa 101-118) Heavy chain CDR-H3 (cont'd) aa 101 102 103 104 105 106 107 108 109 110 111 112 17D20m R A G G I D Y W G Q G T (SEQ: 19) d3521N11 R R G G I D Y W G Q G T (SEQ: 20) 17N16m R D P F G V P F D I W G (SEQ: 21) d17N9 R D P F G V P F D I W G (SEQ: 21) Heavy chain CDR-H3 (cont'd) aa 113 114 115 116 117 118 119 120 17D20m (SEQ: 19) L V T V S S d3521N11 (SEQ: 20) L V T V S S 17N16m (SEQ: 21) Q G T M V T V S d17N9 (SEQ: 21) Q G T M V T V S
(206) Presented below are the heavy chain variable region (VH) sequences for the mother clones and daughter clones listed above in TABLE 2 and TABLES 3A-F.
(207) The Kabat CDRs (31-35 (H1), 50-65 (H2) and 95-102 (H3)) are bolded; and the Chothia CDRs (26-32 (H1), 52-56 (H2) and 95-101 (H3)) are underlined.
(208) TABLE-US-00009 17D20heavychainvariableregion(VH)(SEQID NO:18): QVTLKESGPVLVKPTETLTLTCTVSGFSLSRGKMGVSWIRQPPGKALEWL AHIFSSDEKSYRTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI RAGGIDYWGQGTLVTVSS 17D20_35VH-21N11VLheavychainvariableregion (VH)(SEQIDNO:20) QVTLKESGPVLVKPTETLTLTCTVSGFSLSRGKMGVSWIRQPPGKALEWL AHIFSSDEKSYRTSLKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI RRGGIDYWGQGTLVTVSS 17N16heavychainvariableregion(VH)(SEQID NO:21) QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSTSAAWNWIRQSPSRGLEWL GRTYYRSKWYNDYAVSVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCA RDPFGVPFDIWGQGTMVTVSS
(209) TABLE-US-00010 TABLE4 HeavyChainCDRs Clone Reference CDR aaSequence SEQIDNO: 17D20m CDR-H1(kabat) RGKMG 28 d3521N11 CDR-H1(kabat) RGKMG 28 17N16m CDR-H1(kabat) STSAA 29 d17N9 CDR-H1(kabat) STSAA 29 17D20m CDR-H1(chothia) GFSLSRG 30 d3521N11 CDR-H1(chothia) GFSLSRG 30 17N16m CDR-H1(chothia) GDSVSST 31 d17N9 CDR-H1(chothia) GDSVSST 31 17D20m CDR-H2(kabat) LAHIFSSDEKSYRTSL 32 d3521N11 CDR-H2(kabat) LAHIFSSDEKSYRTSL 32 17N16m CDR-H2(kabat) LGRTYYRSKWYNDYAV 33 d17N9 CDR-H2(chothia) LGRTYYRSKWYNDYAV 33 17D20m CDR-H2(chothia) HIFSS 34 d3521N11 CDR-H2(chothia) HIFSS 34 17N16m CDR-H2(chothia) RTYYR 35 d17N9 CDR-H2(chothia) RTYYR 35 17D20m CDR-H3(kabat) YYCARIRA 36 d3521N11 CDR-H3(kabat) YYCARIRR 37 17D20mand CDR-H3(kabat) YYCARIRX 90 d3521N11 (whereinXatposition8is consensus A(Ala)orR(Arg)) 17N16m CDR-H3(kabat) AVYYCARD 38 d17N9 CDR-H3(kabat) AVYYCARD 38 17D20m CDR-H3(chothia) YYCARIR 39 d3521N11 CDR-H3(chothia) YYCARIR 39 17N16m CDR-H3(chothia) AVYYCAR 40 d17N9 CDR-H3(chothia) AVYYCAR 40
(210) Light Chain Variable Regions
(211) TABLE-US-00011 TABLE 5A Light chain (aa 1-20) Light chain aa 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 17D20m Q P V L T Q P P S V S V S P G Q T A S I (SEQ: 22) d3521N11 Q P V L T Q P P S L S V S P G Q T A S I (SEQ: 24) 17N16m S Y V L T Q P P S V S V A P G Q T A R I (SEQ: 25) d17N9 S Y E L I Q P P S V S V A P G Q T A T I (SEQ: 27)
(212) TABLE-US-00012 TABLE 5B Light chain (aa 21-40) Light chain CDR-L1 aa 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 17D20m T C S G D K L G D K F A Y W Y Q Q K P G (SEQ: 22) d3521N11 T C S G E K L G D K Y A Y W Y Q Q K P G (SEQ: 24) 17N16m T C G G N N I G S K N V H W Y Q Q K P G (SEQ: 25) d17N9 T C A G D N L G K K R V H W Y Q Q R P G (SEQ: 27)
(213) TABLE-US-00013 TABLE 5C Light chain (aa 41-60) Light chain CDR-L2 aa 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 17D20m H S P V L V I Y Q D N K R P S G I P G R (SEQ: 22) d3521N11 Q S P V L V M Y Q D K Q R P S G I P E R (SEQ: 24) 17N16m Q A P V L V V Y D D S D R P S G I P E R (SEQ: 25) d17N9 Q A P V L V I Y D D S D R P S G I P D R (SEQ: 27)
(214) TABLE-US-00014 TABLE 5D Light chain (aa 61-80) Light chain CDR-L2 (cont'd) aa 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 17D20m F S G S N S G N T A T L T I S G T Q A M (SEQ: 22) d3521N11 F S G S N S G N T A T L T I S G T Q A M (SEQ: 24) 17N16m F S G S N S G N T A T L T V S R V E A G (SEQ: 25) d17N9 F S A S N S G N T A T L T I T R G E A G (SEQ: 27)
(215) TABLE-US-00015 TABLE 5E Light chain (aa 81-100) Light chain CDR-L3 aa 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 17D20m D E A D Y Y C Q A W D S S T A V F G T G (SEQ: 22) d3521N11 D X A D Y Y C Q A W D S S T A V F G G G (SEQ: 24) 17N16m D E A D Y Y C Q V W D I I T D H V V F G (SEQ: 25) d17N9 D E A D Y Y C Q V W D I A T D H V V F G (SEQ: 27)
(216) TABLE-US-00016 TABLE 5F Light chain (aa 101-120) Light chain CDR-L3 (cont'd) aa 101 102 103 104 105 106 107 108 109 110 111 112 17D20m T K V T V L A A A G S E (SEQ: 22) d3521N11 T K L T V L A A A G S E (SEQ: 24) 17N16m G G T K L T V L A A A G (SEQ: 25) d17N9 G G T K L T V L A A A G (SEQ: 27) Light chain CDR-L3 (cont'd) aa 113 114 115 116 117 118 119 120 17D20m (SEQ: 22) Q K L I S E E D d3521N11 (SEQ: 24) Q K L I S E E D 17N16m (SEQ: 25) S E Q K L I S E d17N9 (SEQ: 27) S E Q K L I S E
(217) Presented below are the light chain variable region (VL) sequences for the mother clones and daughter clones listed above in TABLE 2 and TABLES 5A-F.
(218) The Kabat CDRs (24-34 (L1); 50-56 (L2); and 89-97 (L3) are bolded; and the Chothia CDRs (24-34 (L1); 50-56 (L2) and 89-97 (L3) are underlined. These regions are the same whether numbered by the Kabat or Chothia system.
(219) TABLE-US-00017 17D20mlightchainvariableregion(VL)(SEQID NO:22) QPVLTQPPSVSVSPGQTASITCSGDKLGDKFAYWYQQKPGHSPVLVIYQD NKRPSGIPGRFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAVFGTG TKVTVLA 17D20md3521N11lightchainvariableregion (VL)(SEQIDNO:24) QPVLTQPPSLSVSPGQTASITCSGEKLGDKYAYWYQQKPGQSPVLVMYQD KQRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAVFGGG TKLTVL 17N16mlightchainvariableregion(VL)(SEQID NO:25) SYVLTQPPSVSVAPGQTARITCGGNNIGSKNVHWYQQKPGQAPVLVVYDD SDRPSGIPERFSGSNSGNTATLTVSRVEAGDEADYYCQVWDTTTDHVVFG GGTKLTVLAAAGSEQKLISE 17N16mdl7N9lightchainvariableregion(VL) (SEQIDNO:27) SYELIQPPSVSVAPGQTATITCAGDNLGKKRVHWYQQRPGQAPVLVIYDD SDRPSGIPDRFSASNSGNTATLTITRGEAGDEADYYCQVWDIATDHVVFG GGTKLTVLAAAGSEQKLISE
(220) TABLE-US-00018 TABLE6 LightChainCDRs(Kabat/chothia) Reference CDR aaSequence SEQIDNO: 17D20m CDR-L1 GDKLGDKFAYW 41 d3521N11 CDR-L1 GEKLGDKYAYW 42 17D20mand CDR-L1 GXKLGDKXAYW 91 d3521N11 (whereinXatposition2isD consensus (Asp)orE(Glu);and whereinXatposition8isF (Phe)orY(Tyr) 17N16m CDR-L1 GNNIGSKNVHW 43 d17N9 CDR-L1 GDNLGKKRVHW 44 17N16mand CDR-L1 GXNXGXKXVHW 92 d17N9consensus (whereinXatposition2isN (Asn)orD(Asp);whereinX atposition4isI(Ile)orL (Leu);whereinXatposition 6isS(Ser)orK(Lys);and whereinXatposition8isN (Asn)orR(Arg)) d17N9 CDR-L1(aa23-38) AGDNLGKKRVHWYQQR 45 17D20m CDR-L2 DNKRPSG 46 d3521N11 CDR-L2 DKQRPSG 47 d3521N11 CDR-L2(aa50-60) DKQRPSGIPER 48 17N16m CDR-L2 DSDRPSG 49 d17N9 CDR-L2 DSDRPSG 49 17D20m, CDR-L2 DXXRPSG 93 d3521N11, (whereinXatposition2isN 17N16m,d17N9 (Asn),K(Lys)orS(Ser); consensus andwhereinXatposition3 isK(Lys),Q(Gin)orD (Asp)) d17N9 CDR-L2(aa50-63) DSDRPSGIPDRFSA 50 17D20m CDR-L3 AWDSSTAVF 51 d3521N11 CDR-L3 AWDSSTAVF 51 d3521N11 CDR-L3(aa89-104) AWDSSTAVFGGGTKLT 52 17N16m CDR-L3 VWDTTTDHV 53 d17N9 CDR-L3 VWDIATDHV 54 17N16mand CDR-L3 VWDXXTDHV 94 d17N9consensus (whereinXatposition4isT (Thr)orI(Ile);andwherein Xatposition5isT(Thr)or A(Ala))
(221) In one aspect, the invention provides an isolated human monoclonal antibody, or antigen binding fragment thereof, that binds to human MASP-2, comprising:
(222) (i) a heavy chain variable region comprising CDR-H1, CDR-H2 and CDR-H3 sequences; and (ii) a light chain variable region comprising CDR-L1, CDR-L2 and CDR-L3, wherein the heavy chain variable region CDR-H3 sequence comprises an amino acid sequence set forth as SEQ ID NO:38 or SEQ ID NO:90, and conservative sequence modifications thereof, wherein the light chain variable region CDR-L3 sequence comprises an amino acid sequence set forth as SEQ ID NO:51 or SEQ ID NO:94, and conservative sequence modifications thereof, and wherein the isolated antibody inhibits MASP-2 dependent complement activation.
(223) In one embodiment, the heavy chain variable region CDR-H2 sequence comprises an amino acid sequence set forth as SEQ ID NO:32 or 33, and conservative sequence modifications thereof. In one embodiment, the heavy chain variable region CDR-H1 sequence comprises an amino acid sequence set forth as SEQ ID NO:28 or SEQ ID NO:29, and conservative modifications thereof. In one embodiment, the light chain variable region CDR-L2 sequence comprises an amino acid sequence set forth as SEQ ID NO:93 and conservative modifications thereof. In one embodiment, the light chain variable region CDR-L1 sequence comprises an amino acid sequence set forth as SEQ ID NO:91 or SEQ ID NO:92 and conservative modifications thereof. In one embodiment, the CDR-H1 of the heavy chain variable region comprises SEQ ID NO:28.
(224) In one embodiment, the CDR-H2 of the heavy chain variable region comprises SEQ ID NO:32. In one embodiment, the CDR-H3 of the heavy chain variable region comprises SEQ ID NO:90, (as shown in TABLE 4). In one embodiment, the amino acid sequence set forth in SEQ ID NO:90 contains an R (Arg) at position 8.
(225) In one embodiment, the CDR-L1 of the light chain variable region comprises SEQ ID NO:91 (as shown in TABLE 6). In one embodiment, the amino acid set forth in SEQ ID NO:91 contains an E (Glu) at position 2. In one embodiment, the amino acid sequence set forth in SEQ ID NO:91 contains a Y (Tyr) at position 8.
(226) In one embodiment, the CDR-L2 of the light chain variable region comprises SEQ ID NO: 93 (as shown in TABLE 6), and wherein the amino acid sequence set forth in SEQ ID NO:93 contains a K (Lys) at position 2. In one embodiment, the amino acid sequence set forth in SEQ ID NO:93 contains a Q (Gln) at position 3.
(227) In one embodiment, the CDR-L3 of the light chain variable region comprises SEQ ID NO:51.
(228) In one embodiment, said antibody or antigen binding fragment thereof binds human MASP-2 with a K.sub.D of 10 nM or less. In one embodiment, said antibody or antigen binding fragment thereof inhibits C4 activation in an in vitro assay in 1% human serum at an IC.sub.50 of 10 nM or less. In one embodiment, said antibody or antigen binding fragment thereof inhibits C4 activation in 90% human serum with an IC.sub.50 of 30 nM or less. In one embodiment, the conservative sequence modifications thereof comprise or consist of a molecule which contains variable regions that are identical to the recited variable domain(s), except for a combined total of 1, 2, 3, 4, 5, 6, 7, 8 9 or 10 amino acid substitutions within the CDR regions of the heavy chain variable region, and/or up to a combined total of 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid substitutions with said CDR regions of the light chain variable region.
(229) In another aspect, the invention provides an isolated human antibody, or antigen binding fragment thereof, that binds to human MASP-2 wherein the antibody comprises: I) a) a heavy chain variable region comprising: i) a heavy chain CDR-H1 comprising the amino acid sequence from 31-35 of SEQ ID NO:21; and ii) a heavy chain CDR-H2 comprising the amino acid sequence from 50-65 of SEQ ID NO:21; and iii) a heavy chain CDR-H3 comprising the amino acid sequence from 95-102 of SEQ ID NO:21; and b) a light chain variable region comprising: i) a light chain CDR-L1 comprising the amino acid sequence from 24-34 of either SEQ ID NO:25 or SEQ ID NO:27; and ii) a light chain CDR-L2 comprising the amino acid sequence from 50-56 of either SEQ ID NO:25 or SEQ ID NO:27; and iii) a light chain CDR-L3 comprising the amino acid sequence from 89-97 of either SEQ ID NO:25 or SEQ ID NO:27; or II) a variant thereof that is otherwise identical to said variable domains, except for up to a combined total of 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid substitutions within said CDR regions of said heavy chain variable region and up to a combined total of 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid substitutions within said CDR regions of said light chain variable region, wherein the antibody or variant thereof inhibits MASP-2 dependent complement activation. In one embodiment, said variant comprises an amino acid substitution at one or more positions selected from the group consisting of position 31, 32, 33, 34, 35, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 95, 96, 97, 98, 99, 100 or 102 of said heavy chain variable region. In one embodiment, said variant comprises an amino acid substitution at one or more positions selected from the group consisting of position 25, 26, 27, 29, 31, 32, 33, 51, 52, 89, 92, 93, 95, 96 or 97 of said light chain variable region. In one embodiment, the heavy chain of said antibody comprises SEQ ID NO:21. In one embodiment, the light chain of said antibody comprises SEQ ID NO:25. In one embodiment, the light chain of said antibody comprises SEQ ID NO:27.
(230) In another aspect, the invention provides an isolated human monoclonal antibody that binds to human MASP-2, wherein the antibody comprises: I) a) a heavy chain variable region comprising: i) a heavy chain CDR-H1 comprising the amino acid sequence from 31-35 of SEQ ID NO:20; and ii) a heavy chain CDRH-2 comprising the amino acid sequence from 50-65 of SEQ ID NO:20; and iii) a heavy chain CDR-H3 comprising the amino acid sequence from 95-102 of either SEQ ID NO:18 or SEQ ID NO:20; and b) a light chain variable region comprising: i) a light chain CDR-L1 comprising the amino acid sequence from 24-34 of either SEQ ID NO:22 or SEQ ID NO:24; and ii) a light chain CDR-L2 comprising the amino acid sequence from 50-56 of either SEQ ID NO:22 or SEQ ID NO:24; and iii) a light chain CDR-L3 comprising the amino acid sequence from 89-97 of either SEQ ID NO:22 or SEQ ID NO:24; or II) a variant thereof that is otherwise identical to said variable domains, except for up to a combined total of 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid substitutions within said CDR regions of said heavy chain variable region and up to a combined total of 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid substitutions within said CDR regions of said light chain variable region, wherein the antibody or variant thereof inhibits MASP-2 dependent complement activation. In one embodiment, said variant comprises an amino acid substitution at one or more positions selected from the group consisting of position 31, 32, 33, 34, 35, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 95, 96, 97, 98, 99, 100 or 102 of said heavy chain variable region. In one embodiment, said variant comprises an amino acid substitution at one or more positions selected from the group consisting of position 25, 26, 27, 29, 31, 32, 33, 51, 52, 89, 92, 93, 95, 96 or 97 of said light chain variable region. In one embodiment, the heavy chain of said antibody comprises SEQ ID NO:20, or a variant thereof comprising at least 80% identity to SEQ ID NO:20 (e.g., at least 85%, at least 90%, at least 95% or at least 98% identity to SEQ ID NO:20). In one embodiment, the heavy chain of said antibody comprises SEQ ID NO:18, or a variant thereof comprising at least 80% identity to SEQ ID NO:18 (e.g., at least 85%, at least 90%, at least 95% or at least 98% identity to SEQ ID NO:18). In one embodiment, the light chain of said antibody comprises SEQ ID NO:22, or a variant thereof comprising at least 80% identity to SEQ ID NO:22 (e.g., at least 85%, at least 90%, at least 95% or at least 98% identity to SEQ ID NO:22). In one embodiment, the light chain of said antibody comprises SEQ ID NO:24, or a variant thereof comprising at least 80% identity to SEQ ID NO:24 (e.g., at least 85%, at least 90%, at least 95% or at least 98% identity to SEQ ID NO:24).
(231) In one embodiment, said antibody binds to an epitope in the CCP1 domain of MASP-2.
(232) In one embodiment, said antibody binds human MASP-2 with a K.sub.D of 10 nM or less. In one embodiment, said antibody inhibits C3b deposition in an in vitro assay in 1% human serum at an IC.sub.50 of 10 nM or less. In one embodiment, said antibody inhibits C3b deposition in 90% human serum with an IC.sub.50 of 30 nM or less.
(233) In one embodiment, said antibody is an antibody fragment selected from the group consisting of Fv, Fab, Fab, F(ab).sub.2 and F(ab).sub.2. In one embodiment, said antibody is a single chain molecule. In one embodiment, said antibody is an IgG2 molecule. In one embodiment, said antibody is an IgG1 molecule. In one embodiment, said antibody is an IgG4 molecule. In one embodiment, said IgG4 molecule comprises a S228P mutation.
(234) In one embodiment, said antibody does not substantially inhibit the classical pathway (i.e., the classical pathway activity is at least 80%, or at least 90% or at least 95%, or at least 95% intact).
(235) In another aspect, the invention provides an isolated fully human monoclonal antibody or antigen-binding fragment thereof that dissociates from human MASP-2 with a K.sub.D of 10 nM or less as determined by surface plasmon resonance and inhibits C4 activation on a mannan-coated substrate with an IC.sub.50 of 10 nM or less in 1% serum. In some embodiments, said antibody or antigen binding fragment thereof specifically recognizes at least part of an epitope recognized by a reference antibody comprising a heavy chain variable region as set forth in SEQ ID NO:20 and a light chain variable region as set forth in SEQ ID NO:24, such as reference antibody OMS646 (see TABLE 22). In accordance with the foregoing, an antibody or antigen-binding fragment thereof according to certain preferred embodiments of the present application may be one that competes for binding to human MASP-2 with any antibody described herein which both (i) specifically binds to the antigen and (ii) comprises a VH and/or VL domain disclosed herein, or comprises a CDR-H3 disclosed herein, or a variant of any of these. Competition between binding members may be assayed easily in vitro, for example using ELISA and/or by tagging a specific reporter molecule to one binding member which can be detected in the presence of other untagged binding member(s), to enable identification of specific binding members which bind the same epitope or an overlapping epitope. Thus, there is presently provided a specific antibody or antigen-binding fragment thereof, comprising a human antibody antigen-binding site which competes with an antibody described herein that binds to human MASP-2, such as any one of OMS641 to OMS646 as set forth in TABLE 24, for binding to human MASP-2.
(236) Variant MASP-2 Inhibitory Antibodies
(237) The above-described human monoclonal antibodies may be modified to provide variant antibodies that inhibit MASP-2 dependent complement activation. The variant antibodies may be made by substituting, adding, or deleting at least one amino acid of an above-described human monoclonal antibody. In general, these variant antibodies have the general characteristics of the above-described human antibodies and contain at least the CDRs of an above-described human antibody, or, in certain embodiments, CDRs that are very similar to the CDRs of an above-described human antibody.
(238) In the preferred embodiment, the variant comprises one or more amino acid substitution(s) in one or more hypervariable region(s) of the parent antibody. For example, the variant may comprise at least one, e.g., from about one to about ten, such as at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9 or at least 10 substitutions, and preferably from about two to about six, substitutions in one or more CDR regions of the parent antibody. In one embodiment, said variant comprises an amino acid substitution at one or more positions selected from the group consisting of position 31, 32, 33, 34, 35, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 95, 96, 97, 98, 99, 100 or 102 of said heavy chain variable region. In one embodiment, said variant comprises an amino acid substitution at one or more positions selected from the group consisting of position 25, 26, 27, 29, 31, 32, 33, 51, 52, 89, 92, 93, 95, 96 or 97 of said light chain variable region.
(239) In some embodiments, the variant antibodies have an amino acid sequence that is otherwise identical to the variable domain of a subject antibody set forth in TABLE 2, except for up to a combined total of 1, 2, 3, 4, 5 or 6 amino acid substitutions within said CDR regions of said heavy chain variable region and/or up to a combined total of 1, 2, 3, 4, 5 or 6 amino acid substitutions within said CDR regions of said light chain variable region, wherein the antibody or variant thereof inhibits MASP-2 dependent complement activation.
(240) Ordinarily, the variant will have an amino acid sequence having at least 75% amino acid sequence identity with the parent antibody heavy or light chain variable domain sequences, more preferably at least 80%, more preferably at least 85%, more preferably at least 90%, and most preferably at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% identity. Identity or homology with respect to this sequence is defined herein as the percentage of amino acid residues in the candidate sequence that are identical with the parent antibody residues, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. None of N-terminal, C-terminal, or internal extensions, deletions, or insertions into the antibody sequence (such as, for example, signal peptide sequences, linker sequences, or tags, such as HIS tags) shall be construed as affecting sequence identity or homology. The variant retains the ability to bind human MASP-2 and preferably has properties which are superior to those of the parent antibody. For example, the variant may have a stronger binding affinity and/or an enhanced ability to inhibit or block MASP-2 dependent complement activation.
(241) To analyze such properties, one should compare a Fab form of the variant to a Fab form of the parent antibody or a full length form of the variant to a full length form of the parent antibody, for example, since it has been found that the format of the anti-MASP-2 antibody impacts its activity in the biological activity assays disclosed herein. The variant antibody of particular interest herein is one which displays at least about 10-fold, preferably at least about 20-fold, and most preferably at least about 50-fold, enhancement in biological activity when compared to the parent antibody.
(242) The antibodies of the invention may be modified to enhance desirable properties, such as it may be desirable to control serum half-life of the antibody. In general, complete antibody molecules have a very long serum persistence, whereas fragments (<60-80 kDa) are filtered very rapidly through the kidney. Hence, if long-term action of the MASP-2 antibody is desirable, the MASP-2 antibody is preferably a complete full length IgG antibody (such as IgG2 or IgG4), whereas if shorter action of the MASP-2 antibody is desirable, an antibody fragment may be preferred. As described in Example 5, it has been determined that an S228P substitution in the hinge region of IgG4 increases serum stability. Accordingly, in some embodiments, the subject MASP-2 antibody is a full length IgG4 antibody with an S228P substitution.
(243) Single Chain Antibodies
(244) In one embodiment of the present invention, the MASP-2 inhibitory antibody is a single chain antibody, defined as a genetically engineered molecule containing the variable region of the light chain, the variable region of the heavy chain, linked by a suitable polypeptide linker as a genetically fused single chain molecule. Such single chain antibodies are also referred to as single-chain Fv or scFv antibody fragments. Generally, the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains that enables the scFv to form the desired structure for antigen binding. The scFv antibodies that bind MASP-2 can be oriented with the variable light region either amino terminal to the variable heavy region or carboxyl terminal to it. Exemplary scFv antibodies of the invention are set forth herein as SEQ ID NOS: 55-61 and SEQ ID NOS: 66-68.
(245) Methods for Producing Antibodies
(246) In many embodiments, the nucleic acids encoding a subject monoclonal antibody are introduced directly into a host cell, and the cell incubated under conditions sufficient to induce expression of the encoded antibody.
(247) In some embodiments, the invention provides a nucleic acid molecule encoding an anti-MASP-2 antibody, or fragment thereof, of the invention, such as an antibody or fragment thereof set forth in TABLE 2. In some embodiments the invention provides a nucleic acid molecule comprising a nucleic acid sequence selected from the group consisting of SEQ ID NO:19, SEQ ID NO:23, SEQ ID NO:26, SEQ ID NO:71, SEQ ID NO:73, SEQ ID NO:75, SEQ ID NO:77, SEQ ID NO:79, SEQ ID NO:81, SEQ ID NO:83, SEQ ID NO:85, SEQ ID NO:97, SEQ ID NO:88 and SEQ ID NO:89.
(248) In some embodiments, the invention provides a cell comprising a nucleic acid molecule encoding an anti-MASP-2 antibody of the invention.
(249) In some embodiments, the invention provides an expression cassette comprising a nucleic acid molecule encoding an anti-MASP-2 antibody of the invention.
(250) In some embodiments, the invention provides a method of producing anti-MASP-2 antibodies comprising culturing a cell comprising a nucleic acid molecule encoding an anti-MASP-2 antibody of the invention.
(251) According to certain related embodiments there is provided a recombinant host cell which comprises one or more constructs as described herein; a nucleic acid encoding any antibody, CDR, VH or VL domain, or antigen-binding fragment thereof; and a method of production of the encoded product, which method comprises expression from encoding nucleic acid therefor. Expression may conveniently be achieved by culturing under appropriate conditions recombinant host cells containing the nucleic acid. Following production by expression, an antibody or antigen-binding fragment thereof, may be isolated and/or purified using any suitable technique, and then used as desired.
(252) For example, any cell suitable for expression of expression cassettes may be used as a host cell, for example, yeast, insect, plant, etc., cells. In many embodiments, a mammalian host cell line that does not ordinarily produce antibodies is used, examples of which are as follows: monkey kidney cells (COS cells), monkey kidney CVI cells transformed by SV40 (COS-7, ATCC CRL 165 1); human embryonic kidney cells (HEK-293, Graham et al., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary-cells (CHO, Urlaub and Chasin, Proc. Natl. Acad. Sci. (USA) 77:4216, (1980); mouse sertoli cells (TM4, Mather, Biol. Reprod. 23:243-251 (1980)); monkey kidney cells (CVI ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL 51); TRI cells (Mather et al., Annals N.Y. Acad. Sci 383:44-68 (1982)); NIH/3T3 cells (ATCC CRL-1658); and mouse L cells (ATCC CCL-1). Additional cell lines will become apparent to those of ordinary skill in the art. A wide variety of cell lines are available from the American Type Culture Collection, 10801 University Boulevard, Manassas, Va. 20110-2209.
(253) Methods of introducing nucleic acids into cells are well known in the art. Suitable methods include electroporation, particle gun technology, calcium phosphate precipitation, direct microinjection, and the like. The choice of method is generally dependent on the type of cell being transformed and the circumstances under which the transformation is taking place (i.e., in vitro, ex vivo, or in vivo). A general discussion of these methods can be found in Ausubel, et al., Short Protocols in Molecular Biology, 3d ed., Wiley & Sons, 1995. In some embodiments, lipofectamine and calcium mediated gene transfer technologies are used.
(254) After the subject nucleic acids have been introduced into a cell, the cell is typically incubated, normally at 37? C., sometimes under selection, for a suitable time to allow for the expression of the antibody. In most embodiments, the antibody is typically secreted into the supernatant of the media in which the cell is growing in.
(255) In mammalian host cells, a number of viral-based expression systems may be utilized to express a subject antibody. In cases where an adenovirus is used as an expression vector, the antibody coding sequence of interest may be ligated to an adenovirus transcription/translation control complex, e.g., the late promoter and tripartite leader sequence. This chimeric gene may then be inserted in the adenovirus genome by in vitro or in vivo recombination. Insertion in a non-essential region of the viral genome (e.g., region E1 or E3) will result in a recombinant virus that is viable and capable of expressing the antibody molecule in infected hosts. (e.g., see Logan & Shenk, Proc. Natl. Acad. Sci. USA 81:355-359 (1984)). The efficiency of expression may be enhanced by the inclusion of appropriate transcription enhancer elements, transcription terminators, etc. (see Bittner et al., Methods in Enzymol. 153:51-544 (1987)).
(256) For long-term, high-yield production of recombinant antibodies, stable expression may be used. For example, cell lines, which stably express the antibody molecule, may be engineered. Rather than using expression vectors which contain viral origins of replication, host cells can be transformed with immunoglobulin expression cassettes and a selectable marker. Following the introduction of the foreign DNA, engineered cells may be allowed to grow for 1-2 days in an enriched media, and then are switched to a selective media. The selectable marker in the recombinant plasmid confers resistance to the selection and allows cells to stably integrate the plasmid into a chromosome and grow to form foci which in turn can be cloned and expanded into cell lines. Such engineered cell lines may be particularly useful in screening and evaluation of compounds that interact directly or indirectly with the antibody molecule.
(257) Once an antibody molecule of the invention has been produced, it may be purified by any method known in the art for purification of an immunoglobulin molecule, for example, by chromatography (e.g., ion exchange, affinity, particularly by affinity for the specific antigen after Protein A, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins. In many embodiments, antibodies are secreted from the cell into culture medium and harvested from the culture medium. For example, a nucleic acid sequence encoding a signal peptide may be included adjacent the coding region of the antibody or fragment, for example as provided in nucleotides 1-57 of SEQ ID NO:71, encoding the signal peptide as provided in amino acids 1-19 of SEQ ID NO:72. Such a signal peptide may be incorporated adjacent to the 5 end of the amino acid sequences set forth herein for the subject antibodies in order to facilitate production of the subject antibodies.
(258) Pharmaceutical Carriers and Delivery Vehicles
(259) In another aspect, the invention provides compositions for inhibiting the adverse effects of MASP-2-dependent complement activation comprising a therapeutically effective amount of a human anti-MASP-2 inhibitory antibody and a pharmaceutically acceptable carrier.
(260) In general, the human MASP-2 inhibitory antibody compositions of the present invention, combined with any other selected therapeutic agents, are suitably contained in a pharmaceutically acceptable carrier. The carrier is non-toxic, biocompatible and is selected so as not to detrimentally affect the biological activity of the MASP-2 inhibitory antibody (and any other therapeutic agents combined therewith). Exemplary pharmaceutically acceptable carriers for polypeptides are described in U.S. Pat. No. 5,211,657 to Yamada. The anti-MASP-2 antibodies may be formulated into preparations in solid, semi-solid, gel, liquid or gaseous forms such as tablets, capsules, powders, granules, ointments, solutions, depositories, inhalants and injections allowing for oral, parenteral or surgical administration. The invention also contemplates local administration of the compositions by coating medical devices and the like.
(261) Suitable carriers for parenteral delivery via injectable, infusion or irrigation and topical delivery include distilled water, physiological phosphate-buffered saline, normal or lactated Ringer's solutions, dextrose solution, Hank's solution, or propanediol. In addition, sterile, fixed oils may be employed as a solvent or suspending medium. For this purpose, any biocompatible oil may be employed including synthetic mono- or diglycerides. In addition, fatty acids such as oleic acid find use in the preparation of injectables. The carrier and agent may be compounded as a liquid, suspension, polymerizable or non-polymerizable gel, paste or salve.
(262) The carrier may also comprise a delivery vehicle to sustain (i.e., extend, delay or regulate) the delivery of the agent(s) or to enhance the delivery, uptake, stability or pharmacokinetics of the therapeutic agent(s). Such a delivery vehicle may include, by way of non-limiting example, microparticles, microspheres, nanospheres or nanoparticles composed of proteins, liposomes, carbohydrates, synthetic organic compounds, inorganic compounds, polymeric or copolymeric hydrogels and polymeric micelles. Suitable hydrogel and micelle delivery systems include the PEO:PHB:PEO copolymers and copolymer/cyclodextrin complexes disclosed in WO 2004/009664 A2 and the PEO and PEO/cyclodextrin complexes disclosed in U.S. Patent Application Publication No. 2002/0019369 A1. Such hydrogels may be injected locally at the site of intended action, or subcutaneously or intramuscularly to form a sustained release depot.
(263) For intra-articular delivery, the MASP-2 inhibitory antibody may be carried in above-described liquid or gel carriers that are injectable, above-described sustained-release delivery vehicles that are injectable, or a hyaluronic acid or hyaluronic acid derivative.
(264) For intrathecal (IT) or intracerebroventricular (ICV) delivery, appropriately sterile delivery systems (e.g., liquids; gels, suspensions, etc.) can be used to administer the present invention.
(265) The compositions of the present invention may also include biocompatible excipients, such as dispersing or wetting agents, suspending agents, diluents, buffers, penetration enhancers, emulsifiers, binders, thickeners, flavoring agents (for oral administration).
(266) To achieve high concentrations of anti-MASP-2 antibodies for local delivery, the antibodies may be formulated as a suspension of particulates or crystals in solution for subsequent injection, such as for intramuscular injection of a depot.
(267) More specifically with respect to anti-MASP-2 antibodies, exemplary formulations can be parenterally administered as injectable dosages of a solution or suspension of the compound in a physiologically acceptable diluent with a pharmaceutical carrier that can be a sterile liquid such as water, oils, saline, glycerol or ethanol. Additionally, auxiliary substances such as wetting or emulsifying agents, surfactants, pH buffering substances and the like can be present in compositions comprising anti-MASP-2 antibodies. Additional components of pharmaceutical compositions include petroleum (such as of animal, vegetable or synthetic origin), for example, soybean oil and mineral oil. In general, glycols such as propylene glycol or polyethylene glycol are preferred liquid carriers for injectable solutions.
(268) The anti-MASP-2 antibodies can also be administered in the form of a depot injection or implant preparation that can be formulated in such a manner as to permit a sustained or pulsatile release of the active agents.
(269) The pharmaceutical compositions comprising MASP-2 inhibitory antibodies may be administered in a number of ways depending on whether a local or systemic mode of administration is most appropriate for the condition being treated. Additionally, as described herein above with respect to extracorporeal reperfusion procedures, MASP-2 inhibitory antibodies can be administered via introduction of the compositions of the present invention to recirculating blood or plasma. Further, the compositions of the present invention can be delivered by coating or incorporating the compositions on or into an implantable medical device.
(270) Systemic Delivery
(271) As used herein, the terms systemic delivery and systemic administration are intended to include but are not limited to oral and parenteral routes including intramuscular (IM), subcutaneous, intravenous (IV), intra-arterial, inhalational, sublingual, buccal, topical, transdermal, nasal, rectal, vaginal and other routes of administration that effectively result in dispersal of the delivered antibody to a single or multiple sites of intended therapeutic action. Preferred routes of systemic delivery for the present compositions include intravenous, intramuscular, subcutaneous and inhalational. It will be appreciated that the exact systemic administration route for selected agents utilized in particular compositions of the present invention will be determined in part to account for the agent's susceptibility to metabolic transformation pathways associated with a given route of administration.
(272) MASP-2 inhibitory antibodies and polypeptides can be delivered into a subject in need thereof by any suitable means. Methods of delivery of MASP-2 antibodies and polypeptides include administration by oral, pulmonary, parenteral (e.g., intramuscular, intraperitoneal, intravenous (IV) or subcutaneous injection), inhalation (such as via a fine powder formulation), transdermal, nasal, vaginal, rectal, or sublingual routes of administration, and can be formulated in dosage forms appropriate for each route of administration.
(273) By way of representative example, MASP-2 inhibitory antibodies and peptides can be introduced into a living body by application to a bodily membrane capable of absorbing the polypeptides, for example the nasal, gastrointestinal and rectal membranes. The polypeptides are typically applied to the absorptive membrane in conjunction with a permeation enhancer. (See, e.g., Lee, V. H. L., Crit. Rev. Ther. Drug Carrier Sys. 5:69, 1988; Lee, V. H. L., J. Controlled Release 13:213, 1990; Lee, V. H. L., Ed., Peptide and Protein Drug Delivery, Marcel Dekker, New York (1991); DeBoer, A. G., et al., J. Controlled Release 13:241, 1990.) For example, STDHF is a synthetic derivative of fusidic acid, a steroidal surfactant that is similar in structure to the bile salts, and has been used as a permeation enhancer for nasal delivery. (Lee, W. A., Biopharm. 22, November/December 1990.)
(274) The MASP-2 inhibitory antibodies and polypeptides may be introduced in association with another molecule, such as a lipid, to protect the polypeptides from enzymatic degradation. For example, the covalent attachment of polymers, especially polyethylene glycol (PEG), has been used to protect certain proteins from enzymatic hydrolysis in the body and thus prolong half-life (Fuertges, F., et al., J. Controlled Release 11:139, 1990). Many polymer systems have been reported for protein delivery (Bae, Y. H., et al., J. Controlled Release 9:271, 1989; Hori, R., et al., Pharm. Res. 6:813, 1989; Yamakawa, I., et al., J. Pharm. Sci. 79:505, 1990; Yoshihiro, I., et al., J. Controlled Release 10:195, 1989; Asano, M., et al., J. Controlled Release 9:111, 1989; Rosenblatt, J., et al., J. Controlled Release 9:195, 1989; Makino, K., J. Controlled Release 12:235, 1990; Takakura, Y., et al., J. Pharm. Sci. 78:117, 1989; Takakura, Y., et al., J. Pharm. Sci. 78:219, 1989).
(275) Recently, liposomes have been developed with improved serum stability and circulation half-times (see, e.g., U.S. Pat. No. 5,741,516, to Webb). Furthermore, various methods of liposome and liposome-like preparations as potential drug carriers have been reviewed (see, e.g., U.S. Pat. No. 5,567,434, to Szoka; U.S. Pat. No. 5,552,157, to Yagi; U.S. Pat. No. 5,565,213, to Nakamori; U.S. Pat. No. 5,738,868, to Shinkarenko; and U.S. Pat. No. 5,795,587, to Gao).
(276) For transdermal applications, the MASP-2 inhibitory antibodies and polypeptides may be combined with other suitable ingredients, such as carriers and/or adjuvants. There are no limitations on the nature of such other ingredients, except that they must be pharmaceutically acceptable for their intended administration, and cannot degrade the activity of the active ingredients of the composition. Examples of suitable vehicles include ointments, creams, gels, or suspensions, with or without purified collagen. The MASP-2 inhibitory antibodies and polypeptides may also be impregnated into transdermal patches, plasters, and bandages, preferably in liquid or semi-liquid form.
(277) The compositions of the present invention may be systemically administered on a periodic basis at intervals determined to maintain a desired level of therapeutic effect. For example, compositions may be administered, such as by subcutaneous injection, every two to four weeks or at less frequent intervals. The dosage regimen will be determined by the physician considering various factors that may influence the action of the combination of agents. These factors will include the extent of progress of the condition being treated, the patient's age, sex and weight, and other clinical factors. The dosage for each individual agent will vary as a function of the MASP-2 inhibitory antibody that is included in the composition, as well as the presence and nature of any drug delivery vehicle (e.g., a sustained release delivery vehicle). In addition, the dosage quantity may be adjusted to account for variation in the frequency of administration and the pharmacokinetic behavior of the delivered agent(s).
(278) Local Delivery
(279) As used herein, the term local encompasses application of a drug in or around a site of intended localized action, and may include for example topical delivery to the skin or other affected tissues, ophthalmic delivery, intrathecal (IT), intracerebroventricular (ICV), intra-articular, intracavity, intracranial or intravesicular administration, placement or irrigation. Local administration may be preferred to enable administration of a lower dose, to avoid systemic side effects, and for more accurate control of the timing of delivery and concentration of the active agents at the site of local delivery. Local administration provides a known concentration at the target site, regardless of interpatient variability in metabolism, blood flow, etc. Improved dosage control is also provided by the direct mode of delivery.
(280) Local delivery of a MASP-2 inhibitory antibody may be achieved in the context of surgical methods for treating a disease or condition, such as for example during procedures such as arterial bypass surgery, atherectomy, laser procedures, ultrasonic procedures, balloon angioplasty and stent placement. For example, a MASP-2 inhibitor can be administered to a subject in conjunction with a balloon angioplasty procedure. A balloon angioplasty procedure involves inserting a catheter having a deflated balloon into an artery. The deflated balloon is positioned in proximity to the atherosclerotic plaque and is inflated such that the plaque is compressed against the vascular wall. As a result, the balloon surface is in contact with the layer of vascular endothelial cells on the surface of the blood vessel. The MASP-2 inhibitory antibody may be attached to the balloon angioplasty catheter in a manner that permits release of the agent at the site of the atherosclerotic plaque. The agent may be attached to the balloon catheter in accordance with standard procedures known in the art. For example, the agent may be stored in a compartment of the balloon catheter until the balloon is inflated, at which point it is released into the local environment. Alternatively, the agent may be impregnated on the balloon surface, such that it contacts the cells of the arterial wall as the balloon is inflated. The agent may also be delivered in a perforated balloon catheter such as those disclosed in Flugelman, M. Y., et al., Circulation 85:1110-1117, 1992. See also published PCT Application WO 95/23161 for an exemplary procedure for attaching a therapeutic protein to a balloon angioplasty catheter. Likewise, the MASP-2 inhibitory antibody may be included in a gel or polymeric coating applied to a stent, or may be incorporated into the material of the stent, such that the stent elutes the MASP-2 inhibitory antibody after vascular placement.
(281) Treatment Regimes
(282) MASP-2 inhibitory antibody compositions used in the treatment of arthritides and other musculoskeletal disorders may be locally delivered by intra-articular injection. Such compositions may suitably include a sustained release delivery vehicle. As a further example of instances in which local delivery may be desired, MASP-2 inhibitory antibody compositions used in the treatment of urogenital conditions may be suitably instilled intravesically or within another urogenital structure.
(283) In prophylactic applications, the pharmaceutical compositions are administered to a subject susceptible to, or otherwise at risk of, a condition associated with MASP-2-dependent complement activation in an amount sufficient to eliminate or reduce the risk of developing symptoms of the condition. In therapeutic applications, the pharmaceutical compositions are administered to a subject suspected of, or already suffering from, a condition associated with MASP-2-dependent complement activation in a therapeutically effective amount sufficient to relieve, or at least partially reduce, the symptoms of the condition. In both prophylactic and therapeutic regimens, compositions comprising MASP-2 inhibitory antibodies may be administered in several dosages until a sufficient therapeutic outcome has been achieved in the subject. Application of the MASP-2 inhibitory antibody compositions of the present invention may be carried out by a single administration of the composition, or a limited sequence of administrations, for treatment of an acute condition, e.g., reperfusion injury or other traumatic injury. Alternatively, the composition may be administered at periodic intervals over an extended period of time for treatment of chronic conditions, e.g., arthritides or psoriasis.
(284) MASP-2 inhibitory compositions used in the present invention may be delivered immediately or soon after an acute event that results in activation of the lectin pathway, such as following an ischemic event and reperfusion of the ischemic tissue. Examples include myocardial ischemia reperfusion, renal ischemia reperfusion, cerebral ischemia reperfusion, organ transplant and digit/extremity reattachment. Other acute examples include sepsis. A MASP-2 inhibitory composition of the present invention may be administered as soon as possible following an acute event that activates the lectin pathway, preferably within twelve hours and more preferably within two to three hours of a triggering event, such as through systemic delivery of the MASP-2 inhibitory composition.
(285) The methods and compositions of the present invention may be used to inhibit inflammation and related processes that typically result from diagnostic and therapeutic medical and surgical procedures. To inhibit such processes, the MASP-2 inhibitory composition of the present invention may be applied periprocedurally. As used herein periprocedurally refers to administration of the inhibitory composition preprocedurally and/or intraprocedurally and/or postprocedurally, i.e., before the procedure, before and during the procedure, before and after the procedure, before, during and after the procedure, during the procedure, during and after the procedure, or after the procedure. Periprocedural application may be carried out by local administration of the composition to the surgical or procedural site, such as by injection or continuous or intermittent irrigation of the site or by systemic administration. Suitable methods for local perioperative delivery of MASP-2 inhibitory antibody solutions are disclosed in U.S. Pat. No. 6,420,432 to Demopulos and U.S. Pat. No. 6,645,168 to Demopulos. Suitable methods for local delivery of chondroprotective compositions including MASP-2 inhibitory antibodies are disclosed in International PCT Patent Application WO 01/07067 A2. Suitable methods and compositions for targeted systemic delivery of chondroprotective compositions including MASP-2 inhibitory antibodies are disclosed in International PCT Patent Application WO 03/063799 A2.
(286) Dosages
(287) The MASP-2 inhibitory antibodies can be administered to a subject in need thereof, at therapeutically effective doses to treat or ameliorate conditions associated with MASP-2-dependent complement activation. A therapeutically effective dose refers to the amount of the MASP-2 inhibitory antibody sufficient to result in amelioration of symptoms of the condition.
(288) Toxicity and therapeutic efficacy of MASP-2 inhibitory antibodies can be determined by standard pharmaceutical procedures employing experimental animal models, such as the African Green Monkey, as described herein. Using such animal models, the NOAEL (no observed adverse effect level) and the MED (the minimally effective dose) can be determined using standard methods. The dose ratio between NOAEL and MED effects is the therapeutic ratio, which is expressed as the ratio NOAEL/MED MASP-2 inhibitory antibodies that exhibit large therapeutic ratios or indices are most preferred. The data obtained from the cell culture assays and animal studies can be used in formulating a range of dosages for use in humans. The dosage of the MASP-2 inhibitory antibody preferably lies within a range of circulating concentrations that include the MED with little or no toxicity. The dosage may vary within this range depending upon the dosage form employed and the route of administration utilized.
(289) For any compound formulation, the therapeutically effective dose can be estimated using animal models. For example, a dose may be formulated in an animal model to achieve a circulating plasma concentration range that includes the MED. Quantitative levels of the MASP-2 inhibitory antibody in plasma may also be measured, for example, by high performance liquid chromatography.
(290) In addition to toxicity studies, effective dosage may also be estimated based on the amount of MASP-2 protein present in a living subject and the binding affinity of the MASP-2 inhibitory antibody. It has been shown that MASP-2 levels in normal human subjects is present in serum in low levels in the range of 500 ng/ml, and MASP-2 levels in a particular subject can be determined using a quantitative assay for MASP-2 described in Moller-Kristensen M., et al., J. Immunol. Methods 282:159-167, 2003, hereby incorporated herein by reference.
(291) Generally, the dosage of administered compositions comprising MASP-2 inhibitory antibodies varies depending on such factors as the subject's age, weight, height, sex, general medical condition, and previous medical history. As an illustration, MASP-2 inhibitory antibodies, can be administered in dosage ranges from about 0.010 to 10.0 mg/kg, preferably 0.010 to 1.0 mg/kg, more preferably 0.010 to 0.1 mg/kg of the subject body weight.
(292) Therapeutic efficacy of MASP-2 inhibitory compositions and methods of the present invention in a given subject, and appropriate dosages, can be determined in accordance with complement assays well known to those of skill in the art. Complement generates numerous specific products. During the last decade, sensitive and specific assays have been developed and are available commercially for most of these activation products, including the small activation fragments C3a, C4a, and C5a and the large activation fragments iC3b, C4d, Bb, and sC5b-9. Most of these assays utilize antibodies that react with new antigens (neoantigens) exposed on the fragment, but not on the native proteins from which they are formed, making these assays very simple and specific. Most rely on ELISA technology, although radioimmunoassay is still sometimes used for C3a and C5a. These latter assays measure both the unprocessed fragments and their desArg fragments, which are the major forms found in the circulation. Unprocessed fragments and C5a.sub.desArg are rapidly cleared by binding to cell surface receptors and are hence present in very low concentrations, whereas C3a.sub.desArg does not bind to cells and accumulates in plasma. Measurement of C3a provides a sensitive, pathway-independent indicator of complement activation. Alternative pathway activation can be assessed by measuring the Bb fragment. Detection of the fluid-phase product of membrane attack pathway activation, sC5b-9, provides evidence that complement is being activated to completion. Because both the lectin and classical pathways generate the same activation products, C4a and C4d, measurement of these two fragments does not provide any information about which of these two pathways has generated the activation products.
(293) The inhibition of MASP-2-dependent complement activation is characterized by at least one of the following changes in a component of the complement system that occurs as a result of administration of an anti-MASP-2 antibody in accordance with the present invention: the inhibition of the generation or production of MASP-2-dependent complement activation system products C4b, C3a, C5a and/or C5b-9 (MAC), the reduction of C4 cleavage and C4b deposition, or the reduction of C3 cleavage and C3b deposition.
(294) Articles of Manufacture
(295) In another aspect, the present invention provides an article of manufacture containing a human MASP-2 inhibitory antibody, or antigen binding fragment thereof, as described herein in a unit dosage form suitable for therapeutic administration to a human subject, such as, for example, a unit dosage in the range of 1 mg to 5000 mg, such as from 1 mg to 2000 mg, such as from 1 mg to 1000 mg, such as 5 mg, 10 mg, 50 mg, 100 mg, 200 mg, 500 mg, or 1000 mg. In some embodiments, the article of manufacture comprises a container and a label or package insert on or associated with the container. Suitable containers include, for example, bottles, vials, syringes, etc. The containers may be formed from a variety of materials such as glass or plastic. The container holds a composition which is effective for treating the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). At least one active agent in the composition is the MASP-2 inhibitory antibody or antigen binding fragment thereof of the invention. The label or package insert indicates that the composition is used for treating the particular condition. The label or package insert will further comprise instructions for administering the antibody composition to the patient. Articles of manufacture and kits comprising combinatorial therapies described herein are also contemplated.
(296) Therapeutic Uses of the Anti-MASP-2 Inhibitory Antibodies
(297) In another aspect, the invention provides a method of inhibiting MASP-2 dependent complement activation in a human subject comprising administering a human monoclonal anti-MASP-2 inhibitory antibody of the invention in an amount sufficient to inhibit MASP-2 dependent complement activation in said human subject.
(298) In accordance with this aspect of the invention, as described in Example 10, the MASP-2 inhibitory antibodies of the present invention are capable of inhibiting the lectin pathway in African Green Monkeys following intravenous administration. As shown in Table 24, Example 8, the antibody used in this study, OMS646, was found to be more potent in human serum. As known by those of skill in the art, non-human primates are often used as a model for evaluating antibody therapeutics.
(299) As described in U.S. Pat. No. 7,919,094, co-pending U.S. patent application Ser. No. 13/083,441, and co-pending U.S. patent application Ser. No. 12/905,972 (each of which is assigned to Omeros Corporation, the assignee of the instant application), each of which is hereby incorporated by reference, MASP-2 dependent complement activation has been implicated as contributing to the pathogenesis of numerous acute and chronic disease states, including MASP-2-dependent complement mediated vascular condition, an ischemia reperfusion injury, atherosclerosis, inflammatory gastrointestinal disorder, a pulmonary condition, an extracorporeal reperfusion procedure, a musculoskeletal condition, a renal condition, a skin condition, organ or tissue transplant, nervous system disorder or injury, a blood disorder, a urogenital condition, diabetes, chemotherapy or radiation therapy, malignancy, an endocrine disorder, a coagulation disorder, or an ophthalmologic condition. Therefore, the MASP-2 inhibitory antibodies of the present invention may be used to treat the above-referenced diseases and conditions.
(300) As further described in Example 11, the MASP-2 inhibitory antibodies of the present invention are effective in treating a mammalian subject at risk for, or suffering from the detrimental effects of acute radiation syndrome, thereby demonstrating therapeutic efficacy in vivo.
(301) The following examples merely illustrate the best mode now contemplated for practicing the invention, but should not be construed to limit the invention.
Example 1
(302) This Example describes the recombinant expression and protein production of recombinant full-length human, rat and murine MASP-2, MASP-2 derived polypeptides, and catalytically inactivated mutant forms of MASP-2.
(303) Expression of Full-Length Human and Rat MASP-2:
(304) The full length cDNA sequence of human MASP-2 (SEQ ID NO: 1), encoding the human MASP-2 polypeptide with leader sequence (SEQ ID NO:2) was subcloned into the mammalian expression vector pCI-Neo (Promega), which drives eukaryotic expression under the control of the CMV enhancer/promoter region (described in Kaufman R. J. et al., Nucleic Acids Research 19:4485-90, 1991; Kaufman, Methods in Enzymology, 185:537-66 (1991)). The full length rat MASP-2 cDNA (SEQ ID NO:4), encoding the rat MASP-2 polypeptide with leader sequence (SEQ ID NO:5) was subcloned into the pED expression vector. The MASP-2 expression vectors were then transfected into the adherent Chinese hamster ovary cell line DXB1 using the standard calcium phosphate transfection procedure described in Maniatis et al., 1989. Cells transfected with these constructs grew very slowly, implying that the encoded protease is cytotoxic. The mature form of the human MASP-2 protein (SEQ ID NO:3) and the mature form of the rat MASP-2 protein (SEQ ID NO:6) were secreted into the culture media and isolated as described below.
(305) Expression of Full-Length Catalytically Inactive MASP-2:
(306) Rationale:
(307) MASP-2 is activated by autocatalytic cleavage after the recognition subcomponents MBL, C-type lectin CL-11, or ficolins (either L-ficolin, H-ficolin or M-ficolin), collectively referred to as lectins, bind to their respective carbohydrate pattern. Autocatalytic cleavage resulting in activation of MASP-2 often occurs during the isolation procedure of MASP-2 from serum, or during the purification following recombinant expression. In order to obtain a more stable protein preparation for use as an antigen, a catalytically inactive form of MASP-2, designed as MASP-2A, was created by replacing the serine residue that is present in the catalytic triad of the protease domain with an alanine residue in the mature rat MASP-2 protein (SEQ ID NO:6 Ser617 to Ala617); or in mature human MASP-2 protein (SEQ ID NO:3 Ser618 to Ala618).
(308) In order to generate catalytically inactive human and rat MASP-2A proteins, site-directed mutagenesis was carried out as described in US2007/0172483, hereby incorporated herein by reference. The PCR products were purified after agarose gel electrophoresis and band preparation and single adenosine overlaps were generated using a standard tailing procedure. The adenosine tailed MASP-2A was then cloned into the pGEM-T easy vector, transformed into E. coli. The human and rat MASP-2A were each further subcloned into either of the mammalian expression vectors pED or pCI-Neo and transfected into the Chinese Hamster ovary cell line DXB1 as described below.
(309) Construction of Expression Plasmids Containing Polypeptide Regions Derived from Human Masp-2.
(310) The following constructs were produced using the MASP-2 signal peptide (residues 1-15 of SEQ ID NO:2) to secrete various domains of MASP-2. A construct expressing the human MASP-2 CUBI domain (SEQ ID NO:7) was made by PCR amplifying the region encoding residues 1-121 of MASP-2 (SEQ ID NO:3) (corresponding to the N-terminal CUB1 domain). A construct expressing the human MASP-2 CUBI/EGF domain (SEQ ID NO:8) was made by PCR amplifying the region encoding residues 1-166 of MASP-2 (SEQ ID NO:3) (corresponding to the N-terminal CUB1/EGF domain). A construct expressing the human MASP-2 CUBI/EGF/CUBII domain (SEQ ID NO:9) was made by PCR amplifying the region encoding aa residues 1-277 of MASP-2 (SEQ ID NO:3) (corresponding to the N-terminal CUBIEGFCUBII domain). A construct expressing the human MASP-2 EGF domain (SEQ ID NO:10) was made by PCR amplifying the region encoding aa residues 122-166 of MASP-2 (SEQ ID NO:3) (corresponding to the EGF domain). A construct expressing the human MASP-2 CCPI/CCPII/SP domains (SEQ ID NO:11) was made by PCR amplifying the region encoding aa residues 278-671 of MASP-2 (SEQ ID NO:3) (corresponding to the CCPI/CCPII/SP domains). A construct expressing the human MASP-2 CCPI/CCPII domains (SEQ ID NO:12) was made by PCR amplifying the region encoding aa residues 278-429 of MASP-2 (SEQ ID NO:3) (corresponding to the CCPI/CCPII domains). A construct expressing the CCPI domain of MASP-2 (SEQ ID NO:13) was made by PCR amplifying the region encoding aa residues 278-347 of MASP-2 (SEQ ID NO:3) (corresponding to the CCPI domain). A construct expressing the CCPII/SP domains of MASP-2 (SEQ ID NO:14) was made by PCR amplifying the region encoding aa residues 348-671 of MASP-2 (SEQ ID NO:3) (corresponding to the CCPII/SP domains). A construct expressing the CCPII domain of MASP-2 (SEQ ID NO:15) was made by PCR amplifying the region encoding aa residues 348-429of MASP-2 (SEQ ID NO:3) (corresponding to the CCPII domain). A construct expressing the SP domain of MASP-2 (SEQ ID NO:16) was made by PCR amplifying the region encoding aa residues 429-671 of MASP-2 (SEQ ID NO:3) (corresponding to the SP domain).
(311) The above mentioned MASP-2 domains were amplified by PCR using Vent.sub.R polymerase and pBS-MASP-2 as a template, according to established PCR methods. The 5 primer sequence of the sense primer introduced a BamHI restriction site (underlined) at the 5 end of the PCR products. Antisense primers for each of the MASP-2 domains were designed to introduce a stop codon followed by an EcoRI site at the end of each PCR product. Once amplified, the DNA fragments were digested with BamHI and EcoRI and cloned into the corresponding sites of the pFastBac1 vector. The resulting constructs were characterized by restriction mapping and confirmed by dsDNA sequencing.
(312) Recombinant Eukaryotic Expression of MASP-2 and Protein Production of Enzymatically Inactive Rat and Human MASP-2A.
(313) The MASP-2 and MASP-2A expression constructs described above were transfected into DXB1 cells using the standard calcium phosphate transfection procedure (Maniatis et al., 1989). MASP-2A was produced in serum-free medium to ensure that preparations were not contaminated with other serum proteins. Media was harvested from confluent cells every second day (four times in total). The level of recombinant MASP-2A averaged approximately 1.5 mg/liter of culture medium for each of the two species.
(314) MASP-2A Protein Purification:
(315) The MASP-2A (Ser-Ala mutant described above) was purified by affinity chromatography on MBP-A-agarose columns. This strategy enabled rapid purification without the use of extraneous tags. MASP-2A (100-200 ml of medium diluted with an equal volume of loading buffer (50 mM Tris-Cl, pH 7.5, containing 150 mM NaCl and 25 mM CaCl.sub.2) was loaded onto an MBP-agarose affinity column (4 ml) pre-equilibrated with 10 ml of loading buffer. Following washing with a further 10 ml of loading buffer, protein was eluted in 1 ml fractions with 50 mM Tris-Cl, pH 7.5, containing 1.25 M NaCl and 10 mM EDTA. Fractions containing the MASP-2A were identified by SDS-polyacrylamide gel electrophoresis. Where necessary, MASP-2A was purified further by ion-exchange chromatography on a MonoQ column (HR 5/5). Protein was dialysed with 50 mM Tris-Cl pH 7.5, containing 50 mM NaCl and loaded onto the column equilibrated in the same buffer. Following washing, bound MASP-2A was eluted with a 0.05-1 M NaCl gradient over 10 ml.
(316) Results:
(317) Yields of 0.25-0.5 mg of MASP-2A protein were obtained from 200 ml of medium. The molecular mass of 77.5 kDa determined by MALDI-MS is greater than the calculated value of the unmodified polypeptide (73.5 kDa) due to glycosylation. Attachment of glycans at each of the N-glycosylation sites accounts for the observed mass. MASP-2A migrates as a single band on SDS-polyacrylamide gels, demonstrating that it is not proteolytically processed during biosynthesis. The weight-average molecular mass determined by equilibrium ultracentrifugation is in agreement with the calculated value for homodimers of the glycosylated polypeptide.
Example 2
(318) This Example describes the screening method used to identify high affinity fully human anti-MASP-2 scFv antibody candidates that block MASP-2 functional activity for progression into affinity maturation.
(319) Background and Rationale:
(320) MASP-2 is a complex protein with many separate functional domains, including: binding site(s) for MBL and ficolins, a serine protease catalytic site, a binding site for proteolytic substrate C2, a binding site for proteolytic substrate C4, a MASP-2 cleavage site for autoactivation of MASP-2 zymogen, and two Ca.sup.++ binding sites. scFv antibody fragments were identified that bind with high affinity to MASP-2, and the identified Fab2 fragments were tested in a functional assay to determine if they were able to block MASP-2 functional activity.
(321) To block MASP-2 functional activity, an antibody or scFv or Fab2 antibody fragment must bind and interfere with a structural epitope on MASP-2 that is required for MASP-2 functional activity. Therefore, many or all of the high affinity binding anti-MASP-2 scFvs or Fab2s may not inhibit MASP-2 functional activity unless they bind to structural epitopes on MASP-2 that are directly involved in MASP-2 functional activity.
(322) A functional assay that measures inhibition of lectin pathway C3 convertase formation was used to evaluate the blocking activity of anti-MASP-2 scFvs. It is known that the primary physiological role of MASP-2 in the lectin pathway is to generate the next functional component of the lectin-mediated complement pathway, namely the lectin pathway C3 convertase. The lectin pathway C3 convertase is a critical enzymatic complex (C4b2a) that proteolytically cleaves C3 into C3a and C3b. MASP-2 is not a structural component of the lectin pathway C3 convertase (C4b2a); however, MASP-2 functional activity is required in order to generate the two protein components (C4b, C2a) that comprise the lectin pathway C3 convertase. Furthermore, all of the separate functional activities of MASP-2 listed above appear to be required in order for MASP-2 to generate the lectin pathway C3 convertase. For these reasons, a preferred assay to use in evaluating the blocking activity of anti-MASP-2 Fab2s and scFv antibody fragments is believed to be a functional assay that measures inhibition of lectin pathway C3 convertase formation.
(323) The target profile for therapeutic anti-MASP-2 antibodies predicted to yield >90% lectin pathway ablation in vivo following administration of 1 mg/kg to a human is an IC.sub.50<5 nM in 90% plasma. The relationship between in vitro pharmacological activity in these assay formats and in vivo pharmacodynamics was validated experimentally using anti-rodent MASP-2 antibodies.
(324) The criteria for selection of first generation MASP-2 blocking antibodies for therapeutic use were as follows: high affinity to MASP-2 and functional IC.sub.50 values up to ?25 nM. In addition, candidates were screened for cross-reactivity with non-human primate serum, and with rat serum.
(325) Methods:
(326) Screening of scFv Phagemid Library Against MASP-2 Antigen
(327) Antigens:
(328) Human MASP-2A with an N-terminal 5? His tag, and rat MASP-2A with an N-terminal 6? His tags were generated using the reagents described in Example 1 and purified from culture supernatants by nickel-affinity chromatograph, as previously described (Chen et al., J. Biol. Chem. 276:25894-02 (2001)).
(329) OMS100, a human anti-MASP-2 antibody in Fab2 format, was used as a positive control for binding MASP-2.
(330) Phagemid Library Description:
(331) A phage display library of human immunoglobulin light and heavy chain variable region sequences was subjected to antigen panning followed by automated antibody screening and selection to identify high affinity scFv antibodies to rat MASP-2 protein and human MASP-2 protein.
(332) Panning Methods:
(333) Overview: Two panning strategies were used to isolate phages from the phagemid library that bound to MASP-2 in a total of three rounds of panning. Both strategies involved panning in solution and fishing out phage bound to MASP-2. MASP-2 was immobilized on magnetic beads either via the His-tag (using NiNTA beads) or via a biotin (using Streptavidin beads) on the target.
(334) The first two panning rounds involved alkaline elution (TEA), and the third panning round was first eluted competitively with MBL before a conventional alkaline (TEA) elution step. Negative selection was carried out before rounds 2 and 3, and this was against the functional analogs, C1s and C1r of the classical complement pathway. After panning, specific enrichment of phages with scFv fragments against MASP-2A was monitored, and it was determined that the panning strategy had been successful (data not shown).
(335) The scFv genes from panning round 3 were cloned into a pHOG expression vector, and run in a small-scale filter screening to look for specific clones against MASP-2A, as further described below.
(336) TABLE-US-00019 TABLE 7 Phage Panning Methods (biotin/streptavidin) Panning magnetic Round Antigen (?g) beads block prepanning elution 1 biotin human streptavidin 4% blot nothing TEA (alkaline) MASP-2A (10 ?g) block 2 biotin rat MASP- streptavidin 4% blot C1s/C1r TEA (alkaline) 2A block (10 ?g) 3 biotin human streptavidin 4% blot C1s/C1r Competition MASP-2A block w/MBL, (1 ?g) followed by TEA (alkaline)
(337) TABLE-US-00020 TABLE 8 Phage Panning Methods (HIS/NiNTA) Panning magnetic Round Antigen (?g) beads block prepanning elution 1 human MASP-2A NiNTA 4% milk nothing TEA (alkaline) His tagged (10 ?g) in PBS 2 rat MASP-2A His NiNTA 4% milk C1s/C1r TEA (alkaline) tagged in PBS (10 ?g) 3 biotin human NiNTA 4% milk C1s/C1r Competitively MASP-2A in PBS with MBL + TEA (10 ?g) (alkaline)
(338) Panning Reagents: Human MASP-2A OMS100 antibody (positive control) Goat anti-human IgG (H+L) (Pierce #31412) NiNTA beads (Qiagen #LB13267) Dynabeads? M-280 Streptavidin, 10 mg/ml (LB12321) Normal human serum (LB13294) Polyclonal rabbit anti-human C3c (LB13137) Goat anti-rabbit IgG, HRP (American Qualex #A102PU)
(339) To test the tagged MASP-2A antigen, an experiment was carried out to capture the positive control OMS100 antibody (200 ng/ml) preincubated with biotin-tagged MASP-2A or HIS-tagged MASP-2A antigen (10 ?g), with 50 ?l NiNTA beads in 4% milk PBS or 200 ?l Streptavidin beads, respectively. Bound MASP-2A-OMS100 antibody was detected with Goat-anti-human IgG (H+L) HRP (1:5000) and TMB (3,3,5,5-tetramethylbenzidine) substrate.
(340) NiNTA Beads ELISA Assay
(341) 50 ?l NiNTA beads were blocked with 1 ml 4% milk in phosphate buffered saline (PBS) and incubated on a rotator wheel for 1 hour at room temperature. In parallel, 10 ?g of MASP-2A and OMS100 antibody (diluted to 200 ng/ml in 4% milk-PBS) were pre-incubated for one hour. The beads were then washed three times with 1 ml PBS-T using a magnet between each step. The MASP-2A pre-incubated with OMS100 antibody was added to the washed beads. The mixture was incubated on a rotator wheel for 1 h at RT, then washed three times with 1 ml PBS-T using a magnet as described above. The tubes were incubated for 1 hr at RT with Goat anti-human IgG (H+L) HRP diluted 1:5000 in 4% milk in PBS. For negative controls, Goat-anti-human IgG (H+L) HRP (1:5000) was added to washed and blocked Ni-NTA beads in a separate tube.
(342) The samples were incubated on rotator wheel for 1 hour at room temperature, then washed three times with 1 ml PBS-T and once with 1?PBS using the magnet as described above. 100 ?l TMB substrate was added and incubated for 3 min at room temperature. The tubes were placed in a magnetic rack for 2 min to concentrate the beads, then the TMB solution was transferred to a microtiter plate and the reaction was stopped with 100 ?l 2M H.sub.2SO.sub.4. Absorbance at 450 nm was read in the ELISA reader.
(343) Streptavidin Beads ELISA Assay
(344) This assay was carried out as described above for the NiNTA beads ELISA Assay, but using 200 ?l Streptavidin beads per sample instead, and non-biotinylated antigens.
(345) Results:
(346) The His-tagged and biotin-tagged MASP-2A antigen, preincubated with the positive control OMS100 antibody, were each successfully captured with NiNTA beads, or Streptavidin beads, respectively.
(347) Panning
(348) Three rounds of panning the scFv phage library against HIS-tagged or biotin-tagged MASP-2A was carried out as shown in TABLE 7 or TABLE 8, respectively. The third round of panning was eluted first with MBL, then with TEA (alkaline). To monitor the specific enrichment of phages displaying scFv fragments against the target MASP-2A, a polyclonal phage ELISA against immobilized MASP-2A was carried out as described below.
(349) MASP-2A ELISA on Polyclonal Phage Enriched after Panning
(350) After three rounds of panning the scFv phage library against human MASP-2 as described above, specific enrichment of phages with scFv fragments against the target MASP-2A was monitored by carrying out an ELISA assay on the enriched polyclonal phage populations generated by panning against immobilized MASP-2A as described below.
(351) Methods:
(352) 5 ng/ml MASP-2A was immobilized on maxisorp ELISA plates in PBS overnight at 4? C. The packaged phages from all three panning rounds were diluted 1:3 in 4% Milk-PBS and titrated with 3-fold dilutions. The negative control was M13 helper phage.
(353) The block was 4% Milk in PBS. The plates were washed 3? in 200 ?l PBS-Tween 0.05% (v/v) between every step. The primary antibody was Rabbit ?-fd (M13 coat protein), 1:5000 in 4% Milk-PBS (w/v). The conjugate was Rabbit ?-Goat-HRP at 1:10.000 in 4% Milk-PBS (w/v). The substrate was ABTS. All volumes, except washes and blocking, were 100 ?l/well. All incubations were for 1 hour with shaking at room temperature.
(354) Results:
(355) The results of the phage ELISA showed a specific enrichment of scFv's against MASP-2A for both panning strategies. See
(356) Filter Screening:
(357) Bacterial colonies containing plasmids encoding scFv fragments from the third round of panning were picked, gridded onto nitrocellulose membranes and grown overnight on non-inducing medium to produce master plates. A total of 18,000 colonies were picked and analyzed from the third panning round, half from the competitive elution and half from the subsequent TEA elution.
(358) The nitrocellulose membranes with bacterial colonies were induced with IPTG to express and secrete a soluble scFv protein and were brought into contact with a secondary nitrocellulose membrane coated with MASP-2A antigen along with a parallel membrane coated with 4% milk in PBS (blocking solution).
(359) ScFvs that bound to MASP-2A were detected via their c-Myc tag with Mouse ?-cMyc mAb and Rabbit ?-Mouse HRP. Hits corresponding to scFv clones that were positive on MASP-2A and negative on Milk-PBS were selected for further expression, and subsequent ELISA analysis.
(360) Results:
(361) Panning of the scFv phagemid library against MASP-2A followed by scFv conversion and a filter screen yielded 137 positive clones. The majority of the positive clones came from competitive elution with MBL, using both NiNTA and Streptavidin strategies. All the positive clones were continued with micro expression (200 ?l scale) and subsequent extraction. ScFv were isolated from the periplasma of the bacteria by incubating the bacteria suspension with sucrose lysis buffer and lysozyme for one hour, after which the supernatant was isolated by a centrifugation step. The supernatant containing scFv secreted into the medium together with the contents of the periplasma was analyzed by two assays: ELISA using physically adsorbed MASP-2A, and binding analysis using amine coupled MASP-2A to a CM5 chip on the Biocore, as described in more detail below.
(362) MASP-2A ELISA on ScFv Candidate Clones Identified by Panning/scFv Conversion and Filter Screening
(363) Methods:
(364) 4 ?g/ml MASP-2A was immobilized on maxisorp ELISA plates (Nunc) in PBS overnight at 4? C. The next day, the plates were blocked by washing three times with PBS-Tween (0.05%). Crude scFv material (100 ?l medium-periplasma extract) from each of the 137 scFv candidates (generated as described above) was added per well to the plate. Next, anti-cMyc was added, and in the final step HRP-conjugated Rabbit anti-Mouse was applied to detect bound scFv. The reaction was developed in peroxidase substrate 1-step ABTS (Calbiochem). The positive control was OMS100 (an anti-MASP-2 antibody in Fab2 format) diluted to 10 ?g/ml in PBS-Tween 0.05%. The negative control was medium-periplasma from XL1-Blue without plasmid.
(365) Washes of 3?200 ?l PBS-Tween 0.05% (v/v) were carried out between every step.
(366) The primary antibody was murine ?-cMyc, 1:5000 in PBS-Tween 0.05% (w/v).
(367) The conjugate was rabbit ?-Goat-HRP at 1:5000 in PBS-Tween 0.05% (w/v) or Goat anti-human IgG (H+L, Pierce 31412). The substrate was ABTS, with 15 minutes incubation at room temperature. All volumes, except washes and blocking, were 100 ?l/well. All incubations were for 1 hour with shaking at room temperature.
(368) Results:
(369) 108/137 clones were positive in this ELISA assay (data not shown), of which 45 clones were further analyzed as described below. The positive control was OMS100 Fab2 diluted to 10 ?g/ml in PBS-Tween, and this clone was positive. The negative control was medium-periplasma from XL1-Blue without plasmid, which was negative.
Example 3
(370) This Example describes the MASP-2 functional screening method used to analyze the high affinity fully human anti-MASP-2 scFv antibody candidates for the ability to block MASP-2 activity in normal human serum.
(371) Rationale/Background
(372) Assay to Measure Inhibition of Formation of Lectin Pathway C3 Convertase:
(373) A functional assay that measures inhibition of lectin pathway C3 convertase formation was used to evaluate the blocking activity of the anti-MASP-2 scFv candidate clones. The lectin pathway C3 convertase is the enzymatic complex (C4b2a) that proteolytically cleaves C3 into the two potent proinflammatory fragments, anaphylatoxin C3a and opsonic C3b. Formation of C3 convertase appears to a key step in the lectin pathway in terms of mediating inflammation. MASP-2 is not a structural component of the lectin pathway C3 convertase (C4b2a); therefore anti-MASP-2 antibodies (or Fab2) will not directly inhibit activity of preexisting C3 convertase. However, MASP-2 serine protease activity is required in order to generate the two protein components (C4b, C2a) that comprise the lectin pathway C3 convertase. Therefore, anti-MASP-2 scFv which inhibit MASP-2 functional activity (i.e., blocking anti-MASP-2 scFv) will inhibit de novo formation of lectin pathway C3 convertase. C3 contains an unusual and highly reactive thioester group as part of its structure. Upon cleavage of C3 by C3 convertase in this assay, the thioester group on C3b can form a covalent bond with hydroxyl or amino groups on macromolecules immobilized on the bottom of the plastic wells via ester or amide linkages, thus facilitating detection of C3b in the ELISA assay.
(374) Yeast mannan is a known activator of the lectin pathway. In the following method to measure formation of C3 convertase, plastic wells coated with mannan were incubated with diluted human serum to activate the lectin pathway. The wells were then washed and assayed for C3b immobilized onto the wells using standard ELISA methods. The amount of C3b generated in this assay is a direct reflection of the de novo formation of lectin pathway C3 convertase. Anti-MASP-2 scFv's at selected concentrations were tested in this assay for their ability to inhibit C3 convertase formation and consequent C3b generation.
(375) Methods:
(376) The 45 candidate clones identified as described in Example 2 were expressed, purified and diluted to the same stock concentration, which was again diluted in Ca.sup.++ and Mg.sup.++ containing GVB buffer (4.0 mM barbital, 141 mM NaCl, 1.0 mM MgCl.sub.2, 2.0 mM CaCl.sub.2, 0.1% gelatin, pH 7.4) to assure that all clones had the same amount of buffer. The scFv clones were each tested in triplicate at the concentration of 2 ?g/ml. The positive control was OMS100 Fab2 and was tested at 0.4 ?g/ml. C3c formation was monitored in the presence and absence of the scFv/IgG clones.
(377) Mannan was diluted to a concentration of 20 ?g/ml (1 ?g/well) in 50 mM carbonate buffer (15 mM Na.sub.2CO.sub.3+35 mM NaHCO.sub.3+1.5 mM NaN.sub.3), pH 9.5 and coated on an ELISA plate overnight at 4? C. The next day, the mannan coated plates were washed 3? with 200 ?l PBS. 100 ?l of 1% HSA blocking solution was then added to the wells and incubated for 1 hour at room temperature. The plates were washed 3? with 200 ?l PBS, and stored on ice with 200 ?l PBS until addition of the samples.
(378) Normal human serum was diluted to 0.5% in CaMgGVB buffer, and scFv clones or the OMS100 Fab2 positive control were added in triplicates at 0.01 ?g/ml; 1 ?g/ml (only OMS100 control) and 10 ?g/ml to this buffer and preincubated 45 minutes on ice before addition to the blocked ELISA plate. The reaction was initiated by incubation for one hour at 37? C. and was stopped by transferring the plates to an ice bath. C3b deposition was detected with a Rabbit ?-Mouse C3c antibody followed by Goat ?-Rabbit HRP. The negative control was buffer without antibody (no OMS100=maximum C3b deposition), and the positive control was buffer with EDTA (no C3b deposition). The background was determined by carrying out the same assay, but in mannan negative wells. The background signal against plates without mannan was subtracted from the mannan positive signals. A cut-off criterion was set at half of the activity of an irrelevant scFv clone (VZV) and buffer alone.
(379) Results:
(380) Based on the cut-off criteria, a total of 13 clones were found to block the activity of MASP-2 as shown in
(381) TABLE-US-00021 TABLE 9 10 Unique Clones with Functional anti-MASP-2 Activity Bio- VH Germline VL Germline Clone name ELISA core Panning Elution subclass identity (%) subclass identity (%) 18P15 + + Strep- Comp/ VH6 95.62 ?3 94.27 (13C24/6l18) tavidin TEA 4D9 + + Strep- TEA/ VH2 99.66 ?3 95.34 (18L16) tavidin Comp 17D20 + + Strep- Comp VH2 96.56 ?3 94.98 (17P10) tavidin 17L20 + + Strep- Comp VH6 96.3 ?3 93.55 tavidin 4J3 + + Strep- Comp/ VH2 98.97 ?3 98.21 (16L13/4F2) tavidin TEA 18L16 + + Strep- Comp VH2 100 ?3 93.55 tavidin 21B17 + ? NiNTA TEA VH3 99.31 ?3 96.42 9P13 + ? NiNTA Comp VH6 100 ?3 95.34 17N16 + ? Strep- TEA/ VH6 99.66 ?3 97.85 tavidin Comp 3F22 + ? Strep- VH6 100 ?3 96.42 (18C15) tavidin
(382) As shown above in TABLE 9, 10 different clones with acceptable functional activity and unique sequences were chosen for further analysis. As noted in TABLE 9, some of the clones were detected two or three times, based on identical sequences (see first column of TABLE 9 with clone names).
(383) Expression and Purification of Ten svFc Candidate Clones
(384) The ten candidate clones shown in TABLE 9 were expressed in one liter scale and purified via ion exchange in Nickel chromatography. After that a sample of each clone was run on a size exclusion chromatography column to assess the monomer and dimer content. As shown below in TABLE 10, nearly all of the scFv clones were present in the monomer form, and this monomer fraction was isolated for further testing and ranking.
(385) TABLE-US-00022 TABLE 10 Analysis of Monomer Content Clone Name Monomer 4D9 97% 18P15 98% 17D20 95% 17N16 93% 3F22 86% 4J3 81% 17L20 98% 18L16 92% 9P13 89% 21B17 91%
(386) Testing Monomer Fraction for Binding and Functional Activity
(387) The clones shown in TABLE 10 were expressed in 1 L scale, purified on metal chromatography and ion exchange, separated into monomer fraction by size exclusion chromatography (SEC) and functional assays were repeated to determine IC.sub.50 values and cross-reactivity.
(388) Functional Assay on Monomer Fractions:
(389) The monomer fraction of the top ten clones, shown in TABLE 10, was purified and tested for functional IC.sub.50 nM in a dilution series in which each received the same concentration of GVB buffer with Calcium and Magnesium and human serum. The scFv clones were tested in 12 dilutions in triplicate. The positive control was OMS100 Fab2. C3b deposition was monitored in the presence and absence of antibody. The results are shown below in TABLE 11.
(390) Binding Assay:
(391) Binding affinity K.sub.D was determined in two different ways for purified monomer fractions of the ten candidate scFv clones. MASP-2A was either immobilized by amine coupling to a CM5 chip, or a fixed concentration of scFv (50 nM) was first captured with amine coupled high affinity ?-cMyc antibody, and next a concentration series of MASP-2A in solution was passed over the chip. The results are shown below in TABLE 11.
(392) Results:
(393) TABLE-US-00023 TABLE 11 Summary of functional inhibitory activity (IC.sub.50) and MASP-2 binding affinity (K.sub.D) for the ten candidate scFv clones assayed in the monomer state Inhibitory Binding Affinity to Binding activity in human MASP-2 Affinity human Human Serum (immobilized) MASP-2 in solution Clone name IC.sub.50 (nM) K.sub.D (nM) K.sub.D (nM) 18P15 123.1 39.8 5.88 (13C24/6l18) 4D9 22.0 8.4 2.0E?11 (18L16) 17D20 156.6 11.3 0.76 (17P10) 17L20 ND 28.8 21.3 4J3 54.9 55.5 5.72 (16L13/4F2) 18L16 6.1 39.0 5.48 21B17 ND ND 4.0 9P13 28.9 220.0 2.4E?11 17N16 15.4 3560.0 1.68 3F22 20.6 ND 2.8E?12 (18C15)
(394) Discussion of Results:
(395) As shown in TABLE 11, in the functional assay, five out of the ten candidate scFv clones gave IC.sub.50 nM values less than the 25 nM target criteria using 0.5% human serum. As described below, these clones were further tested in the presence of non-human primate serum and rat serum to determine functional activity in other species. With regard to binding affinity, in solution, all binding affinities were in the range of low nM or better, whereas in the conventional assay with immobilized MASP-2, only two clones (4D9 and 17D20) had affinities in the low nM range. The observation of higher affinities in the solution based assay is likely a result of the fact that the antigen multimerizes when in solution. Also, when the target is immobilized on the chip (via oriented coupling) the epitope may be masked, thereby reducing the observed affinities in the immobilized assay.
Example 4
(396) This Example describes the results of testing the ten candidate human anti-MASP-2 scFv clones for cross-reactivity with rat MASP-2 and determining the IC.sub.50 values of these scFv clones in a functional assay to determine their ability to inhibit MASP-2 dependent complement activation in human serum, non-human primate serum, and rat serum.
(397) Methods:
(398) Cross-Reactivity with Rat MASP-2
(399) The ten candidate scFv clones, shown in TABLE 9 of Example 3, were tested for cross-reactivity against rat MASP-2A in a conventional ELISA assay against adsorbed rat MASP-2A. Rat MASP-2A was diluted to 4 ?g/ml in PBS and coated on a Maxisorp ELISA plate (Nunc) overnight at 4? C. The next day, the plate was blocked by washing three times in PBS-Tween (0.05%). The ScFv clones (100 ?l) diluted in 20 ?g/ml in PBS-Tween were added to the plate, and further titrated with 4-fold dilutions three times. MASP-2A specific svFc clones (wells containing bound scFv) were detected with anti-cMyc and rabbit anti-mouse HRP secondary antibody. The reaction was developed in peroxidase substrate TMB (Pierce). The positive control was OMS100 Fab2 diluted to 10 ?g/ml in PBS-Tween. All the tested clones showed cross reaction with rat MASP-2A, which was expected since the second panning round was with rat MASP-2 (data not shown).
(400) Functional Characterization of the Ten Candidate scFv Clones in Human Serum, Non-Human Primate (NHP) Serum and Rat Serum
(401) Determination of Baseline C3c Levels in Different Sera
(402) First, an experiment was carried out to compare the baseline C3b levels in the three sera (human, rat and NHP) as follows.
(403) Mannan was diluted to 20 ?g/ml and coated on an ELISA plate overnight at 4? C. The next day wells were blocked with 1% HSA. Normal human, rat and African Green Monkey serum (non-human primate NHP) serum was diluted starting at 2% with two-fold dilutions in CaMgGVB buffer. The reaction was initiated by incubation for one hour at 37? C., and was stopped by transferring the plate to an ice bath. C3b deposition was detected with a rabbit anti-mouse C3c antibody, followed by goat anti-rabbit HRP. The negative control was buffer without antibody (no OMS100 results in maximum C3b deposition) and the positive control for inhibition was buffer with EDTA (no C3b deposition).
(404)
(405) Functional Assay of the ScFv Clones in Different Sera
(406) Purified monomer fractions of the ten candidate scFv clones were then tested for functional IC.sub.50 nM in human serum, rat serum and African green monkey serum (non-human primate NHP). The assay was performed as described in Example 3, using 1000 nM scFv purified protein and either normal human serum that was diluted to 0.9% in CaMgGVB buffer; African Green Monkey serum diluted to 0.2% in CaMgGVB buffer; or Rat serum diluted to 0.375% in CaMgGVB buffer. All ten scFv clones were tested in a dilution series in which they received the same concentration of GVB buffer with calcium and magnesium and serum. The scFv clones were tested in twelve dilutions in triplicates. The positive control was OMS100 Fab2 at 100 ng/ml or addition of EDTA to the reaction. The negative control was an irrelevant scFv control or PBS with no scFv. C3b deposition was monitored in the presence and absence of scFv or Fab2 antibody. The background signal of OMS100 at 100 ng/ml was subtracted from all signals. TABLE 12 summarizes the results of the functional assays in all three sera.
(407) TABLE-US-00024 TABLE: 12 Functional IC.sub.50 (nM) activity of the scFv clones in three different types of sera. Non- Non- human human human human human human rat serum serum serum serum primate primate serum Clone name Exp #1* Exp #2 Exp #3 Exp #4 Exp #1 Exp #2 Exp #1 18P15 123.1 207.5 198.9 81.92 407.1 249.6 ND (13C24/6l18) 4D9 22.0 46.31 62.16 38.37 114.6 203.1 ND (18L16) 17D20 156.6 39.93 24.05 23.74 94.75 71.85 434.1 (17P10) 17L20 ND 104.3 308.1 198.9 ambiguous 71.74 40.97 4J3 54.9 105.6 123.8 41.64 180.9 168.3 ND (16L13/4F2) 18L16 6.1 96.85 52.32 53.51 65.60 127.6 ND 21B17 ND 93.73 325.4 434.7 338.3 366.4 ND 9P13 28.9 120.5 17.28 24.26 99.29 77.1 ND 17N16 15.4 65.42 24.78 19.16 95.57 58.78 ND 3F22 20.6 36.73 41.40 68.81 114.2 172.8 ND (18C15) Note: *the first set of data on human serum (Exp #1) was done on scFv samples that were not concentrated, therefore, clones with low concentration could not be titrated fully. In the remaining experiments, all clones were concentrated and titrations started at identical concentrations.
(408) Summary of Results for Functional Activity in scFv Candidate Clones in Different Sera:
(409) All ten of the scFv clones showed function in both human and non-human primate (NHP) serum after the sera had been normalized with respect to C3b deposition levels. The six most active clones in human serum were: 9P13>17N16>17D20>4D9>3F22>18L16, when ranked from best to worst. In NHP serum, the clones ranked (best to worst): 17L20>17N16>17D20>9P13>18L16>3F22. Both 17N16 and 17D20 ranked in the top three for both human and NHP sera. 17D20 also showed some activity in rat serum.
(410) Based on these results, the top three scFv clones were determined to be: 18L16, 17D20 and 17N16. These three clones were further analyzed in dilute human serum (1% serum) as shown below in TABLE 13.
(411) TABLE-US-00025 TABLE 13 C3 Assay of the three candidate clones: (IC.sub.50 nM) in dilute serum (1%) 17D20 17N16 18L16 human serum Exp #1 24 nM 19 nM 53 nM Exp #2 24 nM 24 nM 52 nM Exp #3 40 nM 65 nM 97 nM mean 29 +/? 5 36 +/? 15 67 +/? 15 non-human primate serum Exp #1 94 nM 95 nM 65 nM Exp #2 74 nM 58 nM 154 nM mean 84 nM 76 nM 110 nM
(412)
(413) As further shown in
(414)
(415) TABLE-US-00026 TABLE 14 Sequence of ScFv Candidate clones shown in FIG. 5A and 5B Clone Reference ID full length AA sequence 17D20 SEQ ID NO: 55 18L16 SEQ ID NO: 56 4D9 SEQ ID NO: 57 17L20 SEQ ID NO: 58 17N16 SEQ ID NO: 59 3F22 SEQ ID NO: 60 9P13 SEQ ID NO: 61
(416) The ranking priorities were (1) human serum functional potency and full blockage; (2) NHP cross-reactivity and (3) sequence diversity. 17D20 and 17N16 were selected as the best representatives from each gene family. 18L16 was selected as the third candidate with appreciable CDR3 sequence diversity.
(417) 17N16 and 17D20 were the top two choices due to complete functional blockage, with the best functional potencies against human; appreciable monkey cross-reactivity and different VH gene families. 3F22 and 9P13 were eliminated due to VH sequences nearly identical to 17N16. 18P15, 4J9 and 21B17 were eliminated due to modest potency. 17L20 was not pursued because it was only partially blocking.
(418) 18L16 and 4D9 had similar activities and appreciable diversity compared to 17D20. 18L16 was chosen due to greater primate cross-reactivity than 4D9.
(419) Therefore, based on these criteria: the following three mother clones: 17D20, 17N16 and 18L16 were advanced into affinity maturation as further described below.
Example 5
(420) This Example describes the cloning of three mother clones 17D20, 17N16 and 18L16 (identified as described in Examples 2-4) into wild-type IgG4 format, and assessing the functionality of three mother clones as full length IgGs.
(421) Rationale:
(422) Fully human anti-MASP-2 scFv antibodies with moderate functional potency were identified using phage display as described in Examples 2-4. Three such mother clones, 17D20, 17N16 and 18L16 were selected for affinity maturation. To assess the functionality of these mother clones as full length IgGs, IgG4 wild-type and S228P hinge region IgG4 mutant forms of these antibodies were produced. The S228P hinge region mutant was included to increase serum stability (see Labrijn A. F. et al., Nature Biotechnology 27:767 (2009)).
(423) The amino acid sequence of IgG4 wild-type is set forth as SEQ ID NO:63, encoded by SEQ ID NO:62.
(424) The amino acid sequence of IgG4 S228P is set forth as SEQ ID NO:65, encoded by SEQ ID NO:64.
(425) The IgG4 molecules were also cleaved into F(ab)2 formats with pepsin digestion and fractionated by size exclusion chromatography in order to compare the mother clones directly to the OMS100 control antibody, which is a F(ab)2 molecule.
(426) Methods:
(427) Generating the Clones into Full Length Format
(428) The three mother clones were converted into wild type IgG4 format and into IgG4 mutant S228P format. This was accomplished by PCR isolation of the appropriate VH and VL regions from the above-referenced mother clones and cloning them into pcDNA3 expression vectors harboring the appropriate heavy chain constant regions to create in-frame fusions to produce the desired antibody. The three mother clones in mutant IgG4 format were then cleaved with pepsin to generate F(ab)2 fragments and the latter were purified by fractionation on a size exclusion chromatography column.
(429) Binding Assay
(430) The candidate mother clones converted into IgG4 format were transiently transfected into HEK 293 cells and supernatants from the transient transfection were titrated in an ELISA assay. The clones showed excellent reactivity with physically adsorbed human MASP-2A, and ranked in the following order: 17N16>17D20>18L16 (data not shown).
(431) The clones were then purified and re-tested in an ELISA and activity assay as follows. Human MASP-2A was coated at 3 ?g/ml in PBS on a maxisorp plate, IgG (45 ?g/ml) and Fab2 (30 ?g/ml) were diluted in PBS-Tween to a starting concentration of 300 nM, and further with 3-fold dilutions. IgGs were detected with HRP conjugated Goat ?-Human IgG (Southern Biotech) and the F(ab)2 were detected with HRP-conjugated Goat ?-Human IgG H+L (Pierce 31412). The reaction was developed with TMB substrate and stopped with 2M H.sub.2SO.sub.4. The results are shown below in TABLE 15.
(432) TABLE-US-00027 TABLE 15 Binding affinity to human MASP-2 Antibody Clone IgG4 mutated Reference format (pM) F(ab)2 (pM) scFv (nM) OMS100 control ND 92.5 ND 18L16 96.2 178.7 ND 17N16 20.6 95.9 18.9 17D20 28.4 181.5 ND
(433) Functional Assay
(434) The C3 convertase assay using 1% normal human serum (NHS), as described in Example 4, was used to compare the functional activity of the mother scFv clones and full length IgG4 counterparts in 1% NHS. Mannan was diluted to a concentration of 20 ?g/ml and coated on ELISA plate overnight at 4? C. The next day, the wells were blocked with 1% human serum. Human serum was diluted to 1% in CaMgGVB buffer and the purified antibodies; scFv (900 nM), F(ab)2 (300 nM), IgG (300 nM) were added in duplicates at a series of different dilutions to the same amount of buffer, and preincubated for 45 minutes on ice before adding to the blocked ELISA plate. The reaction was initiated by incubation at 37? C. for one hour and was stopped by placing the plate on ice. C3b deposition was determined with a Rabbit ?-Mouse C3c antibody followed by a Goat ?-Rabbit HRP. The background of OMS100 at 50 nM on mannan positive plates was subtracted from the curves. A summary of the results of this analysis are shown below in TABLE 16.
(435) TABLE-US-00028 TABLE 16 C3 convertase assay using 1% human serum (IC.sub.50 nM) scFv Fold improvement clone wt IgG4 F(ab)2 scFv (scFv ID# (IC.sub.50 nM) (IC.sub.50 nM) (IC.sub.50 nM) to divalent form) 17D20 7.392/10.32 7.305/13.54 98.27/151.0 .sup.~13.5x/.sup.~12.6x 17N16 5.447/3.088 5.701/5.092 36.18/77.60 .sup.~6.6x/.sup.~19.3x 18L16 33.93/22.0 NA 160.2/193.0 .sup.~4.7x/.sup.~8.7x Note: The two values shown in columns 2-4 of Table 16 refer to the results of two separate experiments.
(436) The functional potency of the IgG4 mother clones were also compared to the IgG4 hinge mutant (S228P) format for each clone. The numeric IC.sub.50 values for the C3b deposition assay using 1% NHS are shown below in TABLE 17.
(437) TABLE-US-00029 TABLE 17 Wild type (IgG4) versus Hinge Mutant format (S228P) in C3b deposition assay in 1% human serum (IC.sub.50 nM) Clone ID WT format (IgG4) IgG4 hinge mutant (S228P) 17D20 22 nM 11/27 nM 17N16 ?20 nM agonist 18L16 59 nM partial/mixed
(438) As shown above in TABLE 17, in some cases, unexpected agonist pharmacology was noted for IgG's derived from antagonistic scFv's. The mechanistic basis for this observation is not understood.
(439) The activities of IgG4 converted mother clones with inhibitory function in 1% NHS were further evaluated under more stringent assay conditions that more closely mimic physiological conditions. To estimate antibody activity under physiological conditions, testing of mother clone IgG4 preparations was conducted for their ability to inhibit Lectin-pathway (LP) dependent C3b deposition onto Mannan-coated plates under stringent assay conditions using minimally diluted (90%) human plasma.
(440) The results of the C3b deposition assay in 90% human plasma are shown in
(441) Based on these findings, the activity of IgG4 converted mother clones was further evaluated by examining C4b deposition under stringent assay conditions (90% NHS). This assay format provides for a direct measure of antibody activity on the enzymatic reaction catalyzed by MASP-2.
(442) Assay to Measure Inhibition of MASP-2-Dependent C4 Cleavage
(443) Background:
(444) The serine protease activity of MASP-2 is highly specific and only two protein substrates for MASP-2 have been identified; C2 and C4. Cleavage of C4 generates C4a and C4b. Anti-MASP-2 Fab2 may bind to structural epitopes on MASP-2 that are directly involved in C4 cleavage (e.g., MASP-2 binding site for C4; MASP-2 serine protease catalytic site) and thereby inhibit the C4 cleavage functional activity of MASP-2.
(445) Yeast mannan is a known activator of the lectin pathway. In the following method to measure the C4 cleavage activity of MASP-2, plastic wells coated with mannan were incubated for 90 minutes at 4? C. with 90% human serum to activate the lectin pathway. The wells were then washed and assayed for human C4b immobilized onto the wells using standard ELISA methods. The amount of C4b generated in this assay is a measure of MASP-2 dependent C4 cleavage activity. Anti-MASP-2 antibodies at selected concentrations were tested in this assay for their ability to inhibit C4 cleavage.
(446) Methods:
(447) 96-well Costar Medium Binding plates were incubated overnight at 5? C. with mannan diluted in 50 mM carbonate buffer, pH 9.5 at 1.0 ?g/50 ?L/well. Each well was washed 3? with 200 ?L PBS. The wells were then blocked with 100 ?L/well of 1% bovine serum albumin in PBS and incubated for one hour at room temperature with gentle mixing. Each well was washed 3? with 200 ?L of PBS. Anti-MASP-2 antibody samples were diluted to selected concentrations in Ca.sup.++ and Mg.sup.++ containing GVB buffer (4.0 mM barbital, 141 mM NaCl, 1.0 mM MgCl.sub.2, 2.0 mM CaCl.sub.2, 0.1% gelatin, pH 7.4) at 5? C. 90% human serum was added to the above samples at 5? C. and 100 ?L was transferred to each well. The plates were covered and incubated for 90 min in an ice waterbath to allow complement activation. The reaction was stopped by adding EDTA to the reaction mixture. Each well was washed 5?200 ?L with PBS-Tween 20 (0.05% Tween 20 in PBS), then each well was washed with 2? with 200 ?L PBS. 100 ?L/well of 1:700 dilution of biotin-conjugated chicken anti-human C4c (Immunsystem AB, Uppsala, Sweden) was added in PBS containing 2.0 mg/ml bovine serum albumin (BSA) and incubated one hour at room temperature with gentle mixing. Each well was washed 5?200 ?L PBS. 100 ?L/well of 0.1 ?g/ml of peroxidase-conjugated streptavidin (Pierce Chemical #21126) was added in PBS containing 2.0 mg/ml BSA and incubated for one hour at room temperature on a shaker with gentle mixing. Each well was washed 5?200 ?L with PBS. 100 ?L/well of the peroxidase substrate TMB (Kirkegaard & Perry Laboratories) was added and incubated at room temperature for 16 min. The peroxidase reaction was stopped by adding 100 ?L/well of 1.0 M H.sub.3PO.sub.4 and the OD.sub.450 was measured.
(448) Results:
(449) In this format, both IgG4 forms of 17D20 inhibited Lectin pathway driven C4b deposition, although the IC.sub.50 values were ?3 fold higher compared to the C3b deposition assay. Interestingly, 17N16 IgG4 wild type showed good activity in this assay with an IC.sub.50 value and dose-response profile comparable to the C3b deposition assay. 18L16 was considerably less potent and did not achieve complete inhibition in this format (data not shown).
(450) Discussion:
(451) As described in Examples 2-5, fully human anti-MASP-2 scFv antibodies with functional blocking activity were identified using phage display. Three such clones, 17N16, 17D20 and 18L16, were selected for affinity maturation and further testing. To assess the functionality of these mother clones as full length IgGs, IgG4 wild type and IgG4 S228P hinge region mutant forms of these antibodies were produced. As described in this Example, the majority of full length IgGs had improved functional activity as compared to their scFv counterparts when tested in a standard functional assay format with 1% human plasma. To estimate antibody activity under physiological conditions, testing of mother clone IgG4 preparations was conducted under stringent assay conditions using 90% human plasma. Under these conditions, several antibodies revealed functional potencies which were substantially better than expected based on their performance in standard (1%) plasma functional assays.
Example 6
(452) This Example describes the chain shuffling and affinity maturation of mother clones 17D20, 17N16 and 18L16, and analysis of the resulting daughter clones.
(453) Methods:
(454) To identify antibodies with improved potency, the three mother scFv clones, 17D20, 17N16 and 18L16, identified as described in Examples 2-5, were subjected to light chain shuffling. This process involved the generation of a combinatorial library consisting of the VH of each of the mother clones paired up with a library of na?ve, human lambda light chains (VL) derived from six healthy donors. This library was then screened for scFv clones with improved binding affinity and/or functionality.
(455) 9,000 light chain shuffled daughter clones were analyzed per mother clone, for a total of 27,000 clones. Each daughter clone was induced to express and secrete soluble scFv, and was screened for the ability to bind to human MASP-2A. ScFvs that bound to human MASP-2A were detected via their c-Myc tag. This initial screen resulted in the selection of a total of 119 clones, which included 107 daughter clones from the 17N16 library, 8 daughter clones from the 17D20 library, and 4 daughter clones from the 18L16 library.
(456) The 119 clones were expressed in small scale, purified on NiNTA columns, and tested for binding affinity in an ELISA assay against physically adsorbed human MASP-2A.
(457) Results:
(458) The results of the ELISA assay on a representative subset of the 119 daughter clones is shown in
(459) As shown in
(460) After purification, the six daughter clones were tested in a complement assay for inhibitory activity. The results are shown in TABLE 18.
(461) TABLE-US-00030 TABLE 18 Complement assay of mother and daughter clones scFv clone ID# IC.sub.50 nM K.sub.D nM 17N16mc 8.8 18.9 17N16m_d17N9 10.3 48.6 17N16m_d16E12 103.2 17D20m_d18M24 172.3
(462) As shown above in TABLE 18, only one of the clones, 17N16m_d17N9, had affinity and activity in the same range as the mother clone.
(463)
(464) Rescreening of the 17N16 lambda library resulted in several additional candidate daughter clones, of which 17N16m_d27E13 was identified in an ELISA and complement assay, and was included in the set of candidate daughter clones for further analysis.
(465) Assaying Daughter Clones in Different Sera
(466) The candidate daughter clones were analyzed in different sera as follows. Mannan was diluted to 20 ?g/ml and coated on an ELISA plate overnight at 4? C. The next day, the wells were blocked with 1% HSA. African Green monkey serum was diluted to 0.2%, rat serum was diluted to 0.375% and human serum was diluted to 1% in CaMgGVB buffer. Purified scFv from each of the candidate daughter clones was added in duplicates at a series of different concentrations to the same amount of buffer and preincubated for 45 minutes on ice prior to addition to the blocked ELISA plate. The reaction was initiated by incubation for one hour at 37? C., and was stopped by transferring the plate to an ice bath. C3c release was detected with a Rabbit ?-Mouse C3c antibody followed by a Goat ?-Rabbit HRP. The background of OMS100 at 0.1 ?g/ml on mannan negative plates was subtracted from these curves. The results are summarized below in TABLE 19.
(467) TABLE-US-00031 TABLE 19 IC.sub.50 values for mother clone 17N16 and daughter clones 17N16m_d17N9 and 17N16m_d27E13 in different sera. African Green Serum Human Serum Rat Serum ScFv Clones IC.sub.50 (nM) IC.sub.50 (nM) IC.sub.50 (nM) 17N16mc 92.93/81.37 65.31/73.54 ND/195.8 17N16m_d17N9 63.82/81.11 39.90/57.67 79.32/140.6 17N16m_d27E13 ND/430.9 389.1/NA NA Note: The two values shown in columns 2-4 of Table 19 refer to the results of two separate experiments.
(468) Discussion of Results:
(469) As shown in TABLE 19, daughter clone 17N16m_d17N9 has higher functional activity than the mother clone. The improved function in rat serum in addition to the seventeen amino acid sequence difference in the light chain as compared to the mother clone makes this clone a positive candidate. Based on this data, daughter clone 17N16m_d17N9 was selected for further analysis.
Example 7
(470) This Example describes the generation and analysis of daughter clone 17D20m_d3521N11, derived from mother clone 17D20.
(471) Background/Rationale:
(472) To improve on affinity of the mother clone candidate 17D20mc, an additional look-through-mutagenesis was performed on the first three amino acids in the CDR3 of the heavy chain (CDR-H3). This was a mutagenesis campaign in parallel with the normal light chain shuffling of 17D20mc. Therefore, three different scFv libraries were constructed by PCR where the amino acid positions 1, 2 and 3 were randomized to the set of all possible 20 amino acids using degenerate codons. After cloning the libraries, microscale expression was performed and scFv binding was monitored on a MASP-2A coated CM5 chip (not shown). BIAcore analysis of microscale expression was carried out on the three different libraries on chips coated with MASP-2A, randomized at position 1, 2, or 3 and potentially interesting daughter clones were identified.
(473) It was observed that for the amino acid positions 1 and 2 of CDR-H3, no clone was found having an improved off-rate in comparison with the mother candidate clone 17D20m. However, a few candidates with mutations in amino acid position 3 in the CDR-H3 demonstrated improved off-rates in comparison with the mother clone 17D20m. These clones (#35, #59 and #90) were sequenced to identify the mutation. Sequences of two look-through-mutagenesis derived clones are compared with 17D20mc (original sequence). Interestingly, all sequenced clones except one (#90), harbored an Ala-Arg substitution in comparison with the mother candidate.
(474)
(475) Analysis of Mutant Clones #35 and #59
(476) The mutant clones #35 and #59 were expressed in small scale and further tested in comparison with the mother candidate clone 17D20 in a titration-ELISA on immobilized MASP-2A (10 ?g/ml). The scFvs were serially diluted 5-fold starting from 20 ?g/ml and binding was detected using anti-Myc (mouse)/anti-mouse HRP. Slightly improved binding was observed in the ELISA assay for the candidate clones #35 and #59 in comparison with the mother candidate clone 17D20 (data not shown).
(477) The improved clone #35 was combined with the best light chain shuffled clone 17D20m_d21N11. The mutation in the VH of the candidate 17D20md35 (Ala-Arg) was combined with the light chain of the candidate 17D20m_d21N11, thus resulting in the clone termed VH35-VL21N11, otherwise referred to as 3521N11.
(478)
(479)
(480) A titration ELISA assay of the set of scFvs shown in
(481) TABLE-US-00032 TABLE 20 ELISA on human MASP-2 Clone ID K.sub.D (nM) 17D20m_d21N11 10 17D20m_d3521N11 1.6 17D20mc (monomer) 1.9 17D20md#35 (monomer) 1.2
(482) The 17D20m_d3521N11 daughter clone was further analyzed for functional activity as described below in Example 8.
Example 8
(483) This Example describes the conversion and analysis of the candidate daughter clones 17N16m_d17N9 and 17D20 m_d3521N11 into IgG4, IgG4/S228P and IgG2 format.
(484) Rationale/Background
(485) The antibody screening methods described in Examples 2-7 have identified two mother clones, 17N16 and 17D20, with suitable functionality. Affinity maturation of these mother clones has yielded daughter clones that showed approximately 2-fold improvements in potency as compared to the mother clones in surrogate functional assays at the scFv level. The daughter clones with the best activities are 17N16m_d17N9 and 17D20m_d3521N11. As described in Example 6, in a comparison of functional activity of 17N16 mother clone with light chain shuffled daughter clones (scFv format, 1% NHS assay) it was determined that 17N16m_d17N9 is slightly more potent than the mother clone and has the best functional potency of all daughter clones tested in this assay.
(486) Methods:
(487) A comparison of the functional potency of the candidate scFv clones was carried out in the C3 conversion assay (1% human serum and 90% human serum), and in a C4 conversion assay (90% human serum), carried out as described in Example 5.
(488) The results are shown below in TABLE 21.
(489) TABLE-US-00033 TABLE 21 Comparison of functional potency in IC.sub.50 (nM) of the lead daughter clones and their respective mother clones (all in scFv format) 1% human 90% serum human serum 90% human serum C3 assay C3 assay C4 assay scFv clone (IC.sub.50 nM) (IC.sub.50 nM) (IC.sub.50 nM) 17D20mc 38 nd nd 17D20m_d21N11 360 nd ~500 17D20m_d3521N11 26 >1000 140 17N16mc 68 nd nd 17N16m_d17N9 48 15 230 17N16m_d27E13 390 >1000 nd
(490) As shown above in TABLE 21, 17N16m_d17N9 has good activity when assayed in 90% normal human serum (NHS) in the C3 assay and is more potent that the other daughter clones in this format.
(491) Conversion of Candidate Clones into IgG4, IgG4/S228P and IgG2 Format
(492) All of these candidate clones were converted to IgG4, IgG4/S228P and IgG2 format for further analysis.
(493) SEQ ID NO:62: cDNA encoding wild type IgG4
(494) SEQ ID NO:63: wild type IgG4 polypeptide
(495) SEQ ID NO:64 cDNA encoding IgG4 mutant S228P
(496) SEQ ID NO:65: IgG4 mutant S228P polypeptide
(497) SEQ ID NO:69: cDNA encoding wild type IgG2
(498) SEQ ID NO: 70: wild type IgG2 polypeptide
(499) TABLE-US-00034 TABLE 22 Summary of candidate clones: clone reference daughter clone Ig format VH VL #1 (OMS641) 17N16m_d17N9 IgG2 SEQ ID NO: 21 SEQ ID NO: 27 #2 17N16m_d17N9 IgG4 SEQ ID NO: 21 SEQ ID NO: 27 (OMS642) #3 17N16m_d17N9 IgG4 (mutant) SEQ ID NO: 21 SEQ ID NO: 27 (OMS643) #4 17D20_3521N11 IgG2 SEQ ID NO: 20 SEQ ID NO: 24 (OMS644) #5 17D20_3521N11 IgG4 SEQ ID NO: 20 SEQ ID NO: 24 (OMS645) #6 17D20_3521N11 IgG4 mutant SEQ ID NO: 20 SEQ ID NO: 24 (OMS646)
(500) Monoclonal antibodies #1-6 were tested for the ability to cross-react with a non-human MASP-2 protein (African Green (AG) monkey) in a C3 assay to determine if these antibodies could be used to test for toxicity in an animal model that would be predictive for humans. Monoclonal antibodies #1-6 were also tested in a C3b deposition assay and a C4 assay in 90% human serum. The results are shown below in TABLE 23.
(501) TABLE-US-00035 TABLE 23 Human anti-MASP-2 MoAbs (IC.sub.50 nM) in 90% human serum MoAb MoAb MoAb MoAb MoAb MoAb Assay #1 #2 #3 #4 #5 #6 Human C3 20 3 12 2 3 2 Assay Human C4 30 30 30 5 5 4 assay African nd 26 nd 18 16 14 Green Monkey C3 assay
(502)
(503)
(504) As shown in TABLE 23 and
(505) The MoAb#1-6 were further analyzed in 95% human serum, 95% African Green serum. The results are summarized below in TABLE 24.
(506) TABLE-US-00036 TABLE 24 Functional Functional inhibition of inhibition C3 Functional of C3 deposition inhibition of deposition in in 95% C4 deposition 95% human African in 95% Binding to serum Green Serum human serum immobilized (Average IC.sub.50; (Average (Average Antibody hMASP-2 Average IC.sub.90) IC.sub.50) IC.sub.50) ID (average Kd) nM nM nM 17N16 0.067 4.9; 60.3 17.0 3.3 (IgG4) MoAb#1 0.291 10; 104.1 nd 25.6 (IgG2) MoAb#2 0.314 11.9; 118.0 17.4 19.5 (IgG4) MoAb#3 0.323 9.4; 61.0 9.2 19.8 (IgG4 mutant) 17D20 0.073 2.6; 19.0 25.0 8.5 (IgG4) MoAb#4 0.085 0.9; 9.5 31.0 12.4 (IgG2) MoAb#5 0.067 2.6; 122.0 17.0 7.2 (IgG4) MoAb#6 0.067 1.5; 7.0 13.2 4.5 (IgG4 mutant)
(507)
(508)
(509)
(510) The MoAb#1-6 were further tested for the ability to selectively inhibit the lectin pathway by assaying for inhibition of Rat C3b, inhibition of preassembled MBL-MASP-2 complexes; classical pathway inhibition, and selectivity over C1s. The results are summarized in TABLE 25.
(511) TABLE-US-00037 TABLE 25 Summary of functional assay results Inhibition of Inhibition preassembled Classical of MBL-MASP-2 Pathway Rat C3b complexes inhibition Selectivity Antibody ID (IC.sub.50 nM) IC.sub.50 (nM) IC.sub.50 (nM) over C1s 17N16 (IgG4) nd nd nd nd MoAb#1 (IgG2) nd nd nd >5000x MoAb#2 (IgG4) 100 not detected not detected >5000x (@200 nM) MoAb#3 (IgG4 200 not detected not detected >5000x mutant) (@200 nM) 17D20 (IgG4) nd nd nd nd MoAb#4 (IgG2) nd nd nd >5000x MoAb#5 (IgG4) 500 Yes, IC.sub.50 = not detected >5000x 17 nM MoAb#6 (IgG4 >500 Yes, IC.sub.50 = not detected >5000x mutant) 24.1 nM
(512)
(513)
(514) TABLE-US-00038 TABLE 26 Summary of sequences of daughter clones in various formats: SEQ ID Clone ID Description NO: 17N16m_d17N9 light chain gene sequence 71 17N16m_d17N9 light chain protein sequence 72 17N16m_d17N9 IgG2 heavy chain gene sequence 73 17N16m_d17N9 IgG2 heavy chain protein sequence 74 17N16m_d17N9 IgG4 heavy chain gene sequence 75 17N16m_d17N9 IgG4 heavy chain protein sequence 76 17N16m_d17N9 IgG4 mutated heavy chain gene sequence 77 17N17m_d17N9 IgG4 mutated heavy chain protein 78 sequence 17D20_3521N11 light chain gene sequence 79 17D20_3521N11 light chain protein sequence 80 17D20_3521N11 IgG2 heavy chain gene sequence 81 17D20_3521N11 IgG2 heavy chain protein sequence 82 17D20_3521N11 IgG4 heavy chain gene sequence 83 17D20_3521N11 IgG4 heavy chain protein sequence 84 17D20_3521N11 IgG4 mutated heavy chain gene sequence 85 17D20_3521N11 IgG4 mutated heavy chain protein 86 sequence 17N16m_d17N9 cDNA encoding full length scFv 87 polypeptide 17D20m_d21N11 cDNA encoding full length scFv 88 polypeptide 17D20m_d3521N11 cDNA encoding full length scFv 89 polypeptide
Example 9
(515) This Example describes the epitope mapping that was carried out for several of the blocking human anti-MASP-2 MoAbs.
(516) Methods:
(517) The following recombinant proteins were produced as described in Example 1:
(518) Human MAp19
(519) Human MASP2A
(520) Human MASP-2 SP
(521) Human MASP-2 CCP2-SP
(522) Human MASP-2 CCP1-CCP2-SP
(523) Human MASP-1/3 CUB1-EGF-CUB2
(524) Human MASP-1 CCP1-CCP2-SP
(525) The anti-MASP-2 antibodies OMS100 and MoAb#6 (35VH-21N11VL), which have both been demonstrated to bind to human MASP-2 with high affinity and have the ability to block functional complement activity (see Examples 6-8) were analyzed with regard to epitope binding by dot blot analysis.
(526) Dot Blot Analysis
(527) Serial dilutions of the recombinant MASP-2 polypeptides described above were spotted onto a nitrocellulose membrane. The amount of protein spotted ranged from 50 ng to 5 pg, in ten-fold steps. In later experiments, the amount of protein spotted ranged from 50 ng down to 16 pg, again in five-fold steps. Membranes were blocked with 5% skimmed milk powder in TBS (blocking buffer) then incubated with 1.0 ?g/ml anti-MASP-2 Fab2s in blocking buffer (containing 5.0 mM Ca.sup.2+). Bound Fab2s were detected using HRP-conjugated anti-human Fab (AbD/Serotec; diluted 1/10,000) and an ECL detection kit (Amersham). One membrane was incubated with polyclonal rabbit-anti human MASP-2 Ab (described in Stover et al., J Immunol 163:6848-59 (1999)) as a positive control. In this case, bound Ab was detected using HRP-conjugated goat anti-rabbit IgG (Dako; diluted 1/2,000).
(528) Results:
(529) The results are summarized in TABLE 27.
(530) TABLE-US-00039 TABLE 27 Epitope Mapping Expression construct MoAb #6 OMS100 human MAp19 ? ? human MASP-2A + + Human MASP-2 SP ? ? human MASP-2 CCP2-SP ? ? human MASP-2 CCP1-CCP2-SP + + human MASP-1/3 CUB-EGF-CUBII ? ? human MASP-1 CCP1-CCP2-SP ? ? human MBL/MASP2 complexes + +
(531) The results show that MoAb#6 and OMS100 antibodies are highly specific for MASP-2 and do not bind to MASP-1 or MASP-3. Neither antibody bound to Map19 and MASP-2 fragments not containing the CCP1 domain of MASP-2, leading to the conclusion that the binding sites encompass the CCP1 domain.
Example 10
(532) This Example demonstrates that human anti-MASP-2 MoAb#6 inhibits the lectin pathway in African Green Monkeys following intravenous administration.
(533) Methods:
(534) MoAb#6 was administered intravenously to a first group of three African Green Monkeys at a dosage of 1 mg/kg and to a second group of three African Green Monkeys at a dosage of 3 mg/kg. Blood samples were obtained 2, 4, 8, 10, 24, 48, 72 and 98 hours after administration and were tested for the presence of lectin pathway activity.
(535) As shown in
Example 11
(536) This Example demonstrates that a MASP-2 inhibitor, such as an anti-MASP-2 antibody, is effective for the treatment of radiation exposure and/or for the treatment, amelioration or prevention of acute radiation syndrome.
(537) Rationale:
(538) Exposure to high doses of ionizing radiation causes mortality by two main mechanisms: toxicity to the bone marrow and gastrointestinal syndrome. Bone marrow toxicity results in a drop in all hematologic cells, predisposing the organism to death by infection and hemorrhage. The gastrointestinal syndrome is more severe and is driven by a loss of intestinal barrier function due to disintegration of the gut epithelial layer and a loss of intestinal endocrine function. This leads to sepsis and associated systemic inflammatory response syndrome which can result in death.
(539) The lectin pathway of complement is an innate immune mechanism that initiates inflammation in response to tissue injury and exposure to foreign surfaces (i.e., bacteria). Blockade of this pathway leads to better outcomes in mouse models of ischemic intestinal tissue injury or septic shock. It is hypothesized that the lectin pathway may trigger excessive and harmful inflammation in response to radiation-induced tissue injury. Blockade of the lectin pathway may thus reduce secondary injury and increase survival following acute radiation exposure.
(540) The objective of the study carried out as described in this Example was to assess the effect of lectin pathway blockade on survival in a mouse model of radiation injury by administering anti-murine MASP-2 antibodies.
(541) Study #1
(542) Methods and Materials:
(543) Materials.
(544) The test articles used in this study were (i) a high affinity anti-murine MASP-2 antibody (mAbM11) and (ii) a high affinity anti-human MASP-2 antibody (mAbOMS646) that block the MASP-2 protein component of the lectin complement pathway which were produced in transfected mammalian cells. Dosing concentrations were 1 mg/kg of anti-murine MASP-2 antibody (mAbM11), 5 mg/kg of anti-human MASP-2 antibody (mAbOMS646), or sterile saline. For each dosing session, an adequate volume of fresh dosing solutions were prepared.
(545) Animals.
(546) Young adult male Swiss-Webster mice were obtained from Harlan Laboratories (Houston, Tex.). Animals were housed in solid-bottom cages with Alpha-Dri bedding and provided certified PMI 5002 Rodent Diet (Animal Specialties, Inc., Hubbard Oreg.) and water ad libitum. Temperature was monitored and the animal holding room operated with a 12 hour light/12 hour dark light cycle.
(547) Irradiation.
(548) After a 2-week acclimation in the facility, mice were irradiated at 6.5, 7.0 and 8.0 Gy by whole-body exposure in groups of 10 at a dose rate of 0.78 Gy/min using a Therapax X-RAD 320 system equipped with a 320-kV high stability X-ray generator, metal ceramic X-ray tube, variable x-ray beam collimator and filter (Precision X-ray Incorporated, East Haven, Conn.).
(549) Drug Formulation and Administration.
(550) The appropriate volume of concentrated stock solutions were diluted with ice cold saline to prepare dosing solutions of 0.2 mg/ml anti-murine MASP-2 antibody (mAbM11) or 0.5 mg/ml anti-human MASP-2 antibody (mAbOMS646) according to protocol. Administration of anti-MASP-2 antibody mAbM11 and mAbOMS646 was via IP injection using a 25-gauge needle base on animal weight to deliver 1 mg/kg mAbM11, 5 mg/kg mAbOMS646, or saline vehicle.
(551) Study Design.
(552) Mice were randomly assigned to the groups as described in Table 28. Body weight and temperature were measured and recorded daily. Mice in Groups 7, 11 and 13 were sacrificed at post-irradiation day 7 and blood collected by cardiac puncture under deep anesthesia. Surviving animals at post-irradiation day 30 were sacrificed in the same manner and blood collected. Plasma was prepared from collected blood samples according to protocol and returned to Sponsor for analysis.
(553) TABLE-US-00040 TABLE 28 Study Groups Irradiation Group Level ID N (Gy) Treatment Dose Schedule 1 20 6.5 Vehicle 18 hr prior to irradiation, 2 hr post irradiation, weekly booster 2 20 6.5 anti-murine 18 hr prior to irradiation MASP-2 ab only (mAbM11) 3 20 6.5 anti-murine 18 hr prior to irradiation, 2 hr MASP-2 ab post irradiation, weekly (mAbM11) booster 4 20 6.5 anti-murine 2 hr post irradiation, MASP-2 ab weekly booster (mAbM11) 5 20 6.5 anti-human 18 hr prior to irradiation, 2 hr MASP-2 ab post irradiation, weekly (mAbOMS646) booster 6 20 7.0 Vehicle 18 hr prior to irradiation, 2 hr post irradiation, weekly booster 7 5 7.0 Vehicle 2 hr post irradiation only 8 20 7.0 anti-murine 18 hr prior to irradiation MASP-2 ab only (mAbM11) 9 20 7.0 anti-murine 18 hr prior to irradiation, 2 hr MASP-2 ab post irradiation, weekly (mAbM11) booster 10 20 7.0 anti-murine 2 hr post irradiation, MASP-2 ab weekly booster (mAbM11) 11 5 7.0 anti-murine 2 hr post irradiation only MASP-2 ab (mAbM11) 12 20 7.0 anti-human 18 hr prior to irradiation, 2 hr MASP-2 ab post irradiation, weekly (mAbOMS646) booster 13 10 8.0 anti-human 18 hr prior to irradiation, 2 hr MASP-2 ab post irradiation, weekly (mAbOMS646) booster 14 5 8.0 Vehicle 2 hr post irradiation only 15 5 None None None
(554) Statistical Analysis.
(555) Kaplan-Meier survival curves were generated and used to compare mean survival time between treatment groups using log-Rank and Wilcoxon methods. Averages with standard deviations, or means with standard error of the mean are reported. Statistical comparisons were made using a two-tailed unpaired t-test between controlled irradiated animals and individual treatment groups.
(556) Results of Study #1
(557) Kaplan-Meier survival plots for 6.5, 7.0 and 8.0 Gy exposure groups are provided in
(558) In comparison, all treated animals at the 7.0 Gy and 8.0 Gy exposure level showed an increase in survival compared to vehicle treated irradiated control animals. The greatest change in survival occurred in animals receiving mAbOMS646, with a 45% increase in survival compared to control animals at the 7.0 Gy exposure level, and a 12% increase in survival at the 8.0 Gy exposure level. Further, at the 7.0 Gy exposure level, mortalities in the mAbOMS646 treated group first occurred at post-irradiation day 15 compared to post-irridiation day 8 for vehicle treated irradiated control animals, an increase of 7 days over control animals. Mean time to mortality for mice receiving mAbOMS646 (27.3?1.3 days) was significantly increased (p=0.0087) compared to control animals (20.7?2.0 days) at the 7.0 Gy exposure level.
(559) The percent change in body weight compared to pre-irradiation day (day ?1) was recorded throughout the study. A transient weight loss occurred in all irradiated animals, with no evidence of differential changes due to mAbM11 or mAbOMS646 treatment compared to controls (data not shown). At study termination, all surviving animals showed an increase in body weight from starting (day ?1) body weight.
(560) TABLE-US-00041 TABLE 29 Survival rates of test animals exposed to radiation Time to Death Exposure Survival (Mean ? SEM, First/Last Test Group Level (%) Day) Death (Day) Control Irradiation 6.5 Gy 65% 24.0 ? 2.0 9/16 mAbM11 pre- 6.5 Gy 85% 27.7 ? 1.5 13/17 exposure mAbM11 pre + 6.5 Gy 65% 24.0 ? 2.0 9/15 post-exposure mAbM11 post- 6.5 Gy 80% 26.3 ? 1.9 9/13 exposure mAbOMS646 6.5 Gy 65% 24.6 ? 1.9 9/19 pre + post-exposure Control irradiation 7.0 Gy 35% 20.7 ? 2.0 8/17 mAbM11 pre- 7.0 Gy 65% 23.0 ? 2.3 7/13 exposure mAbM11 pre + 7.0 Gy 55% 21.6 ? 2.2 7/16 post-exposure mAbM11 post- 7.0 Gy 70% 24.3 ? 2.1 9/14 exposure mAbOMS646 7.0 Gy 80% 27.3 ? 1.3* 15/20 pre + post-exposure mAbOMS646 8.0 Gy 32% pre + post-exposure control irradiation 8.0 Gy 20% *p = 0.0087 by two-tailed unpaired t-test between controlled irradiated animals and treatment group at the same irradiation exposure level.
(561) Discussion
(562) Acute radiation syndrome consists of three defined subsyndromes: hematopoietic, gastrointestinal, and cerebrovascular. The syndrome observed depends on the radiation dose, with the hematopoietic effects observed in humans with significant partial or whole-body radiation exposures exceeding 1 Gy. The hematopoietic syndrome is characterized by severe depression of bone-marrow function leading to pancytopenia with changes in blood counts, red and white blood cells, and platelets occurring concomitant with damage to the immune system. As nadir occurs, with few neutrophils and platelets present in peripheral blood, neutropenia, fever, complications of sepsis and uncontrollable hemorrhage lead to death.
(563) In the present study, administration of mAbH6 was found to increase survivability of whole-body x-ray irradiation in Swiss-Webster male mice irradiated at 7.0 Gy. Notably, at the 7.0 Gy exposure level, 80% of the animals receiving mAbOMS646 survived to 30 days compared to 35% of vehicle treated control irradiated animals. Importantly, the first day of death in this treated group did not occur until post-irradiation day 15, a 7-day increase over that observed in vehicle treated control irradiated animals. Curiously, at the lower X-ray exposure (6.5 Gy), administration of mAbOMS646 did not appear to impact survivability or delay in mortality compared to vehicle treated control irradiated animals. There could be multiple reasons for this difference in response between exposure levels, although verification of any hypothesis may require additional studies, including interim sample collection for microbiological culture and hematological parameters. One explanation may simply be that the number of animals assigned to groups may have precluded seeing any subtle treatment-related differences. For example, with groups sizes of n=20, the difference in survival between 65% (mAbOMS646 at 6.5 Gy exposure) and 80% (mAbH6 at 7.0 Gy exposure) is 3 animals. On the other hand, the difference between 35% (vehicle control at 7.0 Gy exposure) and 80% (mAbOMS646 at 7.0 Gy exposure) is 9 animals, and provides sound evidence of a treatment-related difference.
(564) These results demonstrate that anti-MASP-2 antibodies are effective in treating a mammalian subject at risk for, or suffering from, the detrimental effects of acute radiation syndrome.
(565) Study #2
(566) Swiss Webster mice (n=50) were exposed to ionizing radiation (8.0 Gy). The effect of anti-MASP-2 antibody therapy (OMS646 5 mg/kg), administered 18 hours before and 2 hours after radiation exposure, and weekly thereafter, on mortality was assessed.
(567) Results of Study #2
(568) It was determined that administration of anti-MASP-2 antibody OMS646 increased survival in mice exposed to 8.0 Gy, with an adjusted median survival rate from 4 to 6 days as compared to mice that received vehicle control, and a mortality reduced by 12% when compared to mice that received vehicle control (log-rank test, p=0.040).
(569) Study #3
(570) Swiss Webster mice (n=50) were exposed to ionizing radiation (8.0 Gy) in the following groups: (I: vehicle) saline control; (II: low) anti-MASP-2 antibody OMS646 (5 mg/kg) administered 18 hours before irradiation and 2 hours after irradiation, (III: high) OMS646 (10 mg/kg) administered 18 hours before irradiation and 2 hours post irradiation; and (IV: high post) OMS646 (10 mg/kg) administered 2 hours post irradiation only.
(571) Results of Study #3
(572) It was determined that administration of anti-MASP-2 antibody pre- and post-irradiation adjusted the mean survival from 4 to 5 days in comparison to animals that received vehicle control. Mortality in the anti-MASP-2 antibody-treated mice was reduced by 6-12% in comparison to vehicle control mice. It was further noted that no significant detrimental treatment effects were observed.
(573) In summary, the results in this Example demonstrate that anti-MASP-2 antibodies of the invention are effective in treating a mammalian subject at risk for, or suffering from the detrimental effects of acute radiation syndrome.
Example 12
(574) This Example describes further characterization of the OMS646 antibody (17D20m_d3521N11), fully human anti-human MASP-2 IgG4 antibody with a mutation in the hinge region).
(575) Methods:
(576) OMS646 (17D20m_d3521N11), fully human anti-human MASP-2 IgG4 antibody with a mutation in the hinge region) was generated as described above in Examples 2-8. OMS646 antibody was purified from culture supernatants of a CHO expression cell line stably transfected with expression constructs encoding the heavy and light chains of OMS646. Cells were grown in PF-CHO media for 16 to 20 days and cell free supernatant was collected when cell viability dropped below 50%. OMS646 was purified by Protein A affinity chromatograph followed by ion exchange, concentration and buffer exchange into PBS.
(577) 1. OMS646 Binds to Human MASP-2 with High Affinity
(578) Surface Plasmon Resonance (Biocore) Analysis of Immobilized OMS646 Binding to Recombinant Human MASP-2
(579) Methods:
(580) OMS646 was immobilized at various densities by amine coupling to a CM5 chip and the association and disassociation of recombinant human MASP-2 dissolved at 9 nM, 3 nM, 1 nM or 0.3 nM was recorded over time to determine the association (K.sub.on) and dissociation (K.sub.off) rate constants. The equilibrium binding constant (K.sub.D) was calculated based on experimental K.sub.on and K.sub.off values.
(581) Results:
(582)
(583) ELISA Assay of OMS646 Binding to Immobilized Recombinant Human MASP-2
(584) Methods:
(585) An ELISA assay was carried out to assess the dose-response of OMS646 binding to immobilized recombinant MASP-2. Recombinant human MASP-2 (50 ng/well) was immobilized on maxisorp ELISA plates (Nunc) in PBS overnight at 4? C. The next day, the plates were blocked by washing three times with PBS-Tween (0.05%). A serial dilution series of OMS646 in blocking buffer (concentration range from 0.001 to 10 nM) was then added to the MASP-2 coated wells. After a 1 hour incubation to allow OMS646 binding to immobilized antigen, the wells were washed to remove unbound OMS646. Bound OMS646 was detected using HRP-labeled goat anti-human IgG antibody (Qualex; diluted 1:5000 in blocking buffer) followed by development with TMB peroxidase substrate (Kirkegaard & Perry Laboratories). The peroxidase reaction was stopped by adding 100 ?l/well of 1.0 M H.sub.3PO.sub.4, and substrate conversion was quantified photometrically at 450 nM using a 96 well plate reader (Spectramax). A single binding site curve fitting algorithm (Graphpad) was used to calculate K.sub.D values.
(586) Results:
(587)
(588) 2. OMS646 Inhibits C4 Activation on a Mannan-Coated Surface, but not on an Immune Complex-Coated Surface
(589) Methods:
(590) C4 activation was measured on a mannan-coated surface or an immune complex-coated surface in the presence or absence of OMS646 over the concentration range shown in
(591) In the following method to measure the C4 cleavage activity of MASP-2, plastic wells coated with mannan were incubated for 60 minutes at 37? C. with 1% human serum to activate the lectin pathway. The wells were then washed and assayed for human C4b immobilized onto the wells using standard ELISA methods. The amount of C4b generated in this assay is a measure of MASP-2 dependent C4 cleavage activity. Anti-MASP-2 antibodies at selected concentrations were tested in this assay for their ability to inhibit C4 cleavage.
(592) Methods:
(593) C4 Activation on Mannan-Coated Surfaces:
(594) In order to determine the effect of OMS646 on the lectin-pathway, 96-well Costar Medium Binding plates were coated with mannan by overnight incubation at 5? C. with 50 ?L of a 40 ?g/mL solution of mannan diluted in 50 mM carbonate buffer, pH 9.5. Each well was washed 3? with 200 ?L PBS. The wells were then blocked with 100 ?L/well of 1% bovine serum albumin in PBS and incubated for one hour at room temperature with gentle mixing. Each well was washed 3? with 200 ?L of PBS. In a separate 96 well plate, serial dilutions of MASP-2 antibody (OMS646) were preincubated with 1% human serum in Ca.sup.++ and Mg.sup.++ containing GVB buffer (4.0 mM barbital, 141 mM NaCl, 1.0 mM MgCl.sub.2, 2.0 mM CaCl.sub.2, 0.1% gelatin, pH 7.4) for 1 hour at 5? C. These antibody-serum preincubation mixtures were subsequently transferred into the corresponding wells of the mannan-coated assay plate. Complement activation was initiated by transfer of the assay plate to a 37? C. water bath. Following a 60 minute incubation, the reaction was stopped by adding EDTA to the reaction mixture. Each well was washed 5?200 ?L with PBS-Tween 20 (0.05% Tween 20 in PBS), then each well was washed with 2? with 200 ?L PBS. 100 ?L/well of 1:100 dilution of biotin-conjugated chicken anti-human C4c (Immunsystem AB, Uppsala, Sweden) was added in PBS containing 2.0 mg/ml bovine serum albumin (BSA) and incubated one hour at room temperature with gentle mixing. Each well was washed 5?200 ?L PBS. 100 ?L/well of 0.1 ?g/ml of peroxidase-conjugated streptavidin (Pierce Chemical #21126) was added in PBS containing 2.0 mg/ml BSA and incubated for one hour at room temperature on a shaker with gentle mixing. Each well was washed 5?200 ?L with PBS. 100 ?L/well of the peroxidase substrate TMB (Kirkegaard & Perry Laboratories) was added and incubated at room temperature for 10 minutes. The peroxidase reaction was stopped by adding 100 ?L/well of 1.0 M H.sub.3PO.sub.4 and the OD.sub.450 was measured.
(595) C4 Activation on Immune-Complex Coated Surfaces
(596) In order to measure the effect of OMS646 on the classical pathway, the assay described above was modified to use immune-complex coated plates. The assay was carried out as detailed for the lectin pathway above, with the difference that wells were coated with purified sheep IgG used to stimulate C4 activation via the classical pathway.
(597) Results:
(598)
(599) 3. OMS646 Specifically Blocks Lectin-Dependent Activation of Terminal Complement Components
(600) Methods:
(601) The effect of OMS646 on membrane attack complex (MAC) deposition was analyzed using pathway-specific conditions for the lectin pathway, the classical pathway and the alternative pathway. For this purpose, the Wieslab Comp300 complement screening kit (Wieslab, Lund, Sweden) was used following the manufacturer's instructions.
(602) Results:
(603)
(604) As shown in
(605) 4. OMS646 Effectively Inhibits Lectin Pathway Activation Under Physiologic Conditions
(606) Methods:
(607) The lectin dependent C3 and C4 activation was assessed in 90% human serum in the absence and in the presence of various concentrations of OMS646 as follows:
(608) C4 Activation Assay
(609) To assess the effect of OMS646 on lectin-dependent C4 activation, 96-well Costar medium binding plates were coated overnight at 5? C. with 2 ?g of mannan (50 ?l of a 40 ?g/mL solution in 50 mM carbonate buffer, pH 9.5. Plates were then washed three times with 200 ?l PBS and blocked with 100 ?L/well of 1% bovine serum albumin in PBS for one hour at room temperature with gentle mixing. In a separate preincubation plate, select concentrations of OMS646 were mixed with 90% human serum and incubated for 1 hour on ice. These antibody-serum preincubation mixtures were then transferred into the mannan-coated wells of the assay plates on ice. The assay plates were then incubated for 90 minutes in an ice water bath to allow complement activation. The reaction was stopped by adding EDTA to the reaction mixture. Each well was washed 5 times with 200 ?L of PBS-Tween 20 (0.05% Tween 20 in PBS), then each well was washed two times with 200 ?L PBS. 100 ?L/well of 1:1000 dilution of biotin-conjugated chicken anti-human C4c (Immunsystem AB, Uppsala, Sweden) was added in PBS containing 2.0 mg/ml bovine serum albumin (BSA) and incubated 1 hour at room temperature with gentle mixing. Each well was washed 5 times with 200 ?L PBS. 100 ?L/well of 0.1 ?g/mL of peroxidase-conjugated streptavidin (Pierce Chemical #21126) was added in PBS containing 2.0 mg/ml BSA and incubated for 1 hour at room temperature on a shaker with gentle mixing. Each well was washed five times with 200 ?L PBS. 100 ?L/well of the peroxidase substrate TMB (Kirdegaard & Perry Laboratories) was added and incubated at room temperature for 16 minutes. The peroxidase reaction was stopped by adding 100 ?L/well of 1.0M H.sub.3PO.sub.4 and the OD.sub.450 was measured.
(610) C3 Activation Assay
(611) To assess the effect of OMS646 on lectin-dependent C3 activation, assays were carried out in an identical manner to the C4 activation assay described above, except that C3 deposition was assessed as the endpoint. C3 deposition was quantified as follows. At the end of the complement deposition reaction, plates were washed as described above and subsequently incubated for 1 hour with 100 ?L/well of 1:5000 dilution of rabbit anti-human C3c antibody (Dako) in PBS containing 2.0 mg/mL bovine serum albumin (BSA). Each plate was washed five times with 200 ?L PBS, and then incubated for 1 hour at room temperature with 100 ?L/well of HRP-labeled goat anti-rabbit IgG (American Qualex Antibodies) in PBS containing 2.0 mg/mL BSA. Plates were washed five times with 200 ?L PBS and then 100 ?L/well of the peroxidase substrate TMB (Kirkegaard & Perry Laboratories) was added and incubated at room temperature for 10 minutes. The peroxidase reaction was stopped by adding 100 ?L/well of 1.0M H.sub.3PO.sub.4 and the OD.sub.450 was measured. IC.sub.50 values were derived by applying a sigmoidal dose-response curve fitting algorithm (GraphPad) to the experimental data sets.
(612) Results:
(613)
(614) These results demonstrate that OMS646 provides potent, effective blockade of lectin pathway activation under physiological conditions, thereby providing support for the use of low therapeutic doses of OMS646. Based on these data, it is expected that OMS646 will block >90% of the lectin pathway in the circulation of a patient at a plasma concentration of 20 nM (3 ?g/mL) or less. Based on a plasma volume of a typical human of approximately 3 L, and the knowledge that the bulk of antibody material administered is retained in plasma (Lin Y. S. et al., JPET 288:371 (1999)), it is expected that a dose of OMS646 as low as 10 mg administered intravenously will be effective at blocking the lectin pathway during an acute time period (i.e., a transient time period, such as from 1 to 3 days). In the context of a chronic illness, it may be advantageous to block the lectin pathway for an extended period of time to achieve maximal treatment benefit. Thus, for such chronic conditions, an OMS646 dose of 100 mg may be preferred, which is expected to be effective at blocking the lectin pathway in an adult human subject for at least one week or longer. Given the slow clearance and long half-life that is commonly observed for antibodies in humans, it is possible that a 100 mg dose of OMS646 may be effective for longer than one week, such as for 2 weeks, or even 4 weeks. It is expected that a higher dose of antibody (i.e., greater than 100 mg, such as 200 mg, 500 mg or greater, such as 700 mg or 1000 mg), with have a longer duration of action (e.g., greater than 2 weeks).
(615) 5. OMS646 Blocks Lectin Pathway Activation in Monkeys
(616) As described above in Example 10 and shown in
(617) This Example describes a follow up study in which lectin dependent C4 activation was assessed in 90% African Green monkey serum or in 90% Cynomoglus monkey serum over a range of concentrations of OMS646 and in the absence of OMS646, as follows:
(618) To assess the effect of OMS646 on lectin-dependent C4 activation in different non-human primate species, 96-well Costar medium binding plates were coated overnight at 5? C. with 2 ?g of mannan (50 ?l of a 40 ?g/mL solution in 50 mM carbonate buffer, pH 9.5). Plates were then washed three times with 200 ?L PBS and blocked with 100 ?L/well of 1% bovine serum albumin in PBS for 1 hour at room temperature with gentle mixing. In a separate preincubation plate, select concentrations of OMS646 were mixed with 90% serum collected from African Green Monkeys or Cynomoglus Monkeys, and incubated with 1 hour on ice. These antibody-serum preincubation mixtures were then transferred into the mannan-coated wells of the assay plates on ice. The assay plates were then incubated for 90 minutes in an ice water bath to allow complement activation. The reaction was stopped by adding EDTA to the reaction mixture. Each well was washed five times with 200 ?L PBS-Tween 20 (0.05% Tween 20 in PBS), then each well was washed two times with 200 ?L PBS. 100 ?L/well of 1:1000 dilution of biotin-conjugated chicken anti-human C4c (Immunosystem AB, Uppsala, Sweden) was added in PBS containing 2.0 mg/mL BSA and incubated one hour at room temperature with gentle mixing. Each well was washed five times with 200 ?L PBS. 100 ?L/well of 0.1 ?g/mL of peroxidase-conjugated streptavidin (Pierce Chemical #21126) was added in PBS containing 2.0 mg/mL BSA and incubated for one hour at room temperature on a shaker with gentle mixing. Each well was washed five times with 200 ?L PBS. 100 ?L/well of the peroxidase substrate TMB (Kirkegaard & Perry Laboratories) was added and incubated at room temperature for 10 minutes. The peroxidase reaction was stopped by adding 100 ?L/well of 1.0 M H.sub.3PO.sub.4 and the OD.sub.450 was measured. IC.sub.50 values were derived by applying a sigmoidal dose-response curve fitting algorithm (GraphPad) to the experimental data sets.
(619) Results:
(620) A dose response of lectin pathway inhibition in 90% Cynomoglus monkey serum (
(621) In summary, OMS646, a fully human anti-human MASP-2 IgG4 antibody (with a mutation in the hinge region) was observed to have the following advantageous properties: high affinity binding to human MASP-2 (K.sub.D in the range of 50 to 250 pM, with a K.sub.off rate in the range of 1-3?10.sup.?4 S.sup.?1 and a K.sub.on rate in the range of 1.6-3?10.sup.6M.sup.?1S.sup.?1; functional potency in human serum with inhibition of C4 deposition with an IC.sub.50 of 0.52?0.28 nM (n=10) in 1% human serum; and an IC.sub.50 of 3?1.5 nM in 90% serum); and cross-reactivity in monkey showing inhibition of C4 deposition with an IC.sub.50 in the range of 15 to 50 nM (90% monkey serum).
(622) As described above, doses as low as 10 mg OMS646 (corresponding to 0.15 mg/kg for an average human) are expected to be effective at acutely blocking the lectin pathway in human circulation (e.g., for a period of at least 1 to 3 days), while doses of 100 mg OMS646 (corresponding to 1.5 mg/kg for an average human) are expected to block the lectin pathway in the circulation of a patient for at least one week or longer. Larger doses of OMS646 (e.g., doses greater than 100 mg, such as at least 200 mg, at least 300 mg, at least 400 mg, at least 500 mg, or greater), and preferably subcutaneous (sc) or intramuscular (im) routes of administration can be employed to further extend the time window of effective lectin pathway ablation to two weeks and preferably four weeks.
(623) For example, as shown in the experimental data herein, in primates a dose of 1 mg/kg OMS646 resulted in inhibition of the lectin pathway for 1 day, and a 3 mg/kg dose of OMS646 resulted in inhibition of the lectin pathway for about 3 days (72 hours). It is therefore estimated that a larger dosage of 7 to 10 mg/kg would be effective to inhibit the lectin pathway for a time period of about 7 days. As shown herein, the OMS646 has a 5-10 fold greater potency against human MASP-2 as compared to monkey MASP-2. Assuming comparable pharmacokinetics, the expected dosages ranges to achieve effective lectin pathway ablation in humans is shown in TABLE 30 below.
(624) TABLE-US-00042 TABLE 30 OMS646 dosing to inhibit the lectin pathway in vivo 1 Day 3 day 7 day Monkey 1 mg/kg 3 mg/kg 10 mg/kg Human 0.1 to 0.2 mg/kg 0.3 to 0.6 mg/kg 1-2 mg/kg (estimate)
(625) While the preferred embodiment of the invention has been illustrated and described, it will be appreciated that various changes can be made therein without departing from the spirit and scope of the invention.