METHOD FOR THE SELECTION OF ANTIBODIES AGAINST BCMA

20180222991 ยท 2018-08-09

    Inventors

    Cpc classification

    International classification

    Abstract

    An antibody specifically binding to human BCMA, characterized in that the binding of said antibody is not reduced by APRIL and not reduced by BAFF, said antibody does not alter APRIL-dependent NF-B activation, BAFF-dependent NF-B activation, and does not alter NF-B activation without BAFF and APRIL is useful as a therapeutic agent.

    Claims

    1.-21. (canceled)

    22. A bispecific antibody specifically binding to human B cell maturation factor (BCMA) and CD3, comprising variable heavy and light chains of anti-CD3E antibody SP34, wherein said bispecific antibody further comprises variable heavy and light chains of an antibody specifically binding to BCMA wherein variable domain VH comprises the amino acid sequence of SEQ ID NO:59 and variable domain VL comprises the amino acid sequence of SEQ ID NO:89.

    23. A bispecific antibody according to claim 22 wherein the bispecific antibody binds BCMA extracellular domain with a dissociation constant (Kd) of 10.sup.8 M or less.

    24. A bispecific antibody according to claim 22 wherein the bispecific antibody binds specifically to cynomolgus BCMA.

    25. A bispecific antibody according to claim 22 wherein the bispecific antibody comprises an Fc portion and is administered subcutaneously once or twice a week in the dose range of 1 to 100 mg/m.sup.2/week.

    26. A bispecific antibody according to claim 22 wherein the bispecific antibody comprises an Fc portion and is administered subcutaneously once or twice a week in the dose range of 0.25 to 25 mg/m.sup.2/week.

    27. A pharmaceutical composition comprising an antibody according to claim 22 and a pharmaceutically acceptable excipient.

    Description

    DESCRIPTION OF THE FIGURES

    [0107] FIG. 1. Superior binding properties of a non-ligand blocking/non-competing anti-BCMA antibody vs. a ligand-blocking/competing anti-BCMA antibody; or a non-ligand blocking/non-competing anti-BCMA containing TCB vs. a ligand-blocking/competing anti-BCMA containing TCB on plate-bound-BCMA cells by ELISA. In this graph, increasing concentrations (i.e. 10, 100, 1000 ng/mL) of soluble APRIL or BAFF representative of the levels found in the blood and bone marrow of multiple myeloma patients does not alter the binding of a non-ligand blocking/non-competing anti-BCMA antibody or non-ligand blocking/non-competing anti-BCMA containing TCB to plate-bound-BCMA (continuous line). In contrast, the high concentrations (i.e. 100 ng/mL to 1000 ng/mL) of soluble APRIL or BAFF representative of the levels found in the blood and bone marrow of multiple myeloma patients reduce the binding of a ligand blocking/competing anti-BCMA antibody or ligand blocking/competing anti-BCMA containing TCB to plate-bound-BCMA (dotted line). The concentration of anti-BCMA antibodies or anti-BCMA containing TCB with different properties is preferably concentration(s) ranging from 0.1 pM to 200 nM as the levels of add-on circulating APRIL or BAFF range from 1 ng/mL (healthy normal) to 100 ng/mL (MM, blood) and beyond (MM, tumor in bone marrow).

    [0108] FIG. 2. Superior potency in redirected T cell cytotoxicity of BCMA-expressing MM cells mediated by a T cell bispecific antibody containing a non-ligand blocking/non-competing anti-BCMA antibody vs. a ligand-blocking/competing anti-BCMA antibody in a LDH release assay. In this graph, increasing concentrations (i.e. 10, 100, 1000 ng/mL) of soluble APRIL or BAFF representative of the levels found in the blood and bone marrow of multiple myeloma patients does not alter the killing potency of a T cell bispecific antibody containing a non-ligand blocking/non-competing anti-BCMA antibody specific to BCMA-expressing MM cells (continuous line). In contrast, the high concentrations (i.e. 100 ng/mL to 1000 ng/mL) of soluble APRIL or BAFF representative of the levels found in the blood and bone marrow of multiple myeloma patients decrease the killing potency of a T cell bispecific antibody containing a ligand blocking/competing anti-BCMA antibody specific to BCMA-expressing MM cells (dotted line). The concentration of T cell bispecifics with anti-BCMA antibody with different properties is preferably concentration(s) ranging from 0.1 pM to 200 nM as the levels of add-on circulating APRIL or BAFF range from 1 ng/mL (healthy normal) to 100 ng/mL (MM, blood) and beyond (MM, tumor in bone marrow).

    [0109] FIG. 3. BCMA expression on multiple myeloma cell lines. Increase of median fluorescence intensity upon binding of increasing concentrations of the anti-BCMA antibody (from 0.3 to 10 g/mL) to H929 cells as detected by flow cytometry.

    [0110] FIG. 4. Binding of anti-BCMA antibodies on BCMA-positive multiple myeloma cells. Mean fluorescence intensity for anti-BCMA IgG clones plotted in function of anti-BCMA antibody concentrations (from 0.2 to 40 g/mL); (A) clones 13C2, 17A5, 83A10 on H929 cells, (B) clones 13C2, 17A5, 83A10 on MKN45 cells, (C) clones 13A4, 13D2, 14E1, 13A7, 14B11 on H929 cells (D) clones 13A4, 13D2, 14E1, 13A7, 14B11 on MKN45 cells.

    [0111] FIG. 5. Competition ELISA. ELISA results of 7 selected anti-BCMA Fab clones (13C2, 17A5, 83A19, 13A4, 13D2, 29B 11, 13A7), at saturating concentrations of 500 or 1000 nM, binding to immobilized human BCMA in the presence of a concentration range of murine APRIL (from 1.56 to 100 nM) are shown. In case of non-competition, signals remain constant within the variability of the assay across the concentration range and signals in the presence of murine APRIL are comparable to those from the control wells where no murine APRIL was added. In case of competition a concentration dependent reduction of the signal is measured.

    [0112] FIG. 6. Binding competition by FACS. Competition of -APRIL with anti-BCMA antibodies detected by flow cytometry. Relative median fluorescence intensity of -APRIL (FITC signal) used at a concentration of 1000 ng/mL detected in function of concentrations (1, 16, and 40 g/mL) of anti-BCMA antibody clones 13A4, 13D2, 14E1, 14B11 on H929 cells. The median fluorescence intensity upon binding of -APRIL in presence of the isotype control was set to one; the other signals were normalized to it. The detection of APRIL binding to BCMA-positive H929 cells in the presence of anti-BCMA antibodies was measured via anti-HA fluorochrome-conjugated antibody.

    [0113] FIG. 7. Binding competition by FACS. Competition of anti-BCMA antibodies with -APRIL detected by flow cytometry. The relative median fluorescence intensity of anti-BCMA antibody (Alexa.Fluor 647 signal) used at a concentration of 40 g/mL for anti-BCMA antibody clones 13A4, 13C7, 13D2, 14B 11, 17A5, 83A10 on RPMI cells detected in absence or presence of -APRIL 1000 ng/mL. The median fluorescence intensity upon binding of anti-BCMA antibodies in absence of -APRIL was set to one; the other signals respective to the anti-BCMA antibody in presence of -APRIL were normalized to it. The detection of anti-BCMA antibodies binding to BCMA-positive RPMI cells in the presence of A-APRIL was measured via anti-human Fc fluorochrome-conjugated antibody.

    [0114] FIG. 8. Competition of anti-BCMA antibodies with -APRIL after simultaneous incubation detected by flow cytometry. (A) The mean fluorescence intensity and the relative fluorescence signal (Alexa.Fluor 647 signal) of the anti-BCMA antibody clones 14B11, 13D2, 13A4, 17A5 and 83A10 at the concentration of 20 g/mL in presence or absence of 2.5 g/mL -APRIL or (B) the mean fluorescence intensity and the relative fluorescence signal of -APRIL (FITC signal) at a concentration of 2.5 g/mL -APRIL and the anti-BCMA antibody clone 83A10 (20 g/mL) (Alexa.Fluor 647 signal) were measured. Detection of anti-BCMA antibody in presence of -APRIL with FITC-conjugated anti-human Fc antibody was normalized to the signal of anti-BCMA antibody clone in absence -APRIL. Detection of -APRIL in presence of the anti-BCMA antibody clone with Alexa.Fluor 647-conjugated anti-HA antibody was normalized to -APRIL signal in presence of the isotype control.

    DETAILED DESCRIPTION OF THE INVENTION

    [0115] The term BCMA, the target BCMA, human BCMA as used herein relates to human B cell maturation target, also known as BCMA; TR17_HUMAN, TNFRSF17 (UniProt Q02223), which is a member of the tumor necrosis receptor superfamily that is preferentially expressed in differentiated plasma cells. The extracellular domain of BCMA consists according to UniProt of amino acids 1-54 (or 5-51). The term antibody against BCMA, anti BCMA antibody as used herein relates to an antibody specifically binding to the extracellular domain of BCMA.

    [0116] Specifically binding to BCMA refer to an antibody that is capable of binding to the target BCMA with sufficient affinity such that the antibody is useful as a therapeutic agent in targeting BCMA. In some embodiments, the extent of binding of an anti-BCMA antibody to an unrelated, non-BCMA protein is about 10-fold preferably >100-fold less than the binding of the antibody to BCMA as measured, e.g., by surface plasmon resonance (SPR) e.g. Biacore, enzyme-linked immunosorbent (ELISA) or flow cytometry (FACS). Preferably the antibody that binds to BCMA has a dissociation constant (Kd) of 10.sup.8 M or less, preferably from 10.sup.8 M to 10.sup.13 M, preferably from 10.sup.9 M to 10.sup.13 M. Preferably the anti-BCMA antibody binds to an epitope of BCMA that is conserved among BCMA from different species, preferably among human and cynomolgus. Bispecific antibody specifically binding to CD3 and BCMA refers to a respective definition for binding to both targets. An antibody specifically binding to BCMA (or BCMA and CD3) does not bind to other human antigens. Therefore in an ELISA, OD values for such unrelated targets will be equal or lower to that of the limit of detection of the specific assay, preferably >0.3 ng/mL, or equal or lower to OD values of control samples without plate-bound-BCMA or with untransfected HEK293 cells.

    [0117] The term APRIL as used herein relates to recombinant, truncated murine APRIL (amino acids 106-241; NP_076006). APRIL can be produced as described in Ryan, 2007 (Mol Cancer Ther; 6 (11): 3009-18).

    [0118] The term BAFF as used herein relates to recombinant, truncated human BAFF (UniProt Q9Y275 (TN13B_HUMAN) which can be produced as described in Gordon, 2003 (Biochemistry; 42 (20): 5977-5983). Preferably a His-tagged BAFF is used according to the invention. Preferably the His-tagged BAFF is produced by cloning a DNA fragment encoding BAFF residues 82-285 into an expression vector, creating a fusion with an N-terminal His-tag followed by a thrombin cleavage site, expressing said vector and cleaving the recovered protein with thrombin.

    [0119] Anti-BCMA antibodies are analyzed by ELISA for binding to human BCMA using plate-bound BCMA in the presence and absence of APRIL and/or BAFF. For this assay, an amount of plate-bound BCMA preferably 1.5 g/mL and concentration(s) ranging from 0.1 pM to 200 nM of anti-BCMA antibody are used. A BCMA antibody for which its BCMA binding is not inhibited according to the invention is an anti BCMA antibody not inhibiting the binding of APRIL and/or BAFF to human BCMA in an ELISA assay.

    [0120] The term NF-B as used herein relates to recombinant NF-B p50 (accession number (P19838). NF-B activity is measured by a DNA-binding ELISA of an extract of NCI-H929 MM cells (CRL-9068). NCI-H929 MM cells, untreated or treated with 0.1 g/mL TNF-, 1000 ng/mL heat-treated HT-truncated-BAFF, 1000 ng/mL truncated-BAFF, 0.1 pM to 200 nM isotype control, and with or without 0.1 pM to 200 nM anti-BCMA antibodies are incubated for 20 min. NF-B activity is assayed using a functional ELISA that detects chemiluminescent signal from p65 bound to the NF-B consensus sequence (U.S. Pat. No. 6,150,090).

    [0121] An antibody that does not block APRIL-dependent NF-B activation for more than 20% and does not reduce APRIL-dependent NF-B activation for more than 20% and does not increase APRIL-dependent NF-B activation for more than 20% is considered not to alter APRIL-dependent NF-B activation for more than 20% as compared to APRIL-induced NF-B activation without an antibody according to the invention (control group); 20% representing the mean standard variability between experiments. Preferably an antibody according to the invention does not alter APRIL-dependent NF-B activation for more than 15%.

    [0122] An antibody that does not block BAFF-dependent NF-B activation for more than 20% and does not reduce BAFF-dependent NF-B activation for more than 20% and does not increase BAFF-dependent NF-B activation for more than 20% is considered not to alter BAFF-dependent NF-B activation for more than 20% as compared to BAFF-induced NF-B activation without an antibody according to the invention (control group); 20% representing the mean standard variability between experiments. Preferably an antibody according to the invention does not alter BAFF-dependent NF-B activation for more than 15%.

    [0123] An antibody that does not block NF-B activation without APRIL and BAFF for more than 20% and does not reduce NF-B activation without APRIL and BAFF for more than 20% and does not increase NF-B activation without APRIL and BAFF for more than 20% is considered not to alter NF-B activation without APRIL and BAFF for more than 20% as compared to APRIL-induced NF-B activation without an antibody according to the invention (control group); 20% representing the mean standard variability between experiments. Preferably an antibody according to the invention does not alter NF-B activation without APRIL and BAFF for more than 15%.

    [0124] Also if an antibody according to the invention is used in large excess, preferably up to 500 nM or 1000 nM binding of said antibody is not reduced by 100 ng/ml APRIL and preferably by BAFF for more than 20% and does not alter APRIL-dependent NF-B activation for more than 20%, with and without APRIL and preferably with and without BAFF for more than 20%.

    [0125] The term further target as used herein means preferably CD3e. The term first target and second target means either CD3 as first target and BCMA as second target or means BCMA as first target and CD3 as second target.

    [0126] The term CD3 or CD3 as used herein relates to human CD3 described under UniProt P07766 (CD3E_HUMAN). The term antibody against CD3e, anti CD3 antibody relates to an antibody specifically binding to CD3. Preferably the antibody comprises a variable domain VH comprising the heavy chain CDRs of SEQ ID NO: 1, 2 and 3 as respectively heavy chain CDR1, CDR2 and CDR3 and a variable domain VL comprising the light chain CDRs of SEQ ID NO: 4, 5 and 6 as respectively light chain CDR1, CDR2 and CDR3. Preferably the antibody comprises the variable domains of SEQ ID NO:7 (VH) and SEQ ID NO:8 (VL).

    [0127] The term antibody as used herein refers to a monoclonal antibody. An antibody consists of two pairs of a light chain (LC) and a heavy chain (HC) (such light chain (LC)/heavy chain pairs are abbreviated herein as LC/HC). The light chains and heavy chains of such antibodies are polypeptides consisting of several domains. Each heavy chain comprises a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region. The heavy chain constant region comprises the heavy chain constant domains CH1, CH2 and CH3 (antibody classes IgA, IgD, and IgG) and optionally the heavy chain constant domain CH4 (antibody classes IgE and IgM). Each light chain comprises a light chain variable domain VL and a light chain constant domain CL. The variable domains VH and VL can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The constant domains of the heavy chain and of the light chain are not involved directly in binding of an antibody to a target, but exhibit various effector functions.

    [0128] The term antibody includes e.g. mouse antibodies, human antibodies, chimeric antibodies, humanized antibodies and genetically engineered antibodies (variant or mutant antibodies) as long as their characteristic properties are retained. Especially preferred are human or humanized antibodies, especially as recombinant human or humanized antibodies.

    [0129] The term bispecific antibody as used herein refers preferably to an antibody in which one of the two pairs of heavy chain and light chain (HC/LC) is specifically binding to CD3 and the other one is specifically binding to BCMA. The term also refers to other formats of bispecific antibodies according to the state of the art, preferably to bispecific single-chain antibodies.

    [0130] The term naked antibody as used herein refers to an antibody which is specifically binding to BCMA, comprising an Fc part and is not conjugated with a therapeutic agent e.g. with a cytotoxic agent or radiolabel. The term conjugated antibody, drug conjugate as used herein refers to an antibody which is specifically binding to BCMA, and is conjugated with a therapeutic agent e.g. with a cytotoxic agent or radiolabel.

    [0131] The term bispecific single-chain antibody as used herein refers to a single polypeptide chain comprising preferably two binding domains, one specifically binding to BCMA and the other one preferably specifically binding to CD3. Each binding domain comprises one variable region from an antibody heavy chain (VH region), wherein the VH region of the first binding domain specifically binds to the CD3 molecule, and the VH region of the second binding domain specifically binds to BCMA. The two binding domains are optionally linked to one another by a short polypeptide spacer. A non-limiting example for a polypeptide spacer is Gly-Gly-Gly-Gly-Ser (G-G-G-G-S) and repeats thereof. Each binding domain may additionally comprise one variable region from an antibody light chain (VL region), the VH region and VL region within each of the first and second binding domains being linked to one another via a polypeptide linker, long enough to allow the VH region and VL region of the first binding domain and the VH region and VL region of the second binding domain to pair with one another such that, together, they are able to specifically bind to the respective first and second binding domains (see e.g. EP0623679).Bispecific single-chain antibodies are also mentioned e.g. in Choi B D et al., Expert Opin Biol Ther. 2011 July; 11(7):843-53 and Wolf E. et al., Drug Discov Today. 2005 Sep. 15; 10(18):1237-44.

    [0132] The term diabody as used herein refers to a small bivalent and bispecific antibody fragment comprising a heavy (VH) chain variable domain connected to a light chain variable domain (VL) on the same polypeptide chain (VH-VL) connected by a peptide linker that is too short to allow pairing between the two domains on the same chain (Kipriyanov, Int. J. Cancer 77 (1998), 763-772). This forces pairing with the complementary domains of another chain and promotes the assembly of a dimeric molecule with two functional antigen binding sites. To construct bispecific diabodies of the invention, the V-domains of an anti-CD3 antibody and an anti-BCMA antibody are fused to create the two chains VH(CD3)-VL(BCMA), VH(BCMA)-VL(CD3). Each chain by itself is not able to bind to the respective antigen, but recreates the functional antigen binding sites of anti-CD3 antibody and anti-BCMA antibody on pairing with the other chain. The two scFv molecules, with a linker between heavy chain variable domain and light chain variable domain that is too short for intramolecular dimerization, are coexpressed and self-assemble to form bi-specific molecules with the two binding sites at opposite ends. By way of example, the variable regions encoding the binding domains for BCMA and CD3, respectively, can be amplified by PCR from DNA constructs obtained as described, such that they can be cloned into a vector like pHOG, as described in Kipiriyanov et al., J. Immunol, Methods, 200, 69-77 (1997a). The two scFV constructs are then combined in one expression vector in the desired orientation, whereby the VH-VL linker is shortened to prevent backfolding of the chains onto themselves. The DNA segments are separated by a STOP codon and a ribosome binding site (RBS). The RBS allows for the transcription of the mRNA as a bi-cistronic message, which is translated by ribosomes into two proteins which non-covalently interact to form the diabody molecule. Diabodies, like other antibody fragments, have the advantage that they can be expressed in bacteria (E. coli) and yeast (Pichia pastoris) in functional form and with high yields (up to Ig/1).

    [0133] The term tandem scFVs as used herein refers to a single chain Fv molecule (i.e. a molecule formed by association of the immunoglobulin heavy and light chain variable domains, VH and VL, respectively) as described e.g, in WO 03/025018 and WO 03/048209. Such Fv molecules, which are known as TandAbs comprise four antibody variable domains, wherein (i) either the first two or the last two of the four variable domains bind intramolecularly to one another within the same chain by forming an antigen binding scFv in the orientation VH/VL or VL/VH (ii) the other two domains bind intermolecularly with the corresponding VH or VL domains of another chain to form antigen binding VH/VL pairs. In a preferred embodiment, as suggested in WO 03/025018, the monomers of such Fv molecule comprise at least four variable domains of which two neighboring domains of one monomer form an antigen-binding VH-VL or VL-VH scFv unit.

    [0134] The term DARPins as used herein refers to a bispecific ankyrin repeat molecule as described e.g. in US 2009082274. These molecules are derived from natural ankyrin proteins, which can be found in the human genome and are one of the most abundant types of binding proteins. A DARPin library module is defined by natural ankyrin repeat protein sequences, using 229 ankyrin repeats for the initial design and another 2200 for subsequent refinement. The modules serve as building blocks for the DARPin libraries. The library modules resemble human genome sequences. A DARPin is composed of 4 to 6 modules. Because each module is approx. 3.5 kDa, the size of an average DARPin is 16-21 kDa. Selection of binders is done by ribosome display, which is completely cell-free and is described in He M and Taussig M J., Biochem Soc Trans. 2007, November; 35(Pt 5):962-5.

    [0135] The term T cell bispecific engager are fusion proteins consisting of two single-chain variable fragments (scFvs) of different antibodies, or amino acid sequences from four different genes, on a single peptide chain of about 55 kilodaltons. One of the scFvs binds to T cells via the CD3 receptor, and the other to a BCMA.

    [0136] There are five types of mammalian antibody heavy chains denoted by the Greek letters: , , , , and (Janeway C A, Jr et al (2001). Immunobiology. 5th ed., Garland Publishing). The type of heavy chain present defines the class of antibody; these chains are found in IgA, IgD, IgE, IgG, and IgM antibodies, respectively (Rhoades R A, Pflanzer R G (2002). Human Physiology, 4th ed., Thomson Learning). Distinct heavy chains differ in size and composition; and contain approximately 450 amino acids, while and r have approximately 550 amino acids.

    [0137] Each heavy chain has two regions, the constant region and the variable region. The constant region is identical in all antibodies of the same isotype, but differs in antibodies of different isotype. Heavy chains , and have a constant region composed of three constant domains CH1, CH2, and CH3 (in a line), and a hinge region for added flexibility (Woof J, Burton D Nat Rev Immunol 4 (2004) 89-99); heavy chains and r have a constant region composed of four constant domains CH1, CH2, CH3, and CH4 (Janeway C A, Jr et al (2001). Immunobiology. 5th ed., Garland Publishing). The variable region of the heavy chain differs in antibodies produced by different B cells, but is the same for all antibodies produced by a single B cell or B cell clone. The variable region of each heavy chain is approximately 110 amino acids long and is composed of a single antibody domain.

    [0138] In mammals there are only two types of light chain, which are called lambda () and kappa (). A light chain has two successive domains: one constant domain CL and one variable domain VL. The approximate length of a light chain is 211 to 217 amino acids. Preferably the light chain is a kappa () light chain, and the constant domain CL is preferably derived from a kappa (K) light chain (the constant domain CK).

    [0139] The terms monoclonal antibody or monoclonal antibody composition as used herein refer to a preparation of antibody molecules of a single amino acid composition.

    [0140] The antibodies according to the invention can be of any class (e.g. IgA, IgD, IgE, IgG, and IgM, preferably IgG or IgE), or subclass (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2, preferably IgG1), whereby both antibodies, from which the bivalent bispecific antibody according to the invention is derived, have an Fc part of the same subclass (e.g. IgG1, IgG4 and the like, preferably IgG1), preferably of the same allotype (e.g. Caucasian).

    [0141] A Fc part of an antibody is a term well known to the skilled artisan and defined on the basis of papain cleavage of antibodies. The antibodies according to the invention contain as Fc part, preferably a Fc part derived from human origin and preferably all other parts of the human constant regions. The Fc part of an antibody is directly involved in complement activation, C1q binding, C3 activation and Fc receptor binding. While the influence of an antibody on the complement system is dependent on certain conditions, binding to C1q is caused by defined binding sites in the Fc part. Such binding sites are known in the state of the art and described e.g. by Lukas, T J., et al., J. Immunol. 127 (1981) 2555-2560; Brunhouse, R., and Cebra, J. J., Mol. Immunol. 16 (1979) 907-917; Burton, D. R., et al., Nature 288 (1980) 338-344; Thommesen, J. E., et al., Mol. Immunol. 37 (2000) 995-1004; Idusogie, E. E., et al., J. Immunol. 164 (2000) 4178-4184; Hezareh, M., et al., J. Virol. 75 (2001) 12161-12168; Morgan, A., et al., Immunology 86 (1995) 319-324; and EP 0 307 434.

    [0142] Such binding sites are e.g. L234, L235, D270, N297, E318, K320, K322, P331 and P329 (numbering according to EU index of Kabat, see below). Antibodies of subclass IgG1, IgG2 and IgG3 usually show complement activation, C1q binding and C3 activation, whereas IgG4 do not activate the complement system, do not bind C1q and do not activate C3. Preferably the Fc part is a human Fc part.

    [0143] Preferably an antibody according to the invention comprises an Fc variant of a wild-type human IgG Fc region, said Fc variant comprising an amino acid substitution at position Pro329 and at least one further amino acid substitution, wherein the residues are numbered according to the EU index of Kabat, and wherein said antibody exhibits a reduced affinity to the human FcRIIIA and/or FcRIIA and/or FcRI compared to an antibody comprising the wildtype IgG Fc region, and wherein the ADCC induced by said antibody is reduced to at least 20% of the ADCC induced by the antibody comprising a wild-type human IgG Fc region. In a specific embodiment Pro329 of a wild-type human Fc region in the antibody according to the invention is substituted with glycine or arginine or an amino acid residue large enough to destroy the proline sandwich within the Fc/Fc receptor interface, that is formed between the proline329 of the Fc and tryptophane residues Trp 87 and Tip 110 of FcRIII (Sondermann et al.: Nature 406, 267-273 (20 Jul. 2000)). In a further aspect of the invention the at least one further amino acid substitution in the Fc variant is S228P, E233P, L234A, L235A, L235E, N297A, N297D, or P331S and still in another embodiment said at least one further amino acid substitution is L234A and L235A of the human IgG1 Fc region or S228P and L235E of the human IgG4 Fc region. Such Fc variants are described in detail in WO2012130831.

    [0144] By effector function as used herein is meant a biochemical event that results from the interaction of an antibody Fc region with an Fc receptor or ligand. Effector functions include but are not limited to ADCC, ADCP, and CDC. By effector cell as used herein is meant a cell of the immune system that expresses one or more Fc receptors and mediates one or more effector functions. Effector cells include but are not limited to monocytes, macrophages, neutrophils, dendritic cells, eosinophils, mast cells, platelets, B cells, large granular lymphocytes, Langerhans' cells, natural killer (NK) cells, and T cells, and may be from any organism including but not limited to humans, mice, rats, rabbits, and monkeys.

    [0145] By library herein is meant a set of Fc variants in any form, including but not limited to a list of nucleic acid or amino acid sequences, a list of nucleic acid or amino acid substitutions at variable positions, a physical library comprising nucleic acids that encode the library sequences, or a physical library comprising the Fc variant proteins, either in purified or unpurified form.

    [0146] By Fc gamma receptor or FcR as used herein is meant any member of the family of proteins that bind the IgG antibody Fc region and are substantially encoded by the FcR genes. In humans this family includes but is not limited to FcRI (CD64), including isoforms FcRIa, FcRIb, and FcRIc; FcRII (CD32), including isoforms FcRIIa (including allotypes H131 and R131), FcRIIb (including FcRIIb-1 and FcRIIb-2), and FcRIIc; and FcRIII (CD16), including isoforms FcRIIIa (including allotypes V158 and F158) and FcRIIIb (including allotypes FcRIIIb-NA1 and FcRIIIb-NA2) (Jefferis et al., 2002, Immunol Lett 82:57-65), as well as any undiscovered human FcRs or FcR isoforms or allotypes. An FcR may be from any organism, including but not limited to humans, mice, rats, rabbits, and monkeys. Mouse FcRs include but are not limited to FcRI (CD64), FcRII (CD32), FcRIII (CD16), and FcRIII-2 (CD16-2), as well as any undiscovered mouse FcRs or FcR isoforms or allotypes.

    [0147] Fc variant with increased effector function as used herein is meant an Fc sequence that differs from that of a parent Fc sequence by virtue of at least one amino acid modification or relates to other modifications like amendment of glycosylation at e.g. Asn279 that increase effector functions. Such modifications are e.g. mentioned in Duncan et al., 1988, Nature 332:563-564; Lund et al., 1991, J Immunol 147:2657-2662; Lund et al., 1992, Mol Immunol 29:53-59; Alegre et al., 1994, Transplantation 57:1537-1543; Hutchins et al., 1995, Proc Natl Acad Sci USA 92:11980-11984; Jefferis et al., 1995, //77muno/Lett 44:111-117; Lund et al., 1995, Faseb J 9:115-119; Jefferis et al., 1996, Immunol Lett 54:101-104; Lund et al., 1996, J Immunol 157:4963-4969; Armour et al., 1999, Eur J Immunol 29:2613-2624; Idusogie et al., 2000, J Immunol 164:4178-4184; Reddy et al., 2000, J Immunol 164:1925-1933; Xu et al., 2000, Cell Immunol 200: 16-26; Idusogie et al., 2001, J Immunol 166:2571-2575; Shields et al., 2001, J Biol Chem 276:6591-6604; Jefferis et al., 2002, Immunol Lett 82:57-65; Presta et al., 2002, Biochem Soc Trans 30:487-490; U.S. Pat. No. 5,624,821; U.S. Pat. No. 5,885,573; U.S. Pat. No. 6,194,551; WO200042072; WO199958572. Such Fc modifications also include according to the invention engineered glycoforms of the Fc part. By engineered glycoform as used herein is meant a carbohydrate composition that is covalently attached to an Fc polypeptide, wherein said carbohydrate composition differs chemically from that of a parent Fc polypeptide. Engineered glycoforms may be generated by any method, for example by using engineered or variant expression strains, by co-expression with one or more enzymes, for example D1-4-N-acetylglucosaminyltransferase III (GnTIII), by expressing an Fc polypeptide in various organisms or cell lines from various organisms, or by modifying carbohydrate(s) after the Fc polypeptide has been expressed. Methods for generating engineered glycoforms are known in the art and mentioned in Umana et al., 1999, Nat Biotechnol 17:176-180; Davies et al., 2001, Biotechnol Bioeng 74:288-294; Shields et al., 2002, J Biol Chem 277:26733-26740; Shinkawa et al., 2003, J Biol Chem 278:3466-3473) U.S. Pat. No. 6,602,684; WO200061739; WO200129246; WO200231140; WO200230954; Potelligent technology (Biowa, Inc., Princeton, N.J.); GlycoMAb glycosylation engineering technology (GLYCART biotechnology AG, Zurich, Switzerland)). Engineered glycoform typically refers to the different carbohydrate or oligosaccharide composition than the parent Fc polypeptide.

    [0148] Antibodies according to the invention comprising a Fc variant with increased effector function show high binding affinity to the Fc gamma receptor III (FcRIII, CD 16a). High binding affinity to FcRIII denotes that binding is enhanced for CD16a/F158 at least 10-fold in relation to the parent antibody (95% fucosylation) as reference expressed in CHO host cells, such as CHO DG44 or CHO K1 cells, or/and binding is enhanced for CD16a/V158 at least 20-fold in relation to the parent antibody measured by Surface Plasmon Resonance (SPR) using immobilized CD 16a at an antibody concentration of 100 nM. FcRIII binding can be increased by methods according to the state of the art, e.g. by modifying the amino acid sequence of the Fc part or the glycosylation of the Fc part of the antibody (see e.g. EP2235061). Mori, K et al., Cytotechnology 55 (2007)109 and Satoh M, et al., Expert Opin Biol Ther. 6 (2006) 1161-1173 relate to a FUT8 (-1,6-fucosyltransferase) gene knockout CHO line for the generation of afucosylated antibodies.

    [0149] The term chimeric antibody refers to an antibody comprising a variable region, i.e., binding region, from one source or species and at least a portion of a constant region derived from a different source or species, usually prepared by recombinant DNA techniques. Chimeric antibodies comprising a murine variable region and a human constant region are preferred. Other preferred forms of chimeric antibodies encompassed by the present invention are those in which the constant region has been modified or changed from that of the original antibody to generate the properties according to the invention, especially in regard to C1q binding and/or Fc receptor (FcR) binding. Such chimeric antibodies are also referred to as class-switched antibodies. Chimeric antibodies are the product of expressed immunoglobulin genes comprising DNA segments encoding immunoglobulin variable regions and DNA segments encoding immunoglobulin constant regions. Methods for producing chimeric antibodies involve conventional recombinant DNA and gene transfection techniques are well known in the art. See, e.g., Morrison, S. L., et al., Proc. Natl. Acad. Sci. USA 81 (1984) 6851-6855; U.S. Pat. Nos. 5,202,238 and 5,204,244.

    [0150] The term humanized antibody refers to antibodies in which the framework or complementarity determining regions (CDR) have been modified to comprise the CDR of an immunoglobulin of different specificity as compared to that of the parent immunoglobulin. In a preferred embodiment, a murine CDR is grafted into the framework region of a human antibody to prepare the humanized antibody. See, e.g., Riechmann, L., et al., Nature 332 (1988) 323-327; and Neuberger, M. S., et al., Nature 314 (1985) 268-270. Other forms of humanized antibodies encompassed by the present invention are those in which the constant region has been additionally modified or changed from that of the original antibody to generate the properties according to the invention, especially in regard to C1q binding and/or Fc receptor (FcR) binding.

    [0151] The term human antibody, as used herein, is intended to include antibodies having variable and constant regions derived from human germ line immunoglobulin sequences. Human antibodies are well-known in the state of the art (van Dijk, M. A., and van de Winkel, J. G., Curr. Opin. Chem. Biol. 5 (2001) 368-374). Human antibodies can also be produced in transgenic animals (e.g., mice) that are capable, upon immunization, of producing a full repertoire or a selection of human antibodies in the absence of endogenous immunoglobulin production. Transfer of the human germ-line immunoglobulin gene array in such germ-line mutant mice will result in the production of human antibodies (see, e.g., Jakobovits, A., et al., Proc. Natl. Acad. Sci. USA 90 (1993) 2551-2555; Jakobovits, A., et al., Nature 362 (1993) 255-258; Bruggemann, M., et al., Year Immunol. 7 (1993) 33-40). Human antibodies can also be produced in phage display libraries (Hoogenboom, H. R., and Winter, G., J. Mol. Biol. 227 (1992) 381-388; Marks, J. D., et al., J. Mol. Biol. 222 (1991) 581-597). The techniques of Cole et al. and Boerner et al. are also available for the preparation of human monoclonal antibodies (Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); and Boerner, P., et al., J. Immunol. 147 (1991) 86-95). As already mentioned for chimeric and humanized antibodies according to the invention the term human antibody as used herein also comprises such antibodies which are modified in the constant region to generate the properties according to the invention, especially in regard to C1q binding and/or FcR binding, e.g. by class switching i.e. change or mutation of Fc parts (e.g. from IgG1 to IgG4 and/or IgG1/IgG4 mutation.)

    [0152] The term recombinant human antibody, as used herein, is intended to include all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies isolated from a host cell such as a NSO or CHO cell or from an animal (e.g. a mouse) that is transgenic for human immunoglobulin genes or antibodies expressed using a recombinant expression vector transfected into a host cell. Such recombinant human antibodies have variable and constant regions in a rearranged form. The recombinant human antibodies according to the invention have been subjected to in vivo somatic hypermutation. Thus, the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germ line VH and VL sequences, may not naturally exist within the human antibody germ line repertoire in vivo.

    [0153] The variable domain (variable domain of a light chain (VL), variable region of a heavy chain (VH)) as used herein denotes each of the pair of light and heavy chains which is involved directly in binding the antibody according to the invention. The domains of variable human light and heavy chains have the same general structure and each domain comprises four framework (FR) regions whose sequences are widely conserved, connected by three hypervariable regions (or complementarity determining regions, CDRs). The framework regions adopt a P3-sheet conformation and the CDRs may form loops connecting the P3-sheet structure. The CDRs in each chain are held in their three-dimensional structure by the framework regions and form together with the CDRs from the other chain the binding site. The antibody heavy and light chain CDR3 regions play a particularly important role in the binding specificity/affinity of the antibodies according to the invention and therefore provide a further object of the invention.

    [0154] The terms hypervariable region or target-binding portion of an antibody when used herein refer to the amino acid residues of an antibody which are responsible for target-binding. The hypervariable region comprises amino acid residues from the complementarity determining regions or CDRs. Framework or FR regions are those variable domain regions other than the hypervariable region residues as herein defined. Therefore, the light and heavy chains of an antibody comprise from N- to C-terminus the domains FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4. CDRs on each chain are separated by such framework amino acids. Especially, CDR3 of the heavy chain is the region which contributes most to target binding. CDR and FR regions are determined according to the standard definition of Kabat et al., Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, National Institutes of Health, Bethesda, Md. (1991).

    [0155] The constant heavy chain domain CH1 by which the heavy chain domain CH3 is replaced can be of any Ig class (e.g. IgA, IgD, IgE, IgG, and IgM), or subclass (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2).

    [0156] The constant light chain domain CL by which the heavy chain domain CH3 is replaced can be of the lambda () or kappa () type, preferably the kappa () type.

    [0157] The term target or target molecule as used herein are used interchangeable and refer to human BCMA. In regard to bispecific antibodies the term refers to BCMA and the second target. Preferably in regard to bispecific antibodies the term refers to BCMA and CD3.

    [0158] The term epitope includes any polypeptide determinant capable of specific binding to an antibody. In certain embodiments, epitope determinant include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl, or sulfonyl, and, in certain embodiments, may have specific three dimensional structural characteristics, and or specific charge characteristics. An epitope is a region of a target that is bound by an antibody.

    [0159] In general there are two vectors encoding the light chain and heavy chain of an antibody according to the invention. In regard to a bispecific antibody there are two vectors encoding the light chain and heavy chain of said antibody specifically binding to the first target, and further two vectors encoding the light chain and heavy chain of said antibody specifically binding to the second target. One of the two vectors is encoding the respective light chain and the other of the two vectors is encoding the respective heavy chain. However in an alternative method for the preparation of an antibody according to the invention, only one first vector encoding the light chain and heavy chain of the antibody specifically binding to the first target and only one second vector encoding the light chain and heavy chain of the antibody specifically binding to the second target can be used for transforming the host cell.

    [0160] The term nucleic acid or nucleic acid molecule, as used herein, is intended to include DNA molecules and RNA molecules. A nucleic acid molecule may be single-stranded or double-stranded, but preferably is double-stranded DNA.

    [0161] As used herein, the expressions cell, cell line, and cell culture are used interchangeably and all such designations include progeny. Thus, the words transformants and transformed cells include the primary subject cell and cultures derived therefrom without regard for the number of transfers. It is also understood that all progeny may not be precisely identical in DNA content, due to deliberate or inadvertent mutations. Variant progeny that have the same function or biological activity as screened for in the originally transformed cell are included. Where distinct designations are intended, it will be clear from the context.

    [0162] The term transformation as used herein refers to process of transfer of a vectors/nucleic acid into a host cell. If cells without formidable cell wall barriers are used as host cells, transfection is carried out e.g. by the calcium phosphate precipitation method as described by Graham and Van der Eh, Virology 52 (1978) 546ff. However, other methods for introducing DNA into cells such as by nuclear injection or by protoplast fusion may also be used. If prokaryotic cells or cells which contain substantial cell wall constructions are used, e.g. one method of transfection is calcium treatment using calcium chloride as described by Cohen S N, et al, PNAS 1972, 69 (8): 2110-2114.

    [0163] Recombinant production of antibodies using transformation is well-known in the state of the art and described, for example, in the review articles of Makrides, S. C, Protein Expr. Purif. 17 (1999) 183-202; Geisse, S., et al., Protein Expr. Purif. 8 (1996) 271-282; Kaufman, R J., Mol. Biotechnol. 16 (2000) 151-161; Werner, R. G., et al., Arzneimittelforschung 48 (1998) 870-880 as well as in U.S. Pat. No. 6,331,415 and U.S. Pat. No. 4,816,567.

    [0164] As used herein, expression refers to the process by which a nucleic acid is transcribed into mRNA and/or to the process by which the transcribed mRNA (also referred to as transcript) is subsequently being translated into peptides, polypeptides, or proteins. The transcripts and the encoded polypeptides are collectively referred to as gene product. If the polynucleotide is derived from genomic DNA, expression in a eukaryotic cell may include splicing of the mRNA.

    [0165] A vector is a nucleic acid molecule, in particular self-replicating, which transfers an inserted nucleic acid molecule into and/or between host cells. The term includes vectors that function primarily for insertion of DNA or RNA into a cell (e.g., chromosomal integration), replication of vectors that function primarily for the replication of DNA or RNA, and expression vectors that function for transcription and/or translation of the DNA or RNA. Also included are vectors that provide more than one of the functions as described.

    [0166] An expression vector is a polynucleotide which, when introduced into an appropriate host cell, can be transcribed and translated into a polypeptide. An expression system usually refers to a suitable host cell comprised of an expression vector that can function to yield a desired expression product.

    [0167] The antibodies according to the invention are preferably produced by recombinant means. Such methods are widely known in the state of the art and comprise protein expression in prokaryotic and eukaryotic cells with subsequent isolation of the antibody polypeptide and usually purification to a pharmaceutically acceptable purity. For the protein expression, nucleic acids encoding light and heavy chains or fragments thereof are inserted into expression vectors by standard methods. Expression is performed in appropriate prokaryotic or eukaryotic host cells like CHO cells, NSO cells, SP2/0 cells, HEK293 cells, COS cells, yeast, or E. coli cells, and the antibody is recovered from the cells (supernatant or cells after lysis).The bispecific antibodies may be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form. Purification is performed in order to eliminate other cellular components or other contaminants, e.g. other cellular nucleic acids or proteins, by standard techniques, including alkaline/SDS treatment, column chromatography and others well known in the art. See Ausubel, F., et al., ed., Current Protocols in Molecular Biology, Greene Publishing and Wiley Interscience, New York (1987).

    [0168] Expression in NSO cells is described by, e.g., Barnes, L. M., et al., Cytotechnology 32 (2000) 109-123; and Barnes, L. M., et al., Biotech. Bioeng. 73 (2001) 261-270. Transient expression is described by, e.g., Durocher, Y., et al., Nucl. Acids. Res. 30 (2002) E9. Cloning of variable domains is described by Orlandi, R., et al., Proc. Natl. Acad. Sci. USA 86 (1989) 3833-3837; Carter, P., et al., Proc. Natl. Acad. Sci. USA 89 (1992) 4285-4289; and Norderhaug, L., et al., J. Immunol. Methods 204 (1997) 77-87. A preferred transient expression system (HEK293) is described by Schlaeger, E.-J., and Christensen, K., in Cytotechnology 30 (1999) 71-83 and by Schlaeger, E.-J., in J. Immunol. Methods 194 (1996) 191-199.

    [0169] The control sequences that are suitable for prokaryotes, for example, include a promoter, optionally an operator sequence, and a ribosome binding site. Eukaryotic cells are known to utilize promoters, enhancers and polyadenylation signals.

    [0170] The antibodies are suitably separated from the culture medium by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography. DNA or RNA encoding the monoclonal antibodies is readily isolated and sequenced using conventional procedures. The hybridoma cells can serve as a source of such DNA and RNA. Once isolated, the DNA may be inserted into expression vectors, which are then transfected into host cells such as HEK293 cells, CHO cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of recombinant monoclonal antibodies in the host cells.

    [0171] Amino acid sequence variants (or mutants) of an antibody according to the invention are prepared by introducing appropriate nucleotide changes into the antibody DNA, or by nucleotide synthesis. Such modifications can be performed, however, only in a very limited range, e.g. as described above. For example, the modifications do not alter the above mentioned antibody characteristics such as the IgG isotype and target binding, but may improve the yield of the recombinant production, protein stability or facilitate the purification.

    [0172] T cell bispecific (TCB) binders have very high concentration/tumor-cell-receptor-occupancy dependent potency in cell killing (e.g. EC.sub.50 in in vitro cell killing assays in the sub- or low picomolar range; Dreier et al. Int J Cancer 2002), T-cell bispecific binder (TCB) are given at much lower doses than conventional monospecific antibodies. For example, blinatumomab (CD19CD3) is given at a continuous intravenous dose of 5 to 15 g/m.sup.2/day (i.e. only 0.35 to 0.105 mg/m.sup.2/week) for treatment of acute lymphocytic leukemia or 60 g/m.sup.2/day for treatment of Non Hodgkin Lymphoma, and the serum concentrations at these doses are in the range of 0.5 to 4 ng/ml (Klinger et al., Blood 2012; Topp et al., J Clin Oncol 2011; Goebeler et al. Ann Oncol 2011). Because low doses of TCB can exert high efficacy in patients, it is envisaged that for an antibody according to the invention subcutaneous administration is possible and preferred in the clinical settings (preferably in the dose range of 0.25 to 2.5 mg/m.sup.2/week). Even at these low concentrations/doses/receptor occupancies, TCB can cause considerable adverse events (Klinger et al., Blood 2012). Therefore it is critical to control tumor cell occupancy/coverage. In patients with high and variable levels of serum APRIL and BAFF (e.g. multiple myeloma patients, Moreaux et al. 2004; Blood 103(8): 3148-3157) number of TCB bound to the tumor cells resp. tumor cell occupancy may be considerably influenced by APRIL/BAFF. But by using said antibody of this invention, tumor cell occupancy respectively efficacy/safety it may not be required to increase the dose for an antibody according to this invention as said antibody may not be affected by APRIL/BAFF ligand competition. Another advantage of the antibody according to the invention is based on the inclusion of an Fc portion, which increases the elimination half-life to 12 days and allows at least once or twice/week administrations as compared to TCBs without an Fc portion (e.g. blinatumomab) which are required to be given intravenously and continuously with a pump carried by patients.

    TABLE-US-00001 TABLE 1 BCMA SEQ ID NO: antibody VH VL CDR1H CDR2H CDR3H CDR1L CDR2L CDR3L 13C2 17 27 37 47 57 67 77 87 17A5 18 28 38 48 58 68 78 88 83A10 19 29 39 49 59 69 79 89 13A4 20 30 40 50 60 70 80 90 13D2 21 31 41 51 61 71 81 91 14B11 22 32 42 52 62 72 82 92 14E1 23 33 43 53 63 73 83 93 29B11 24 34 44 54 64 74 84 94 29F3 25 35 45 55 65 75 85 95 13A7 26 36 46 56 66 76 86 96

    [0173] The following examples, sequence listing and figures are provided to aid the understanding of the present invention, the true scope of which is set forth in the appended claims. It is understood that modifications can be made in the procedures set forth without departing from the spirit of the invention.

    [0174] Materials & General Methods

    [0175] General information regarding the nucleotide sequences of human immunoglobulins light and heavy chains is given in: Kabat, E. A., et al., Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, National Institutes of Health, Bethesda, Md. (1991). Amino acids of antibody chains are numbered and referred to according to EU numbering (Edelman, G. M., et al., Proc. Natl. Acad. Sci. USA 63 (1969) 78-85; Kabat, E. A., et al., Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, National Institutes of Health, Bethesda, Md., (1991)).

    [0176] Recombinant DNA Techniques

    [0177] Standard methods were used to manipulate DNA as described in Sambrook et al., Molecular cloning: A laboratory manual; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989. The molecular biological reagents were used according to the manufacturers' instructions. General information regarding the nucleotide sequences of human immunoglobulins light and heavy chains is given in: Kabat, E. A. et al., (1991) Sequences of Proteins of Immunological Interest, 5th ed., NIH Publication No. 91-3242.

    [0178] Gene Synthesis

    [0179] Desired gene segments are prepared from oligonucleotides made by chemical synthesis. The 600-1800 bp long gene segments, which are flanked by singular restriction endonuclease cleavage sites, are assembled by annealing and ligation of oligonucleotides including PCR amplification and subsequently cloned via the indicated restriction sites e.g. Kpnl/Sad or Ascl/Pacl into a pPCRScript (Stratagene) based pGA4 cloning vector. The DNA sequences of the subcloned gene fragments are confirmed by DNA sequencing. Gene synthesis fragments are ordered according to given specifications at Geneart (Regensburg, Germany).

    [0180] DNA Sequence Determination

    [0181] DNA sequences were determined by double strand sequencing.DNA and protein sequence analysis and sequence data management

    [0182] The GCG's (Genetics Computer Group, Madison, Wis.) software package version 10.2 and Infomax's Vector NT1 Advance suite version 8.0 is used for sequence creation, mapping, analysis, annotation and illustration.

    [0183] Expression Vectors

    [0184] a) For the expression of the described antibodies variants of expression plasmids for transient expression (e.g. in HEK293 EBNA or HEK293-F) cells based either on a cDNA organization with a CMV-Intron A promoter or on a genomic organization with a CMV promoter are applied.

    [0185] Beside the antibody expression cassette the vectors contained: [0186] an origin of replication which allows replication of this plasmid in E. coli, and- a -lactamase gene which confers ampicillin resistance in E. coli.

    [0187] The transcription unit of the antibody gene is composed of the following elements: [0188] unique restriction site(s) at the 5 endthe immediate early enhancer and promoter from the human cytomegalovirus, [0189] followed by the Intron A sequence in the case of the cDNA organization, [0190] a 5-untranslated region of a human antibody gene, [0191] a immunoglobulin heavy chain signal sequence, [0192] the human antibody chain (wildtype or with domain exchange) either as cDNA or as genomic organization with an the immunoglobulin exon-intron organization [0193] a 3 untranslated region with a polyadenylation signal sequence, and [0194] unique restriction site(s) at the 3 end.

    [0195] The fusion genes comprising the described antibody chains as described below are generated by PCR and/or gene synthesis and assembled with known recombinant methods and techniques by connection of the according nucleic acid segments e.g. using unique restriction sites in the respective vectors. The subcloned nucleic acid sequences are verified by DNA sequencing. For transient transfections larger quantities of the plasmids are prepared by plasmid preparation from transformed E. coli cultures (Nucleobond A X, Macherey-Nagel).

    [0196] b) Generation of antibody and antigen expression vectors

    [0197] The variable region of heavy and light chain DNA sequences were subcloned in frame with either the human IgG1 constant heavy chain or the hum IgG1 constant light chain pre-inserted into the respective recipient mammalian expression vector. The antibody expression was driven by a chimeric MPSV promoter comprising a CMV enhancer and a MPSV promoter followed by a 5 UTR, an intron and a kappa MAR element. The transcription is terminated by a synthetic polyA signal sequence at the 3 end of the CDS. All vectors carry a 5-end DNA sequence coding for a leader peptide which targets proteins for secretion in eukaryotic cells. In addition each vector contains an EBV OriP sequence for episomal plasmid replication in EBV EBNA expressing cells.

    [0198] The antigens that have been used for the phage display selection campaigns and to characterize the binding properties of the selected antibodies were expressed from mammalian antigen expression vectors with pre-inserted DNA sequences coding for C-terminal tags. An Avi tag has been used for in vivo or in vitro biotinylation of the respective antigen. For purification and homo- or heterodimerization of the antigen a hum IgG1 Fc wt or Fc knob was fused to the C-terminus of the antigen expression cassette. The antigen expression was driven by a chimeric MPSV promoter comprising a CMV enhancer and a MPSV promoter followed by a 5 UTR, an intron and a kappa MAR element. The transcription was terminated by a synthetic polyA signal sequence at the 3 end of the CDS. All vectors carry a 5-end DNA sequence coding for a leader peptide which targets proteins for secretion in eukaryotic cells. In addition each vector contains an EBV OriP sequence for episomal plasmid replication in EBV EBNA expressing cells.

    [0199] Cell Culture Techniques

    [0200] Standard cell culture techniques are used as described in Current Protocols in Cell Biology (2000), Bonifacino, J. S., Dasso, M., Harford, J. B., Lippincott-Schwartz, J. and Yamada, K. M. (eds.), John Wiley & Sons, Inc.

    [0201] Transient Expression in HEK293 Cells

    [0202] Bispecific antibodies are expressed by transient co-transfection of the respective expression plasmids in adherently growing HEK293-EBNA or in HEK293-F cells growing in suspension as described below.

    [0203] a) Transient transfections in HEK293-EBNA system

    [0204] Bispecific antibodies are expressed by transient co-transfection of the respective expression plasmids (e.g. encoding the heavy and modified heavy chain, as well as the corresponding light and modified light chain) in adherently growing HEK293-EBNA cells (human embryonic kidney cell line 293 expressing Epstein-Barr-Virus nuclear target; American type culture collection deposit number ATCC # CRL-10852, Lot. 959 218) cultivated in DMEM (Dulbecco's modified Eagle's medium, Gibco) supplemented with 10% Ultra Low IgG FCS (fetal calf serum, Gibco), 2 mM L-Glutamine (Gibco), and 250 g/ml Geneticin (Gibco). For transfection FuGENE 6 Transfection Reagent (Roche Molecular Biochemicals) is used in a ratio of FuGENE reagent (l) to DNA (g) of 4:1 (ranging from 3:1 to 6:1).

    [0205] Proteins are expressed from the respective plasmids using a molar ratio of (modified and wildtype) light chain and heavy chain encoding plasmids of 1:1 (equimolar) ranging from 1:2 to 2:1, respectively. Cells are feeded at day 3 with L-Glutamine ad 4 mM, Glucose [Sigma] and NAA [Gibco]. Bispecific antibody containing cell culture supernatants are harvested from day 5 to 11 after transfection by centrifugation and stored at 200 C. General information regarding the recombinant expression of human immunoglobulins in e.g. HEK293 cells is given in: Meissner, P. et al., Biotechnol. Bioeng. 75 (2001) 197-203.

    [0206] b) Transient transfections in HEK293-F system

    [0207] Bispecific antibodies are generated by transient transfection of the respective plasmids (e.g. encoding the heavy and modified heavy chain, as well as the corresponding light and modified light chain) using the HEK293-F system (Invitrogen) according to the manufacturer's instruction. Briefly, HEK293-F cells (Invitrogen) growing in suspension either in a shake flask or in a stirred fermenter in serum free FreeStyle 293 expression medium (Invitrogen) are transfected with a mix of the four expression plasmids and 293fectin or fectin (Invitrogen). For 2 L shake flask (Corning) HEK293-F cells are seeded at a density of 1.010.sup.6 cells/mL in 600 mL and incubated at 120 rpm, 8% CO.sub.2. The day after the cells are transfected at a cell density of ca. 1.510.sup.6 cells/mL with ca. 42 mL mix of A) 20 mL Opti-MEM (Invitrogen) with 600 g total plasmid DNA (1 g/mL) encoding the heavy or modified heavy chain, respectively and the corresponding light chain in an equimolar ratio and B) 20 ml Opti-MEM+1.2 mL 293 fectin or fectin (2 l/mL). According to the glucose consumption glucose solution is added during the course of the fermentation. The supernatant containing the secreted antibody is harvested after 5-10 days and antibodies are either directly purified from the supernatant or the supernatant is frozen and stored.

    [0208] Protein Determination

    [0209] The protein concentration of purified antibodies and derivatives is determined by determining the optical density (OD) at 280 nm, using the molar extinction coefficient calculated on the basis of the amino acid sequence according to Pace et al., Protein Science, 1995, 4, 2411-1423.

    [0210] Antibody Concentration Determination in Supernatants

    [0211] The concentration of antibodies and derivatives in cell culture supernatants is estimated by immunoprecipitation with Protein A Agarose-beads (Roche). 60 L Protein A Agarose beads are washed three times in TBS-NP40 (50 mM Tris, pH 7.5, 150 mM NaCl, 1% Nonidet-P40). Subsequently, 1-15 mL cell culture supernatant is applied to the Protein A Agarose beads pre-equilibrated in TBS-NP40. After incubation for at 1 h at room temperature the beads are washed on an Ultrafree-MC-filter column (Amicon] once with 0.5 mL TBS-NP40, twice with 0.5 mL 2 phosphate buffered saline (2PBS, Roche) and briefly four times with 0.5 mL 100 mM Na-citrate pH 5.0. Bound antibody is eluted by addition of 35 l NuPAGE LDS Sample Buffer (Invitrogen). Half of the sample is combined with NuPAGE Sample Reducing Agent or left unreduced, respectively, and heated for 10 min at 70 C. Consequently, 5-30 l are applied to an 4-12% NuPAGE Bis-Tris SDS-PAGE (Invitrogen) (with MOPS buffer for non-reduced SDS-PAGE and MES buffer with NuPAGE Antioxidant running buffer additive (Invitrogen) for reduced SDS-PAGE) and stained with Coomassie Blue.

    [0212] The concentration of antibodies and derivatives in cell culture supernatants is quantitatively measured by affinity HPLC chromatography. Briefly, cell culture supernatants containing antibodies and derivatives that bind to Protein A are applied to an Applied Biosystems Poros A/20 column in 200 mM KH.sub.2PO.sub.4, 100 mM sodium citrate, pH 7.4 and eluted from the matrix with 200 mM NaCl, 100 mM citric acid, pH 2.5 on an Agilent HPLC 1100 system. The eluted protein is quantified by UV absorbance and integration of peak areas. A purified standard IgG1 antibody served as a standard.

    [0213] Alternatively, the concentration of antibodies and derivatives in cell culture supernatants is measured by Sandwich-IgG-ELISA. Briefly, StreptaWell High Bind Strepatavidin A-96 well microtiter plates (Roche) are coated with 100 L/well biotinylated anti-human IgG capture molecule F(ab)2<h-Fc>BI (Dianova) at 0.1 g/mL for 1 h at room temperature or alternatively over night at 4 C. and subsequently washed three times with 200 L/well PBS, 0.05% Tween (PBST, Sigma). 100 L/well of a dilution series in PBS (Sigma) of the respective antibody containing cell culture supernatants is added to the wells and incubated for 1-2 h on a micro titerplate shaker at room temperature. The wells are washed three times with 200 L/well PBST and bound antibody is detected with 100 l F(ab)2<hFc>POD (Dianova) at 0.1 g/mL as detection antibody for 1-2 h on a microtiterplate shaker at room temperature. Unbound detection antibody is washed away three times with 200 L/well PBST and the bound detection antibody is detected by addition of 100 L ABTS/well. Determination of absorbance is performed on a Tecan Fluor Spectrometer at a measurement wavelength of 405 nm (reference wavelength 492 nm).

    [0214] Protein Purification

    [0215] Proteins are purified from filtered cell culture supernatants referring to standard protocols. In brief, antibodies are applied to a Protein A Sepharose column (GE healthcare) and washed with PBS. Elution of antibodies is achieved at pH 2.8 followed by immediate neutralization of the sample. Aggregated protein is separated from monomeric antibodies by size exclusion chromatography (Superdex 200, GE Healthcare) in PBS or in 20 mM Histidine, 150 mM NaCl pH 6.0. Monomeric antibody fractions are pooled, concentrated if required using e.g. a MILLIPORE Amicon Ultra (30 MWCO) centrifugal concentrator, frozen and stored at 20 C. Part of the samples are provided for subsequent protein analytics and analytical characterization e.g. by SDS-PAGE, size exclusion chromatography or mass spectrometry.

    [0216] SDS-PAGE

    [0217] The NuPAGE Pre-Cast gel system (Invitrogen) is used according to the manufacturer's instruction. In particular, 10% or 4-12% NuPAGE Novex Bis-TRIS Pre-Cast gels (pH 6.4) and a NuPAGE MES (reduced gels, with NuPAGE Antioxidant running buffer additive) or MOPS (non-reduced gels) running buffer is used.

    [0218] Analytical Size Exclusion Chromatography

    [0219] Size exclusion chromatography for the determination of the aggregation and oligomeric state of antibodies is performed by HPLC chromatography. Briefly, Protein A purified antibodies are applied to a Tosoh TSKgel G3000SW column in 300 mM NaCl, 50 mM KH.sub.2PO.sub.4/K.sub.2HPO.sub.4, pH 7.5 on an Agilent HPLC 1100 system or to a Superdex 200 column (GE Healthcare) in 2PBS on a Dionex HPLC-System. The eluted protein is quantified by UV absorbance and integration of peak areas. BioRad Gel Filtration Standard 151-1901 served as a standard.

    [0220] Mass Spectrometry

    [0221] The total deglycosylated mass of crossover antibodies is determined and confirmed via electrospray ionization mass spectrometry (ESI-MS). Briefly, 100 g purified antibodies are deglycosylated with 50 mil N-Glycosidase F (PNGaseF, ProZyme) in 100 mM KH.sub.2PO.sub.4/K.sub.2HPO.sub.4, pH 7 at 37 C. for 12-24 h at a protein concentration of up to 2 mg/ml and subsequently desalted via HPLC on a Sephadex G25 column (GE Healthcare). The mass of the respective heavy and light chains is determined by ESI-MS after deglycosylation and reduction. In brief, 50 g antibody in 115 l are incubated with 60 l IM TCEP and 50 l 8 M Guanidine-hydrochloride subsequently desalted. The total mass and the mass of the reduced heavy and light chains is determined via ESI-MS on a Q-Star Elite MS system equipped with a NanoMate source.

    EXAMPLES

    Example 1Generation of Anti-BCMA Antibodies

    Example 1A. Production of Antigens and Tool Reagents

    Example 1A1. Recombinant, Soluble, Human BCMA Extracellular Domain

    [0222] a) Recombinant, soluble, human BCMA extracellular domain (BCMA ECD) is produced as described in Ryan, 2007 (Mol Cancer Ther; 6 (11): 3009-18). Briefly, the human BCMA extracellular domain (ECD; amino acids 5-51; NP_001183) is amplified with

    TABLE-US-00002 forwardprimer (SEQIDNO:11) 5-AAGCTTGGATCCATGTTGCAGATGGCTGGGCAGTGCTCC-3 incorporatingaBamHIsite(bold,underlined) and reverseprimer (SEQIDNO:12) 5-GAATTCGCGGCCGCTCATCCTTTCACTGAATTGGTCACACTTGCATT AC-3 incorporatingastopcodon(italic)andNotIsite (bold,underlined)usingIMAGEclone687194 (Invitrogen)asaPCRtemplate.
    The PCR product is cloned into an expression vector comprising a glutathione S-trans erase gene upstream of glutathione S-transferase (GST), transformed into an E. coli strain comprising T7 RNA polymerase gene under the control of the lacUV5 promoter., and the induced protein is purified at 4 C. on an KTAexplorer (GE Healthcare). The cell pellet is lysed in 1:15 w/v of B-PER buffer (Pierce) containing protease inhibitor and lysozyme. The extract is supplemented with 1 to 2 g/mL DNase I (Sigma), stirred for an additional 20 min, and adjusted to pH 7.5. The soluble fusion protein is collected after centrifugation at 31,000g for 20 min (Beckman) and loaded onto a glutathione Sepharose 4 FF column (GE Healthcare) preequilibrated with B-PER buffer. The column is washed with 4 column volumes (CV) B-PER buffer, 3 CV each of wash buffers 1 and 2 (Pierce), followed by a final column wash with 5 CV 50 mmol/L Tris (pH 8.0), 0.15 mol/L NaCl. The GST-tagged BCMA is eluted with 20 mmol/L reduced glutathione in 50 mmol/L Tris (pH 8.0) and dialyzed against PBS (pH 7.4) using a 3500 MWCO slide-A-lyzer (Pierce). For GST tag removal, BCMA:GST is treated with thrombin in 50 mmol/L Tris (pH 8.0), 0.15 mol/L NaCl, while bound to the glutathione Sepharose. Released thrombin is then captured by a benzamidine Sepharose column (GE Healthcare). The GST-cleaved BCMA is eluted from the column with 3 to 5 CV 50 mmol/L Tris (pH 8.0), 0.15 mol/L NaCl, and dialyzed against PBS (pH 7.4). Thrombin removal is confirmed by analyzing fractions for thrombin activity using the chromogenic substrate S-2238 (Chromogenix, DiaPharma). Protein concentration is determined by A280. All purified proteins are analyzed by SDS-PAGE and by TSK-Gel G3000SW HPLC size exclusion chromatography (Tosoh Bioscience).A biotinylated variant of BCMA ECD (BCMA-ECD-biot) is produced as described above using the same procedures with the following modifications. A DNA sequence encoding an Avi-His tag is added, via PCR amplification, in frame downstream at the 3 end of the first PCR product described above. This new, second PCR product is then sublconed into the pGEX4T1 expression vector and then co-transformed in bacteria together with a vector for expression of BirA enzyme for in vivo biotinylation of the Avi tag. The remaining production and purification steps are performed as indicated above for BCMA-ECD.

    [0223] b) The extracellular domains of human, cynomolgus and murine BCMA that were used as antigens for phage display selections were transiently expressed as N-terminal monomeric Fc-fusion in HEK EBNA cells and in vivo site-specifically biotinylated via co-expression of BirA biotin ligase at the avi-tag recognition sequence located at the C-terminus of the Fc portion carrying the receptor chain (Fc knob chain). The extracellular domains of human, cynomolgus and murine BCMA comprised methionine 4 to asparagine 53, methionine 4 to asparagine 52, and alanine 2 to threonine 49, respectively. These were N-terminally fused to the hinge of a human IgG1 enabling heterodimerization with an unfused human IgG1 Fc portion (hole chain) by knobs-into-holes technology.

    Example 1A2. Recombinant, Truncated Murine APRIL

    [0224] a) Recombinant, truncated murine APRIL is produced as described in Ryan, 2007 (Mol Cancer Ther; 6 (11): 3009-18). Briefly, murine APRIL (residues 106-241; NP_076006) is amplified from IMAGE clone 5290965 (Invitrogen) and cloned into a bacterial expression vector fused at the COOH terminus to Gene-specific

    TABLE-US-00003 forwardprimer (SEQIDNO:13) 5-ACGTTAGATCTCCACTCAGTCCTGCATCTTGTTCCAGTTAAC-3 and reverseprimer (SEQIDNO:14) 5-AACGTTGCGGCCGCTAGTTTCACAAACCCCAGG-3
    are used for amplification. The BglII and NotI sites (bold, underlined) in the forward and reverse primers, respectively, are used to clone the resulting PCR fragment a bacterial expression vector fused at the COOH terminus to thioredoxin. The construct is transformed into an Escherichia coli strain K-12 comprising a mutation in the thioredoxin reductase genecultured at 25 C. until A600 0.6, induced with 1 mmol/L isopropyl-L-thio-(3-D-galactopyranoside, and then cultured overnight at 25 C. The E. coli cell paste is resuspended and stirred at 4 C. in a 1:10 w/v of B-PER lysis buffer containing complete EDTA-free protease inhibitors. The mixture is then diluted with 5 stock buffer to a final concentration of 50 mmol/L Tris-HCl, 0.4 mol/L NaCl, 1% Triton-X100, 5% glycerol, and 10 mmol/L imidazole (pH 8-9). The sample is supplemented with lysozyme, DNase I, and 2 mmol/L MgCl.sub.2 (Sigma), stirred for 30 min, adjusted to 4 mmol/L EDTA, stirred for 20 min, and then centrifuged to remove the cell debris. The sample is adjusted to 40 mmol/L MgCl.sub.2 and stirred for 30 min before loading onto a Ni-IMAC column (GE Healthcare). The column is sequentially washed with 3 to 5 CV of 10 mmol/L imidazole in 20 mmol/L Tris-HCl (pH 8.0), 2 to 3 CV of 0.5% v/v Triton X-100 in 20 mmol/L Tris-HCl (pH 8.0), then with 5 to 10 CV of 70 mmol/L imidazole in 20 mmol/L Tris-HCl (pH 8.0). The truncated-APRIL is eluted with a linear gradient from 70 to 500 mmol/L imidazole in 20 mmol/L Tris-HCl, 5% glycerol (pH 8.0). Pooled protein fractions are dialyzed against PBS buffer containing 50 mmol/L imidazole, 0.1 mol/L L-Arg, 5% glycerol, 1 mmol/L EDTA (pH 8.0). The protein concentration is determined spectrophotometrically [c280 (1%)=0.94].

    [0225] b) Recombinant, truncated, murine APRIL that was used as tool (competitor) for the phage display selections and ELISAs was transiently expressed as N-terminal monomeric Fc-fusion in HEK EBNA cells. Murine APRIL comprised histidine 106 to leucine 241. It was N-terminally fused to the hinge of a human IgG1 enabling heterodimerization with an unfused human IgG1 Fc portion (hole chain) by knobs-into-holes technology.

    Example 1A3. Recombinant, Truncated Human BAFF

    [0226] Recombinant, truncated human is produced as describe in Gordon, 2003 (Biochemistry; 42 (20): 5977-5983). Briefly, a DNA fragment encoding BAFF residues 82-285 is cloned into a pBr322 vector comprising a His-Tag at the N-terminus and a subsequent thrombin cleavage site, creating a fusion with an N-terminal His-tag followed by a thrombin cleavage site. An E. coli strain comprising T7 RNA polymerase gene under the control of the lacUV5 promoter is cultured to mid-log phase at 37 C. in LB medium with 50 mg/L carbenicillin and then cooled to 16 C. prior to induction with 1.0 mM IPTG. Cells are harvested by centrifugation after 12 h of further growth and stored at 80 C. The cell pellet is resuspended in 50 mM Tris, pH 8.0, and 500 mM NaCl and sonicated on ice. After centrifugation, the supernatant is loaded onto a Ni-NTA agarose column (Qiagen). The column is washed with 50 mM Tris, pH 8.0, 500 mM NaCl, and 20 mM imidazole and then eluted with a step gradient in the same buffer with 250 mM imidazole. BAFF-containing fractions are pooled, thrombin is added, and the sample is dialyzed overnight against 20 mM Tris, pH 8.0, and 5 mM CaCl.sub.2 at 4 C. The protein is further purified on a monoQ (Pharmacia) column and finally on an S-200 size exclusion column in 20 mM Tris, 150 mM NaCl, and 5 mM MgCl.sub.2.

    Example 1B. Recombinant Cells Expressing Human BCMA on their Surface

    [0227] Recombinant cells expressing human BCMA on their surface (HEK293-BCMA cells) are generated as described in Ryan, 2007 (Mol Cancer Ther; 6 (11): 3009-18). Briefly, full-length human BCMA is amplified using forward primer 5-GAATTCAAGCTTGCCACCATGTTGCAGATGGCTGGGCAGTGCTCC-3 (SEQ ID NO:15) including a HindIII restriction site (bold, underlined) and Kozak consensus sequence and reverse primer 5-GAATTCTCTAGATTACCTAGCAGAAATTGATTTCTCTATCTCCGTAGC-3 (SEQ ID NO:16) including a 3 stop codon and XbaI restriction site (bold, underlined) using IMAGE clone 687194 (Invitrogen) as a PCR template. The amplification product is cloned into an E. coli expression vector, comprising human cytomegalovirus (CMV) immediate early enhancer/promoter, a polyhistidine (6His), and a neomycin resistance gene linearized, transfected into human embryonic kidney 293 (HEK293) cells. These cells are selected which express human BCMA on their surface high expressing stable clones are chosen by fluorescence-activated cell sorting analysis.

    Example 1C. Human Myeloma Cell Line Expressing BCMA on their Surface

    [0228] a) Cell origin and culture conditions. Human MM cell line NCI-H929 is acquired from the American Type Culture Collection (ATCC CRL-9068). NCI-H929 cells are grown in RPMI 1640 supplemented with 10% fetal bovine calf serum, 2 mM L-Glutamine, 1 mM Sodiumpyruvate. U266B 1 (ATCC TIB-196) a human B lymphocyte myeloma cell line cultured in RPMI high Glucose, 10% FCS, 1% Glutamine, 1% Sodiumpyruvate, 10 mM HEPES). RPMI 8226 (ATCC CCL-155), a human B lymphocyte myeloma cell line cultured in DMEM, 10% FCS, 1% Glutamine. MKN45 (DSMZ ACC 409), a human gastric adenocarcinoma cell line cultured in DMEM containing 10% FCS and 1% Glutamine. BCMA expression on MM cell lines is confirmed by flow cytometry using fluorochrome-conjugated anti-human BCMA antibodies (BD Biosciences).

    [0229] b) BCMA expression was assessed on three human myeloma cell lines (H929, RPMI-8226 and U266B 1) by flow cytometry. Briefly, cells were harvested, washed, counted for viability, resuspended at 50 000 cells/well of a 96-well round bottom plate and incubated with anti human BCMA antibody (Abcam, #ab54834, mouse IgG1) at 10 g/ml for 30 min at 4 C. (to prevent internalization). A mouse IgG1 was used as isotype control (BD Biosciences, #554121). Cells were then centrifuged (5 min at 350g), washed twice and incubated with the FITC-conjugated anti mouse secondary antibody for 30 min at 4 C. At the end of incubation time, cells were centrifuged (5 min at 350g), washed twice with FACS buffer, resuspended in 100 ul FACS buffer and analyzed on a Cantoll device running FACS Diva software. FIG. 3 shows increase of median fluorescence intensity upon binding of increasing concentrations of the anti-BCMA antibody to H929 cells. Quantification of BCMA receptor number on membrane surface of H929, RPMI-8226 and U266B1 myeloma cell lines was assessed by QFIKIT analysis (Dako, #K0078, following manufacturer's instructions).

    TABLE-US-00004 TABLE 2 Quantification of BCMA receptor number on membrane surface of H929, RPMI-8226 and U266B1 myeloma cell lines. Myeloma cell lines BCMA receptor no H929 6085 RPMI-8226 6253 U266(B1) 2865

    Example 1D. Obtaining Anti-BCMA Antibodies Via Immunization

    [0230] Anti-BCMA antibodies are generated by immunization of rats with BCMA ECD as described in Ryan, 2007 (Mol Cancer Ther; 6 (11): 3009-18). Briefly, Sprague-Dawley rats are immunized subcutaneously with keyhole limpet hemocyanin-conjugated BCMA ECD (amino acids 5-54; NP_001183) using TiterMax adjuvant (Sigma). Keyhole limpet hemocyanin conjugation is performed with a lysine residue using Imject mcKLHV (Pierce). Due to the high sequence homology between human and mouse BCMA proteins, rats are preferred for antibody production. B cells are harvested from immunized spleens and fused to P3-X63.Ag8 myeloma cells using a standard polyethylene glycol fusion protocol (Goding 1996; Monoclonal antibodies: principles and practice. 3.sup.rd ed. Academic Press). Hybridomas are cultured in 80% Iscove's modified Dulbecco's medium supplemented with 10% fetal clone I, 4 mmol/L L-glutamine, 10% cloning factor and also including penicillin, streptomycin and 1 sodium hypoxanthine, aminopterin, and thymidine. ELISA testing is performed to detect binding of hybridoma culture supernatants to BCMA. Positive BCMA-binding hybridomas are further screened by flow cytometry for cell-based binding to BCMA transfectants (HEK293-BCMA cells). Chosen hybridomas undergo two rounds of limiting dilution cloning and are further expanded for purification. In addition, antibodies from those same chosen hybridomas are converted to chimeric antibodies with human constant regions by standard methods. Briefly, cDNAs encoding the heavy and light chain variable regions are amplified bz RT-PCR out of mRNA from the hybridomas and then joined in frame with cDNAs coding the heavy constant region of human IgG1 and the human kappa light chain constant region, respectively. These cDNAs are cloned into mammalian transient expression vectors and plasmid DNA is produced in E. coli and purified for transfection. HEK293 cells are transfected by a standard transfection method (calcium phosphate-based transfection) and 7 days later IgG1 antibodies are purified from culture supernatants by affinity chromatography on a Protein A column followed by isolation of the monomeric antibody fraction via size exclusion chromatography.

    Example 1E. Obtaining Anti-BCMA Antibodies Out of an In Vitro, Recombinant Library

    Example 1E1. Construction of Generic Fab-Libraries

    [0231] Generic antibody libraries in the Fab-format are constructed on the basis of human germline genes using the following V-domain pairings: Vk3_20 kappa light chain with VH3_23 heavy chain for the DP47-3 library and Vk1_17 kappa light chain with VH1_69 heavy chain for the DP88-3 library. Both libraries are randomized in CDR3 of the light chain (L3) and CDR3 of the heavy chain (H3) and are assembled from 3 fragments per library by splicing by overlapping extension (SOE) PCR. Fragment 1 comprises the 5 end of the antibody gene including randomized L3, fragment 2 is a central constant fragment spanning from L3 to H3, whereas fragment 3 comprises randomized H3 and the 3 portion of the antibody gene. The following primer combinations are used to generate library fragments for DP47-3 library: fragment 1 (LMB3-LibL1b_new), fragment 2 (MS63-MS64), fragment 3 (Lib2H-fdseqlong). See Table 1 of WO2012020038. The following primer combinations are used to generate library fragments for the DP88-3 library: fragment 1 (LMB3-RJH_LIB3), fragment 2 (RJH31-RJH32) and fragment 3 (LIB88_2-fdseqlong). See tables 3 and 4 of WO2012020038. The PCR protocol for the production of library fragments includes: 5 min of initial denaturation at 94 C.; 25 cycles of 1 min at 94 C., 1 min at 58 C., and 1 min at 72 C.; and terminal elongation for 10 min at 72 C. For assembly PCR, equimolar ratios of the 3 fragments are used as template. The assembly PCR protocol includes: 3 min of initial denaturation at 94 C.; and 5 cycles of 30 seconds at 94 C., 1 min at 58 C., and 2 min at 72 C. At this stage, primers complementary to sequence outside fragments 1-3 are added and an additional 20 cycles are performed prior to a terminal elongation for 10 min at 72 C. After assembly of sufficient amounts of full length randomized Fab constructs, the Fab constructs are digested with NcoI/NotI for the DP47-3 library and with NcoI/NheI for the DP88-3 library alongside with similarly treated acceptor phagemid vector. For the DP47-3 library, 22.8 g of Fab library is ligated with 16.2 g of phagemid vector. For the DP88-3 library, 30.6 g of Fab library is ligated with 30.6 g of phagemid vector. Purified ligations are used for 68 transformations for the DP47-3 library and 64 transformations for the DP88-3 library, respectively, to obtain final DP47-3 and DP88-3 libraries. Phagemid particles displaying the Fab libraries are rescued and purified by PEG/NaCl purification to be used for selection of anti-BCMA Fab clones.

    Example 1E2. Selection of Anti-BCMA Fab Clones

    [0232] a) Selections are carried out against BCMA-ECD-biot. The antigen is biotinylated in vivo upon expression. Selections are carried out in solution according to the following protocol: (i) binding of .sup.10.sup.12 phagemid particles of library DP88-3 and 100 nM BCMA-ECD-biot for 0.5 hours in a total volume of 1 ml; (ii) capture of BCMA-ECD-biot and attached phage by the addition of 5.410.sup.7 streptavidin-coated magnetic beads for 10 minutes; (iii) washing of beads using 51 ml PBS/Tween 20 and 51 ml PBS; (iv) elution of phage particles by the addition of 1 mL 100 mM TEA (triethylamine) for 10 minutes and neutralization by the addition of 500 L 1M Tris/HCl pH 7.4; and (v) re-infection of log-phase E. coli TG1 cells (Zymo Research), infection with helper phage VCSM13 (Stratagene) and subsequent PEG/NaCl precipitation of phagemid particles to be used in subsequent selection rounds. Selections are carried out over 3 rounds using constant BCMA-ECD-biot concentrations at 100 nM. In round 2, capture of antigen:phage complexes is performed on neutravidin plates instead of streptavidin beads. Specific binders are identified by ELISA as follows using: 100 l of 100 nM BCMA-ECD-biot is coated in each well of neutravidin plates. Fab-containing bacterial supernatants are added and binding Fabs are detected via their Flag-tags by using an anti-Flag/HRP secondary antibody. Once identified, anti-BCMA ECD clones are bacterially expressed in a 0.5 liter culture volume, affinity purified and further characterized by SPR-analysis using a BIACORE instrument.

    [0233] b) Anti-BCMA Fabs were established by phage display from synthetic Fab libraries consisting of VL and VH pairings derived from different V-domain families. Clones 13C2, 17A5, 83A10, 13D2, 14B11, 14E1, 29B11, and 29F3 were generated from Vk3_20/VH3_23 sublibrary, clone 13A4 from Vk2D_28/VH5_1 sublibrary, and clone 13A7 from Vk2D_28/VH3_23 sublibrary, respectively (Table 3). These libraries are based on entirely human frameworks with sequence diversity in CDR3 of VL (3 different lengths) and VH domains (6 different lengths).

    TABLE-US-00005 TABLE 3 Anti-BCMA clones and respective VL/VH pairings Fab clone VL domain VH domain 13C2 Vk3_20 VH3_23 17A5 Vk3_20 VH3_23 83A10 Vk3_20 VH3_23 13A4 Vk2D_28 VH5_1 13D2 Vk3_20 VH3_23 14B11 Vk3_20 VH3_23 14E1 Vk3_20 VH3_23 29B11 Vk3_20 VH3_23 29F3 Vk3_20 VH3_23 13A7 Vk2D_28 VH3_23

    [0234] Selection rounds (biopanning) were performed in solution according to the following pattern: 1. pre-clearing of 1012 phagemid particles per library pool in immunotubes coated with 10 ug/ml of an unrelated human IgG to deplete the libraries of antibodies recognizing the Fc-portion of the antigens, 2. incubation of the non-Fc-binding phagemid particles with 100 nM biotinylated BCMA for 0.5 h in the presence of 100 nM unrelated non-biotinylated Fc knobs-into-holes construct for further depletion of Fc-binders in a total volume of 2 ml, 3. capture of biotinylated BCMA and specifically binding phage by splitting up and transferring the panning reaction into 16 wells on a neutravidin or streptavidin pre-coated microtiter plate for 20 min on a shaker, 4. washing of respective wells 10-30 with PBS/Tween20 and 10-30 with PBS using a plate washer, 5. optional competitive washing step by addition of 230 nM murine APRIL to displace Fab clones that recognize the binding site of the natural ligand thus selecting for APRIL-non-competing phage antibodies, 6. elution of phage particles by addition of 125 ul 100 mM TEA (triethylamine) per well for 5-10 min and neutralization by addition of an equal volume of 1M Tris/HCl pH 7.4, 7. re-infection of log-phase E. coli TG1 cells with the eluted phage particles, infection with helperphage VCSM13, incubation on a shaker at 30 C. overnight and subsequent PEG/NaCl precipitation of phagemid particles to be used in the next selection round.

    [0235] Selections were carried out over 3 to 5 rounds using constant antigen concentrations of 100 nM. Apart from selection campaigns during which only human BCMA was used as antigen, additional selection campaigns were carried out during which also cynomolgus or murine BCMA were used in an alternating fashion with human BCMA in order to select for cross-reactive antibodies. Moreover, as an alternative to streptavidin plate-based capture, capture of antigen: phage complexes was performed by addition of 5.4107 streptavidin-coated magnetic beads to the panning reaction followed by washing steps using respective magnets under the conditions described above.

    [0236] Specific binders were identified by surface plasmon resonance-screening of Fab-containing bacterial culture supernatants using BioRad's ProteOn XPR36 biosensor. In brief, after infection of log-phase E. coli TG1 cells with the eluted phage particles, single colony forming units (cfu) were plated and picked for inoculation of 1 ml expression cultures in 96-deep well plates. Fabs were captured from the supernatants on a ProteOn GLM chip that was derivatized with 8.000-10.000 RU of a goat anti-human IgG, F(ab)2 fragment specific polyclonal antibody (Jackson ImmunoResearch, #109-005-006) in vertical orientation. Subsequently, human, cynomolgus and murine BCMA as well as an unrelated Fc knobs-into-holes construct were injected as analytes in horizontal orientation. Clones that exhibited significant binding responses to BCMA and did not bind the Fc-portion of the antigens, were bacterially expressed in a 0.5 liter culture volume, affinity purified and kinetically characterized by SPR-analysis using a one-shot-kinetics protocol on BioRad's ProteOn XPR36 biosensor.

    Example 1F. BCMA Binding Assays: Surface Plasmon Resonance

    [0237] a) To measure binding affinities of BCMA antibody to immobilized BCMA, surface plasmon resonance measurements are performed on a Biacore 3000 instrument (Pharmacia Biosensor). The receptor BCMA (BCMA-ECD) is coupled to the sensor chip at a level of 400 resonance units using the amine coupling protocol as provided by manufacturer. Alternative BCMA-ECD-biot is coupled to a streptavidin-sensor chip, also at a level of 400 resonance units, using the protocol as provided by the manufacturer. In all experiments, flow cell 1 is used as the reference cell. Sensorgrams are recorded for Fab solutions ranging in concentration from 0.1 pM to 200 nM. Nonlinear regression analysis is used to calculate kinetic constants and binding constants simultaneously with the use of the manufacturer's software. Fab clones with monovalent binding affinities to BCMA-ECD of 100 nM are converted into IgGs by standard methods. Briefly, cDNAs encoding the heavy and light chain variable regions are joined in frame with cDNAs coding the heavy constant region of human IgG1 and the human kappa light chain constant region, respectively. These cDNAs are cloned into mammalian transient expression vectors and plasmid DNA is produced in E. coli and purified for transfection. HEK293 cells are transfected by a standard transfection method (calcium phosphate-based transfection) and 7 days later IgG1 antibodies are purified from culture supernatants by affinity chromatography on a Protein A column followed by isolation of the monomeric antibody fraction via size exclusion chromatography.

    [0238] b) Affinities (KD) of anti-BCMA Fab clones were measured by surface plasmon resonance using a ProteOn XPR36 instrument (Biorad) at 25 C. with biotinylated human, cynomolgus and murine BCMA immobilized on NLC chips by neutravidin capture (Table 4). An unrelated biotinylated Fc knobs-into-holes construct was immobilized in a similar fashion as negative control. Immobilization of antigens (ligand): Recombinant antigens were diluted with PBST (10 mM phosphate, 150 mM sodium chloride pH 7.4, 0.005% Tween 20) to 10 ug/ml, then injected at 40 ul/minute for 300s in vertical orientation.

    [0239] Injection of analytes: For one-shot kinetics measurements, injection direction was changed to horizontal orientation, two-fold dilution series of purified Fab (varying concentration ranges) were injected simultaneously at 40 ul/min along channels 1-5, with association times of 200 or 300s, and dissociation times of 300s. Buffer (PBST) was injected along the sixth channel to provide an in-line blank for referencing. Association rate constants (kon) and dissociation rate constants (koff) were calculated using a simple one-to-one Langmuir binding model in ProteOn Manager v3.1 software by simultaneously fitting the association and dissociation sensorgrams. The equilibrium dissociation constant (KD) was calculated as the ratio koff/kon. Regeneration was performed in horizontal orientation using 10 mM glycine-HCl pH 1.5 at a flow rate of 100 ul/min for a contact time of 18s.

    TABLE-US-00006 TABLE 4 Monovalent affinities of anti-BCMA Fab clones K.sub.D human K.sub.D cynomolgus K.sub.D murine Fab clone BCMA [nM] BCMA [nM] BCMA [nM] 13C2 196 144 17A5 45 74 83A10 76 1510 1130 13A4 1.8 13D2 86 weak weak 14B11 383 14E1 91 weak weak 29B11 224 weak 29F3 87 weak 13A7 235

    [0240] c) Assessment of binding of anti-BCMA antibodies to recombinant BCMA by surface plasmon resonance (SPR) as follow. All SPR experiments were performed on a Biacore T200 at 25 C. with HBS-EP as running buffer (0.01 M HEPES pH 7.4, 0.15 M NaCl, 3 mM EDTA, 0.005% Surfactant P20, Biacore, Freiburg/Germany). The avidity of the interaction between anti-BCMA antibodies and recombinant BCMA Fc(kih) (human, cynomolgus and murine) was determined. Biotinylated recombinant human, cynomolgus and murine BCMA Fc(kih) were directly coupled on a SA chip following instructions (Biacore, Freiburg/Germany). The immobilization level ranged from 200 to 700 RU. The anti-BCMA antibodies were passed at a 2-fold concentration range (1.95 to 500 nM) with a flow of 30 L/minutes through the flow cells over 120 seconds. The dissociation was monitored for 180 seconds. Bulk refractive index differences were corrected for by subtracting the response obtained on the reference flow cell. Here, the anti-BCMA antibodies were flown over an empty surface previously activated and deactivated as described in the standard amine coupling kit. Apparent kinetic constants were derived using the Biacore T200 Evaluation Software (vAA, Biacore AB, Uppsala/Sweden), to fit rate equations for 1:1 Langmuir binding by numerical integration, despite the bivalency of the interaction for comparison purposes.

    [0241] The affinity of the interaction between anti-BCMA antibodies and recombinant human BCMA Fc(kih) was also determined. Anti-human Fab antibody (GE Healthcare) was directly coupled on a CM5 chip at pH 5.0 using the standard amine coupling kit (Biacore, Freiburg/Germany). The immobilization level was about 6500 RU. Anti-BCMA antibody was captured for 90 seconds at 25 nM. Recombinant human BCMA Fc(kih) was passed at a 4-fold concentration range (1.95 to 500 nM) with a flow of 30 L/minutes through the flow cells over 120 seconds. The dissociation was monitored for 120 seconds. Bulk refractive index differences were corrected for by subtracting the response obtained on reference flow cell. Here, recombinant BCMA was flown over a surface with immobilized anti-human Fab antibody but on which HBS-EP has been injected rather than anti-BCMA antibody. Kinetic constants were derived using the Biacore T100 Evaluation Software (vAA, Biacore AB, Uppsala/Sweden), to fit rate equations for 1:1 Langmuir binding by numerical integration (Table 5). Binding of 83A10 anti-BCMA antibody to recombinant cynomolgus BCMA Fc(kih) and murine BCMA Fc(kih) was also measured (Table 6).

    TABLE-US-00007 TABLE 5 Affinity constants determined by fitting rate equations for 1:1 Langmuir binding Kon Koff KD Ligand Analyte (1/Ms) (1/s) (M) 13C2 anti-BCMA IgG huBCMA Fc(kih) 2.4E+05 1.1E02 4.7E08 17A5 anti-BCMA IgG huBCMA Fc(kih) 2.2E+05 1.9E03 8.7E09 83A10 anti-BCMA IgG huBCMA Fc(kih) 6.2E+05 2.5E03 4.1E09 29F3 anti-BCMA IgG huBCMA Fc(kih) 3.2E+05 6.8E03 2.1E08 13A7 anti-BCMA IgG huBCMA Fc(kih) 8.0E+04 7.9E03 1.0E07 13A4 anti-BCMA IgG huBCMA Fc(kih) 7.2E+04 3.6E04 5.1E09 13D2 anti-BCMA IgG huBCMA Fc(kih) 3.6E+05 9.3E03 2.6E08 14B11 anti-BCMA IgG huBCMA Fc(kih) 1.5E+05 1.6E02 1.1E07 14E1 anti-BCMA IgG huBCMA Fc(kih) 4.0E+05 8.1E03 2.0E08 29B11 anti-BCMA IgG huBCMA Fc(kih) 1.7E+05 6.6E03 4.0E08

    TABLE-US-00008 TABLE 6 Binding of recombinant BCMA Fc(kih) to 83A10 anti-BCMA antibody. Kon Koff KD Ligand Analyte (1/Ms) (1/s) (M) 83A10 anti-BCMA IgG huBCMA Fc(kih) 6.2E+05 2.5E03 4.1E09 83A10 anti-BCMA IgG cyBCMA Fc(kih) 2.8E+05 2.0E02 7.2E08 83A10 anti-BCMA IgG muBCMA Fc(kih) 2.0E+05 4.0E02 2.0E07 a) cynomolgus BCMA Fc(kih). b) murine BCMA Fc(kih)

    Example 1G. BCMA-Signaling Assay: NF-B Activation

    [0242] a) As described in Ryan, 2007 (Mol Cancer Ther; 6 (11): 3009-18), NCI-H929 cells are washed and incubated in RPMI supplemented with 0.25% fetal bovine serum for 24 h before treatment. The cells are then untreated or treated with 0.1 g/mL TNF-, 100 ng/mL, preferably 1000 ng/mL heat-treated HT-truncated-APRIL, 100 ng/mL, preferably 1000 ng/mL truncated-APRIL, 0.1 pM to 200 nM isotope control, or 0.1 pM to 200 nM anti-BCMA antibodies for 20 min. To evaluate ligand blockade, cells pre-treated for 20 min with 0.1 pM to 200 nM of anti-BCMA antibodies or an isotype control antibody are treated with 1000 ng/mL of truncated-APRIL. Cells are then harvested, washed, and lysed with 50 mmol/L Tris-HCl (pH 7.5), 1% NP.sub.40, 150 mmol/L NaCl, 1 mmol/L EDTA, 1 mmol/L EGTA supplemented with protease, and phosphatase inhibitors. Protein extracts are then analyzed for NF-B activity using a TransAM chemiluminescent assay kit (Active Motif) and the luminescent signal reading is performed with a Fusion HT plate reader (Packard Instruments).

    [0243] b) Briefly, H929 cells were starved in RPMI1640 with 0.25% FCS for 24 h at 37 C. in cell incubator. At the end of the starvation time, cells were harvested, counted and cell viability evaluated using ViCell. Viable cells were adjusted to 4106 cells per ml in BSA-containing FACS Stain Buffer (BD Biosciences). 30 l of this cell suspension were further aliquoted per well into a round-bottom 96-well plate and pre-incubated with anti-BCMA antibodies (15 or 50 ug/ml) or isotype control antibodies (10, and 40 ug/ml) for 20 min in cell incubator. Cells were then supplemented with 1 ug/ml recombinant mouse -APRIL tagged with hemagglutinin (HA) (R&D Systems Europe, #7907-AP-010) for 40 min at 37 C. Heat inactivated -APRIL (HI APRIL) was used in the assay to confirm the specificity of A-APRIL-induced NFkB signal (heat inactivation was performed by treatment of -APRIL at 60 C. for 1 h). At the end of incubation time, cells were harvested, washed, lysed, and processed according to the manufacturer's protocol of the Nuclear Extract Kit (Active Motif, #40410). Protein extracts were analyzed for NF-B activity using a TransAm NFB p65 Chemi Assay kit (Active Motif, #40097) following manufacturer's instructions. Luminescent signal was read using the Spectra Max M5 luminometer (Molecular Devices).

    Example 1H. Screening Anti-BCMA Antibodies to Select Antibodies not Affected by 100 ng/mL, Preferably 1000 ng/mL of APRIL or BAFF in their Binding to BCMA and that Neither Promote Nor Block Signaling Via the BCMA Intracellular Domain

    [0244] The invention relates to the generation of an anti-human BCMA antibody that 1) binds to human BCMA, 2) binding to BCMA is not affected by 100 ng/mL, preferably 1000 ng/mL of APRIL and BAFF, 3) does not block or reduce >20%, preferably >15% or increase >20%, preferably >15% APRIL-dependent NF-B activation, 4) does not block or reduce >20%, preferably >15% or increase >20%, preferably >15% BAFF-dependent NF-B activation, 5) does not induce NF-B activation by itself, without APRIL or BAFF. Table 10 shows the screening paradigm for selection of a BCMA antibody with desired new properties: non-ligand binding/blocking, non-ligand competing. Importantly, antibodies are selected whose binding to BCMA is not blocked by APRIL or by BAFF.

    Example 1H1. Binding to BCMA on HEK293-BCMA Cells, Plate-Bound BCMA or BCMA-Positive Multiple Myeloma Cell Lines (Flow Cytometry and ELISA)

    [0245] a) Anti-BCMA antibodies coming either from the immunization approach and/or from the screening of the recombinant in vitro library described above are analyzed by flow cytometry for binding to human BCMA on HEK293-BCMA cells. Briefly, cultured cells are harvested, counted and cell viability is evaluated using the Trypan Blue exclusion method. Viable cells are then adjusted to 210.sup.6 cells per ml in BSA-containing FACS Stain Buffer (BD Biosciences). 90 l of this cell suspension are further aliquoted per well into a round-bottom 96-well plate. 10 l of the anti-BCMA antibodies or corresponding IgG control are added to the cell-containing wells to obtain final concentrations of 0.1 pM to 200 nM. All constructs and control IgG are used at the same molarity. After incubation for 30 min at 4 C., the cells are centrifuged (5 min, 350g), washed with 150 l/well FACS Stain Buffer (BD Biosciences), resuspended and incubated for an additional 30 min at 4 C. with 12 l/well fluorochrome-conjugated AffiniPure F(ab)2 Fragment goat anti-human IgG Fc Fragment Specific (Jackson Immuno Research Lab; working solution: 1:20). Cells are then washed with Stain Buffer (BD Biosciences) 120 l/well and pelleted down by centrifugation at 350g for 5 min. A second washing step is performed using FACS Stain Buffer 150 l/well. The samples are resuspended in 200 l/well FACS Stain Buffer and acquired and analyzed using an LSR II flow cytometer with FACSDiva software (BD Biosciences). The mean fluorescence intensity is plotted as a function of anti-BCMA antibody concentration to obtain the binding curve and to calculate the effective antibody concentration to reach 50% of maximal binding (EC.sub.50). Anti-BCMA antibodies that bind to BCMA on cells as judged from this assay are selected for the next screening step, namely the competition BCMA binding assay against APRIL and BAFF (step (Example 1H2) below).

    [0246] The properties of antibodies that show binding to human BCMA on HEK293-BCMA cells are confirmed using an ELISA method as described by Ryan et al. (2007). Briefly, immunosorb 96-well plates are coated with 1.5 g/mL of GST-BCMA-ECD, washed with PBS+1% Tween (PBS-T), and blocked with PBS-T plus 1% serum albumin. BCMA-coated plates are incubated with hybridoma culture supernatants for 2 h at room temperature, washed 5 times with PBS-T, and incubated with peroxidase-conjugated goat-anti-rat IgG. Following incubation with secondary antibody, plates are washed, incubated with 3,3,5,5-tetramethylbenzidine substrate, and stopped with an equal volume of 1 mol/L H.sub.2SO.sub.4.

    [0247] b) Anti-BCMA IgG antibodies (clones 13C2, 17A5, 83A10, 13A4, 13D2, 14E1, 13A7, 14B11) were analyzed by flow cytometry for binding to human BCMA on BCMA-expressing H929 cells. MKN45 (human gastric adenocarcinoma cell line that does not express BCMA) was used as negative control. Briefly, cultured cells are harvested, counted and cell viability was evaluated using ViCell. Viable cells are then adjusted to 210.sup.6 cells per ml in BSA-containing FACS Stain Buffer (BD Biosciences). 100 l of this cell suspension were further aliquoted per well into a round-bottom 96-well plate and incubated with 30 l of the anti-BCMA antibodies or corresponding IgG control for 30 min at 4.sup.0c. All anti-BCMA antibodies (and isotype control) were titrated and analyzed in final concentration range between 0.1-40 ug/ml. Cells were then centrifuged (5 min, 350g), washed with 120 l/well FACS Stain Buffer (BD Biosciences), resuspended and incubated for an additional 30 min at 4 C. with fluorochrome-conjugated PE-conjugated AffiniPure F(ab)2 Fragment goat anti-human IgG Fc Fragment Specific (Jackson Immuno Research Lab; 109-116-170). Cells were then washed twice with Stain Buffer (BD Biosciences), fixed using 100 ul BD Fixation buffer per well (#BD Biosciences, 554655) at 4 C. for 20 min, resuspended in 120 l FACS buffer and analyzed using BD FACS Cantoll. FIG. 4 shows the mean fluorescence intensity for anti-BCMA IgG clones plotted in function of anti-BCMA antibody concentration; (A) clones 13C2, 17A5, 83A10 on H929 cells, (B) clones 13C2, 17A5, 83A10 on MKN45 cells, (C) clones 13A4, 13D2, 14E1, 13A7, 14B11 on H929 cells (D) clones 13A4, 13D2, 14E1, 13A7, 14B11 on MKN45 cells. EC50 values (denoting the antibody concentration required to reach 50% of the maximal binding) for the binding of clones 13C2, 17A5, 83A10 to H929 cells are summarized in Table 7.

    TABLE-US-00009 TABLE 7 EC50 values for binding of anti-BCMA antibodies to H929 multiple myeloma cells Anti-BCMA Anti-BCMA Anti-BCMA antibody clone antibody clone antibody clone 13C2 83A10 17A5 EC50 (nM) 13.9 12.5 9.0 EC50 (ug/ml) 2.0 1.8 1.3

    Example 1H2. 100 ng/mL, Preferably 1000 ng/mL of APRIL or BAFF does not Alter BCMA Antibody Binding to Human-BCMA (Flow Cytometry and ELISA)

    [0248] a) Anti-BCMA antibodies selected from step (Example 1H1) above are then analyzed by flow cytometry for binding to human BCMA on HEK293-BCMA cells in the presence and absence of 100 ng/mL, preferably 1000 ng/mL APRIL or BAFF. Viable 293-BCMA cells are adjusted to 210.sup.6 cells per ml in BSA-containing FACS Stain Buffer (BD Biosciences). 90 l of this cell suspension are further aliquoted per well into a round-bottom 96-well plate. 10 l of the anti-BCMA antibodies or corresponding IgG control are added to the cell-containing wells to obtain final concentrations of 0.1 pM to 200 nM. All constructs and control IgG are used at the same molarity. After incubation for 30 min at 37 C., in the presence and absence of 100 ng/ml, preferably 1000 ng/mL of APRIL and BAFF, respectively, the cells are centrifuged (5 min, 350g), washed with 150 l/well FACS Stain Buffer (BD Biosciences), resuspended and incubated for an additional 30 min at 4 C. with 12 l/well fluorochrome-conjugated AffiniPure F(ab)2 Fragment goat anti-human IgG Fc Fragment Specific (Jackson Immuno Research Lab; working solution: 1:20). Cells are then washed with Stain Buffer (BD Biosciences) 120 l/well and pelleted down by centrifugation at 350g for 5 min. A second washing step is performed using FACS Stain Buffer 150 l/well. The samples are resuspended in 200 l/well FACS Stain Buffer and acquired and analyzed using an LSR II flow cytometer with FACSDiva software (BD Biosciences). The mean fluorescence intensity is plotted as a function of anti-BCMA antibody concentration to obtain the binding curve and to calculate the effective antibody concentration to reach 50% of maximal binding (EC.sub.50). One binding curve is done in the presence of APRIL, another in its absence, and the same is done for presence and absence of BAFF. Those antibodies whose binding to BCMA is not affected by 100 ng/ml, preferably 1000 ng/mL of APRIL and also is not affected by 100 ng/ml, preferably 1000 ng/mL of BAFF are selected for next steps below. Representative binding curves for antibodies that are non-competing with the ligands APRIL and BAFF for binding to BCMA and for antibodies that are competing with these ligands for binding to BCMA are shown in FIG. 1.

    [0249] The properties of antibodies that show binding to human BCMA on HEK293-BCMA cells in the presence of 100 ng/mL APRIL or BAFF are confirmed using an ELISA method as described by Ryan et al. (2007). Briefly, immunosorb 96-well plates are coated with 1.5 g/mL of GST-BCMA-ECD, washed with PBS+1% Tween (PBS-T), and blocked with PBS-T plus 1% serum albumin. BCMA-coated plates are incubated with hybridoma culture supernatants for 2 h at room temperature, washed 5 times with PBS-T, and incubated with peroxidase-conjugated goat-anti-rat IgG. Following incubation with secondary antibody, plates are washed, incubated with 3,3,5,5-tetramethylbenzidine substrate, and stopped with an equal volume of 1 mol/L H.sub.2SO.sub.4. For plate-based ligand blockade, plates are coated with 1 g/mL of GST-BCMA-ECD as described above. Coated plates are preincubated with purified antibodies at the specified concentrations, washed with PBS-T, and then incubated with 3 g/mL of recombinant human MegaAPRIL (Alexis Biochemicals) or recombinant human BAFF (R&D Systems). APRIL or BAFF binding is detected using peroxidase-conjugated anti-FLAG followed by development with 3,3,5,5-tetramethylbenzidine as described above.

    [0250] b) Identification of non-APRIL-competing anti-BCMA Fabs or antibodies by ELISA. Binding of Fabs to immobilized human BCMA was assessed in the presence of increasing concentrations of murine APRIL. 25 nM biotinylated human BCMA (100 ul/well) were coated on a neutravidin plate and incubated on a shaker for 1h at room temperature. 500 nM or 1000 nM purified Fabs were added to saturate the coated human BCMA for 1h at room temperature. The plate was washed 3 times with PBS and murine APRIL was added at eight different concentrations using a two-fold dilution series in PBS buffer, ranging from 0 to 100 nM, and incubated on a shaker for 30 min. The plate was washed 3 times with PBS and anti-FLAG-HRP secondary antibody (1:4000) was added for 1h. Again, the plate was washed 3 times with PBS and developed by adding 100 ul/well BM Blue POD (Roche). The reaction was stopped by adding 50 ul/well 1M H2SO4 and the OD was read at 450 nm (reference at 650 nm) for a final read-out of OD450-650. Results for selected Fabs are shown in FIG. 5. The reduction (%) in OD values measured with the anti-BCMA clones in the absence vs. presence of 50 nM (1000 ng/mL) or 6.25 nM (140 ng/mL) muAPRIL is summarized in Table 8.

    TABLE-US-00010 TABLE 8 Reduction in OD values measured (450 nm) in absence vs. presence of muAPRIL Reduction () in OD values in presence of muAPRIL muAPRIL Anti-BCMA antibody clones (nM and ng/mL) 13C2 17A5 83A10 13A4 13D2 29B11 13A7 50 nM/1000 ng/mL 18.9% 34.5% 6.3% 13.1% 7.3% 67.3% 93.2% 6.25 nM/140 ng/mL no 5.6% no 7.7% 6.4% 12.1% 31.3%

    [0251] c) Competition of -APRIL with anti-BCMA antibodies detected by flow cytometry. The assessment of the eventual competition between -APRIL and anti-BCMA antibodies was performed on H929 cells by quantifying the binding of -APRIL in presence of increasing concentrations of anti-BCMA antibodies (clones 13C2, 17A5, 83A10, 13A4, 13D2, 14E1, 13A7, 14B11). Briefly, cultured cells were harvested, counted and cell viability evaluated using ViCell. Viable cells were adjusted to 110.sup.6 cells per ml in BSA-containing FACS Stain Buffer (BD Biosciences). 100 l of this cell suspension are further aliquoted per well into a round-bottom 96-well plate and incubated with 30 l of the anti-BCMA antibodies or corresponding IgG control for 30 min at 4 c. All anti-BCMA antibodies (and isotype control) are titrated and analyzed at final concentrations of 1, 16 and 40 ug/ml. Cells are then centrifuged (5 min, 350g), washed with 120 l/well FACS Stain Buffer (BD Biosciences), resuspended and incubated with 1 ug/ml recombinant mouse -APRIL tagged with hemagglutinin (HA) (R&D Systems Europe, #7907-AP-010) for additional 30 min at 4 C. Cells are then washed once with 120 l/well FACS Buffer and incubated with FITC-conjugated anti-HA antibody (Sigma Aldrich, #H7411) for 30 min at 4 C. At the end of incubation time, cells are washed with 120 l/well FACS Buffer, fixed using 100 ul BD Fixation buffer per well (#BD Biosciences, 554655) at 4 C. for 20 min, resuspended in 80 l FACS buffer and analyzed using BD FACS Fortessa. FIG. 6 shows the relative median fluorescence intensity of -APRIL (FITC signal) detected in function of increasing concentrations of anti-BCMA antibody clones 13A4, 13D2, 14E1, 13A7, 14B11 on H929 cells. The median fluorescence intensity upon binding of -APRIL in presence of the isotype control was set to one; the other signals were normalized to it.

    [0252] d) Competition of anti-BCMA antibodies with -APRIL detected by flow cytometry. The assessment of the eventual competition between -APRIL and anti-BCMA antibodies was performed on RPMI cells by quantifying the binding of anti-BCMA antibodies (clones 13A4, 13C2, 13D2, 14B11, 17A5, 83A10,) in presence or absence of -APRIL. Briefly, cultured cells were harvested, counted and cell viability evaluated using ViCell. Viable cells were adjusted to 110.sup.6 cells per ml in BSA-containing FACS Stain Buffer (BD Biosciences). 100 l of this cell suspension were further aliquoted per well into a round-bottom 96-well plate and incubated with 30 l of the anti-BCMA antibodies or corresponding IgG control for 20 min at 4 C. All anti-BCMA antibodies and isotype control were analyzed at final concentrations 40 ug/ml. Cells were then centrifuged (5 min, 350g), washed with 120 l/well FACS Stain Buffer (BD Biosciences), resuspended and incubated with 1 ug/ml recombinant mouse -APRIL tagged with hemagglutinin (HA) (R&D Systems Europe, #7907-AP-010) for additional 40 min at 4 C. Cells were then washed once with 120 l/well FACS Buffer and incubated with Alexa.Fluor 647-conjugated anti-human Fc antibody (Jackson Immuno Research Lab, #109-606-008) for 30 min at 4 C. At the end of incubation time, cells were washed with 120 l/well FACS Buffer, fixed using 100 ul BD Fixation buffer per well (#BD Biosciences, 554655) at 4 C. for 20 min, resuspended in 80 l FACS buffer and analyzed using BD FACS Fortessa. FIG. 7 shows the relative median fluorescence intensity of anti-BCMA antibody (Alexa.Fluor 647 signal) clones 13A4, 13C7, 13D2, 14B11, 17A5, 83A10 on RPMI cells detected in absence or presence of 1000 ng/mL of -APRIL. The median fluorescence intensity upon binding of anti-BCMA antibodies in absence of -APRIL was set to one; the other signals respective to the anti-BCMA antibody in presence of -APRIL were normalized to it.

    [0253] e) Competition of anti-BCMA antibodies with -APRIL after simultaneous incubation detected by flow cytometry. The assessment of the eventual competition between -APRIL and anti-BCMA antibodies was performed on H9292 cells by quantifying the binding of anti-BCMA antibodies (clones 14B11, 13D2, 13A4, 17A5, 83A10) in presence or absence of -APRIL. Briefly, cultured cells were harvested, counted and cell viability evaluated using ViCell. Viable cells were adjusted to 110.sup.6 cells per ml in BSA-containing FACS Stain Buffer (BD Biosciences). 100 l of this cell suspension were further aliquoted per well into a round-bottom 96-well plate and incubated with 30 l of the anti-BCMA antibodies or corresponding IgG control and 30 l of -APRIL tagged with hemagglutinin (HA) (R&D Systems Europe, #7907-AP-010) for 40 min at 4 C. All anti-BCMA antibodies and isotype control were analyzed at final concentrations 20 ug/ml; -APRIL at final concentrations 2.5 ug/ml. Cells were then centrifuged (5 min, 350g) and washed with 120 l/well FACS Stain Buffer (BD Biosciences). After that, cells were incubated with Alexa.Fluor 647-conjugated anti-human Fc antibody (Jackson Immuno Research Lab, #109-606-008) and FITC-conjugated anti-HA antibody (Sigma Aldrich, #H7411) for 30 min at 4 C. At the end of incubation time, cells were washed with 120 l/well FACS Buffer, fixed using 100 ul BD Fixation buffer per well (#BD Biosciences, 554655) at 4 C. for 20 min, resuspended in 80 l FACS buffer and analyzed using BD FACS Cantoll. FIG. 8A shows the mean fluorescence intensity and the relative fluorescence signal of the anti-BCMA antibody clone (Alexa.Fluor 647 signal) and FIG. 8B shows the mean fluorescence intensity and the relative fluorescence signal of -APRIL (FITC signal) and the anti-BCMA antibody clone (Alexa.Fluor 647 signal). Detection of anti-BCMA antibody in presence of -APRIL with FITC-conjugated anti-human Fc antibody was normalized to the signal of anti-BCMA antibody clone in absence -APRIL. Detection of -APRIL in presence of the anti-BCMA antibody clone with Alexa.Fluor 647-conjugated anti-HA antibody was normalized to -APRIL signal in presence of the isotype control. Reduction in binding of anti-BCMA antibodies (20 g/mL) clones 14B11, 13D2, 13A4, 17A5 and 83A10 in presence of A-APRIL (2.5 g/mL) as detected with fluorochrome-conjugated anti-human Fc antibody is summarized in Table 9.

    TABLE-US-00011 TABLE 9 Reduction in binding of anti-BCMA antibodies to H929 cells in presence of APRIL Anti-BCMA Reduction () in binding of anti-BCMA antibody clones antibodies in presence of APRIL 14B11 50% 13D2 25% 13A4 25% 17A5 20% 83A10 10%

    Example 1H3. BCMA Antibody does not Block or Increase APRIL-Dependent NF-B Activation

    [0254] a) Antibodies selected as non-competing in step (Example 1H2) above (i.e., their BCMA binding curve is not affected by the presence of 100 ng/ml, preferably 1000 ng/mL of APRIL and is also not affected by the presence of 100 ng/ml, preferably 1000 ng/mL of BAFF) are then tested in step (Example 1H3) for effects on APRIL, BAFF, and BCMA mediated NF-B activation. As APRIL is the high affinity ligand to BCMA, the blocking or agonist properties of anti-BCMA antibodies on APRIL signaling is first examined. As described in Ryan 2007 (Mol Cancer Ther; 6 (11): 3009-18), to verify whether anti-BCMA antibodies block or increase APRIL downstream signaling, NCI-H929 human multiple myeloma (MM) cells are washed and incubated in serum free RPMI for 24 h before treatment. The cells are then untreated or treated with 0.1 g/mL TNF- (used as positive control), 100 ng/mL, preferably 1000 ng/mL heat-treated HT-truncated-APRIL, 100 ng/mL, preferably 1000 ng/mL truncated-APRIL, 0.1 pM to 200 nM isotype control, or 0.1 pM to 200 nM anti-BCMA antibodies for 20 min. To evaluate APRIL blockade, cells pre-treated for 20 min with 0.1 pM to 200 nM of anti-BCMA antibodies or a respective isotype control antibody are treated with 100 ng/mL, preferably 1000 ng/mL of truncated-APRIL. Cells are then harvested, washed, and lysed with 50 mmol/L Tris-HCl (pH 7.5), 1% NP.sub.40, 150 mmol/L NaCl, 1 mmol/L EDTA, 1 mmol/L EGTA supplemented with protease, and phosphatase inhibitors. Protein extracts are then analyzed for NF-B activity using a TransAM chemiluminescent assay kit (Active Motif) and the luminescent signal reading is performed with a Fusion HT plate reader (Packard Instruments).

    [0255] As NF-B activity is assayed using a functional ELISA that detects chemiluminescent signal from p65 bound to the NF-B consensus sequence, anti-BCMA antibodies that do not alter APRIL-mediated downstream signaling and NF-B activation (i.e. that the mean luminescent signal detected by ELISA in nuclear extracts from NCI-H929 MM cells treated with APRIL alone is similar, not significantly reduced or increased, to that of nuclear extracts from NCI-H929 MM cells treated with APRIL and anti-BCMA antibodies) are selected for the next steps below.

    [0256] b) It was assessed whether binding of anti-BCMA antibodies (clones 13C2, 17A5, 83A10, 13A4, 13D2, 14B 11) interferes with APRIL-induced NFkB activation, a known signaling pathway downstream of BCMA. Briefly, H929 cells were starved in RPMI1640 with 0.25% FCS for 24 h at 37 C. in cell incubator. At the end of the starvation time, cells were harvested, counted and cell viability evaluated using ViCell. Viable cells were adjusted to 410.sup.6 cells per ml in BSA-containing FACS Stain Buffer (BD Biosciences). 30 l of this cell suspension were further aliquoted per well into a round-bottom 96-well plate and pre-incubated with anti-BCMA antibodies (15 or 50 ug/ml) or isotype control antibodies (10, 20 and 40 ug/ml) for 20 min in cell incubator. Cells were then supplemented with 1 ug/ml recombinant mouse -APRIL tagged with hemagglutinin (HA) (R&D Systems Europe, #7907-AP-010) for 40 min at 37 C. Heat inactivated -APRIL (HI APRIL) was used in the assay to confirm the specificity of -APRIL-induced NFkB signal (heat inactivation was performed by treatment of A-APRIL at 60 C. for 1 h). At the end of incubation time, cells were harvested, washed, lysed, and processed according to the manufacturer's protocol of the Nuclear Extract Kit (Active Motif, #40410). Protein extracts were analyzed for NF-kB activity using a TransAm NfkB p65 Chemi Assay kit (Active Motif, #40097) following manufacturer's instructions. Luminescent signal was read using the Spectra Max M5 luminometer (Molecular Devices). The relative luminescence signal intensity obtained using H929 cells treated as described above was measured. The luminescence signal obtained upon binding of -APRIL in presence of the isotype control was set to one; the other signals were normalized to it.

    Example 1H4. BCMA Antibody does not Block or Increase BAFF-Dependent NF-B Activation

    [0257] Antibodies selected as non-blocking and non-increasing APRIL-dependent NF-B activation in step (Example 1H3) above are then tested in step (Example 1H3) for effects on BAFF mediated NF-B activation. As described in Ryan 2007, (Mol Cancer Ther; 6 (11): 3009-18), to verify whether BCMA antibodies block or increase BAFF downstream signaling leading to NF-B activation, NCI-H929 MM cells (CRL-9068) are washed and incubated in serum free RPMI medium for 24 h before treatment, as described in Ryan 2007, (Mol Cancer Ther; 6 (11): 3009-18), The cells are then untreated or treated with 0.1 g/mL TNF-, 100 ng/mL, preferably 1000 ng/mL heat-treated HT-truncated-BAFF, 100 ng/mL, preferably 1000 ng/mL truncated-BAFF, 1 to 0.1 pM to 200 nM isotype control, or 0.1 pM to 200 nM anti-BCMA antibodies for 20 min. To evaluate BAFF blockade, cells pre-treated for 20 min with 0.1 pM to 200 nM of anti-BCMA antibodies or a respective isotype control antibody are treated with 1 g/mL of truncated-BAFF. Cells are then harvested, washed, and lysed with 50 mmol/L Tris-HCl (pH 7.5), 1% NP40, 150 mmol/L NaCl, 1 mmol/L EDTA, 1 mmol/L EGTA supplemented with protease, and phosphatase inhibitors. Protein extracts are then analyzed for NF-B activity using a TransAM chemiluminescent assay kit (Active Motif) and the luminescent signal reading is performed with a Fusion HT plate reader (Packard Instruments). Anti-BCMA antibodies that do not alter BAFF-mediated downstream signaling and NF-B activation (i.e. that the mean luminescent signal from p65 bound to the NF-B consensus sequence detected by ELISA in nuclear extracts from NCI-H929 MM cells treated with BAFF alone is similar, not significantly reduced or increased, to that of nuclear extracts from NCI-H929 MM cells treated with BAFF and anti-BCMA antibodies) are selected for the next steps below.

    Example 1H5. BCMA Antibody does not Induce NF-B Activation by Itself

    [0258] a) Antibodies selected as non-blocking and non-increasing BAFF-dependent NF-B activation in step (Example 1H4) above are then tested in step (Example 1H5) for their intrinsic agonistic effects to mediate NF-B activation. To verify whether BCMA antibodies are agonistic and induce downstream signaling by themselves, NCI-H929 cells are washed and incubated in serum-free RPMI medium for 24 h before treatment. The cells are then untreated or treated with 0.1 g/mL TNF-, 0.1 pM to 200 nM isotype control or 0.1 pM to 200 nM anti-BCMA antibodies for 20 min. Cells are then harvested, washed, and lysed with 50 mmol/L Tris-HCl (pH 7.5), 1% NP.sub.40, 150 mmol/L NaCl, 1 mmol/L EDTA, 1 mmol/L EGTA supplemented with protease, and phosphatase inhibitors. Protein extracts are then analyzed for NF-B activity using a TransAM chemiluminescent assay kit (Active Motif) and the luminescent signal reading is performed with a Fusion HT plate reader (Packard Instruments). Anti-BCMA antibodies that do not induce downstream signaling and NF-B activation (i.e. that the mean luminescent signal from p65 bound to the NF-B consensus sequence detected by ELISA in nuclear extracts from NCI-H929 MM cells treated with anti-BCMA antibodies alone is similar, not significantly increased, to that of nuclear extracts from NCI-H929 MM cells treated with isotype control antibody) are finally selected for further production and in vitro and in vivo characterization. They represent the anti-BCMA antibodies that are non-ligand blocking, non-competing, and non-signaling (see Table 10).

    [0259] b) It was assessed whether binding of anti-BCMA antibodies (clones 13C2, 17A5, 83A10, 13A4, 13D2, 14B11) to BCMA-expressing H929 cells induces NFkB activation, a known signaling pathway downstream of BCMA. Briefly, H929 cells were starved in RPMI1640 with 0.25% FCS for 24 h at 37 C. in cell incubator. At the end of the starvation time, cells were harvested, counted and cell viability evaluated using ViCell. Viable cells were adjusted to 410.sup.6 cells per ml in BSA-containing FACS Stain Buffer (BD Biosciences). 30 l of this cell suspension were further aliquoted per well into a round-bottom 96-well plate and incubated with 30 l of the anti-BCMA antibodies at 100 or 350 nM (14 or 50 ug/ml) for 20 min at 37 C. As negative controls, cells were either left untreated or incubated with the corresponding IgG isotype control antibodies 100 nM (14 ug/ml) for 20 min at 37 C. As positive controls, cells were incubated with 1 ug/ml recombinant mouse -APRIL tagged with hemagglutinin (HA) (R&D Systems Europe, #7907-AP-010) for 20 min at 37 C. At the end of incubation time, cells were harvested, washed, lysed, and processed according to the manufacturer's protocol of the Nuclear Extract Kit (Active Motif, #40410). Protein extracts were analyzed for NF-kB activity using a TransAm NfkB p65 Chemi Assay kit (Active Motif, #40097) following manufacturer's instructions. Luminescent signal was read using the Spectra Max M5 luminometer (Molecular Devices). The relative luminescence signal intensity obtained from H929 cells treated as described above was measured. The luminescence signal obtained upon binding of -APRIL in presence of the isotype control was set to one; the other signals were normalized to it.

    TABLE-US-00012 TABLE 10 Screening paradigm for BCMA antibody selection Evaluation step (in chronologic order) Selection criteria Description of technique 1) Binding to BCMA Binding Binding to plate-bound-BCMA cells (ELISA) 2) Binding to BCMA not reduced by 100 No reduction Binding to plate-bound-BCMA ng/mL, preferably 1000 ng/mL APRIL or is not affected by 100 ng/mL, BAFF preferably 1000 ng/mL of APRIL or BAFF (ELISA) 3) Non-Activation of NF-B downstream No change in all APRIL/BAFF-dependent signaling three cases activation in MM cell line NCI- 3.1) Does anti-BCMA antibody block or H929 (chemiluminescent increase APRIL-dependent NF-B ELISA) activation? 3.2) Does anti-BCMA antibody block or increase BAFF-dependent NF-B activation? 3.3) Does anti-BCMA antibody induce NF-B activation by itself?

    Example 1H6. BCMA Antibody is Crossreactive to Cynomolgus Monkey

    [0260] Human BCMA antibodies generated in Example 1 are also tested for their crossreactivity to cynomolgus monkey and ability to bind to cynomolgus monkey plasma cells. Briefly, PBMC and/or bone marrow aspirates are collected from cynomolgus monkeys and cells are cultured, counted and cell viability is evaluated using the Trypan Blue exclusion method. Viable cells are then adjusted to 210.sup.6 cells per ml in PBS containing 0.1% BSA. 90 l of this cell suspension are further aliquoted per well into a round-bottom 96-well plate. 10 l of BCMA antibody or corresponding IgG control are added to the cell-containing wells to obtain final concentrations of 0.1 pM to 200 nM. BCMA antibodies and control IgG are used at the same molarity. After incubation for 30 min at 4 C., cells are centrifuged (5 min, 350g), washed with 150 l/well BSA-containing FACS Stain Buffer (BD Biosciences), resuspended and incubated for an additional 30 min at 4 C. with 12 l/well fluorochrome-conjugated anti-His antibody (Lucerna) for detection of the BCMA antibody. Cynomolgus monkey cells are also stained with fluorochrome-conjugated CD38, CD19 and CD20 antibodies. Cells are then washed by addition of 120 l/well FACS Stain Buffer and centrifugation at 350g for 5 min. A second washing step is performed with 150 l/well FACS Stain Buffer. The samples are resuspended in 200 l/well FACS Stain Buffer, acquired and analyzed using an LSR II flow cytometer with FACSDiva software (BD Biosciences). Binding of the BCMA antibody to CD38.sup.+ CD19.sup.lo CD20.sup. plasma cells is then evaluated and the mean fluorescence intensity is determined gated on either CD38.sup.+ CD19.sup.lo CD20.sup. plasma cells or total CD19.sup.+ B cells and plotted in histograms or dot plots.

    Example 2Production of Therapeutic Anti-BCMA Antibodies that do not Block Ligand (APRIL, BAFF) Binding and Neither Promote Nor Block Signaling Via the BCMA Intracellular Domain and Whose Binding to BCMA is not Affected by 100 ng/ml, Preferably 1000 ng/mL of APRIL or by 100 ng/ml, Preferably 1000 ng/mL of BAFF

    [0261] If the selected antibodies after step (Example 1H6) above are derived from the in vitro selection out of the recombinant antibody library, then they are already unconjugated human IgG1 antibodies. Those selected antibodies after step (Example 1H6) above that are derived from immunization are in a rat-human chimeric format and are then preferably humanized to be able to apply them for therapy. In that case, standard antibody humanization methods are applied by transferring the complementarity-determining regions of those rat variable regions into human antibody variable region frameworks. Additional mutations are introduced into the variable regions, if necessary, to recover binding to BCMA as compared to the chimeric, parental antibody.

    Example 2A. Production of Therapeutic Anti-BCMA Antibodies

    [0262] For the production of unconjugated IgG1 antibodies mediating ADCC (e.g. glycoengineered antibody) (see Example 3A below) or conjugated antibodies delivering a cytotoxic small molecule moiety (e.g. antibody-drug conjugate) (see Example 4A below), the cells are co-transfected with four plasmids, two for antibody expression (one for expression of the heavy chain of the antibody and another for expression of the light chain of the antibody), one GnTIII expression, and one for mannosidase II expression at a ratio of 4:4:1:1, respectively. Cells are grown as adherent monolayer cultures in T flasks using DMEM culture medium supplemented with 10% FCS, and are transfected when they are between 50 and 80% confluent. For the transfection of a T75 flask, 8 million cells are seeded 24 hours before transfection in 14 ml DMEM culture medium supplemented with FCS (at 10% V/V final), 250 g/ml neomycin, and cells are placed at 37 C. in an incubator with a 5% CO.sub.2 atmosphere overnight. For each T75 flask to be transfected, a solution of DNA, CaCl.sub.2 and water is prepared by mixing 47 g total plasmid vector DNA divided equally between the light and heavy chain expression vectors, 235 l of a 1M CaCl2 solution, and adding water to a final volume of 469 l. To this solution, 469 l of a 50 mM HEPES, 280 mM NaCl, 1.5 mM Na.sub.2HPO.sub.4 solution at pH 7.05 are added, mixed immediately for 10 sec and left to stand at room temperature for 20 sec. The suspension is diluted with 12 ml of DMEM supplemented with 2% FCS, and added to the T75 in place of the existing medium. The cells are incubated at 37 C., 5% CO.sub.2 for about 17 to 20 hours, then medium is replaced with 12 ml DMEM, 10% FCS. The conditioned culture medium is harvested 5 to 7 days post-transfection centrifuged for 5 min at 1200 rpm, followed by a second centrifugation for 10 min at 4000 rpm and kept at 4 C.

    [0263] For the production of the antibody for T cell bispecifics (see Example 5 below), the cells are co-transfected with two plasmids, (one for expression of the heavy chain of the antibody and another for expression of the light chain of the antibody), at a ratio of 1:1, respectively. Cells are grown as adherent monolayer cultures in T flasks using DMEM culture medium supplemented with 10% FCS, and are transfected when they are between 50 and 80% confluent. For the transfection of a T75 flask, 8 million cells are seeded 24 hours before transfection in 14 ml DMEM culture medium supplemented with FCS (at 10% V/V final), 250 g/ml neomycin, and cells are placed at 37 C. in an incubator with a 5% CO.sub.2 atmosphere overnight. For each T75 flask to be transfected, a solution of DNA, CaCl.sub.2 and water is prepared by mixing 47 g total plasmid vector DNA divided equally between the light and heavy chain expression vectors, 235 l of a 1M CaCl.sub.2 solution, and adding water to a final volume of 469 l. To this solution, 469 l of a 50 mM HEPES, 280 mM NaCl, 1.5 mM Na.sub.2HPO.sub.4 solution at pH 7.05 are added, mixed immediately for 10 sec and left to stand at room temperature for 20 sec. The suspension is diluted with 12 ml of DMEM supplemented with 2% FCS, and added to the T75 in place of the existing medium. The cells are incubated at 37 C., 5% CO.sub.2 for about 17 to 20 hours, then medium is replaced with 12 ml DMEM, 10% FCS. The conditioned culture medium is harvested 5 to 7 days post-transfection centrifuged for 5 min at 1200 rpm, followed by a second centrifugation for 10 min at 4000 rpm and kept at 4 C.

    [0264] The secreted antibodies are purified by Protein A affinity chromatography, followed by cation exchange chromatography and a final size exclusion chromatographic step on a Superdex 200 column (Amersham Pharmacia) exchanging the buffer to phosphate buffer saline and collecting the pure monomeric IgG1 antibodies. Antibody concentration is estimated using a spectrophotometer from the absorbance at 280 nm. The antibodies were formulated in a 25 mM potassium phosphate, 125 mM sodium chloride, 100 mM glycine solution of pH 6.7.

    Example 3. Unconjugated IgG1 Antibodies Mediating ADCC

    Example 3A. Generation of Fc Engineered IgG1

    [0265] Fc engineered IgG1 antibodies generated in Example 2A do not require additional step and are ready for in vitro testing in step Example 3B.

    Example 3B. In Vitro Testing of Unconjugated IgG1 Antibodies: ADCC

    [0266] ADCC competency of anti-BCMA unconjugated IgG1 generated in Example 2A (see above) towards MM tumor cells, the target cells, is determined in cellular assays. Human PBMC are used as effector cells and are prepared using density gradient centrifugation with Cell Preparation Tubes with Sodium citrate (Vacutainer CPT tubes, BD) according to the manufacturer's instructions. In brief, venous blood is collected directly in Vacutainer CPT tubes. The gradient is centrifuged at 400g for 30 min at room temperature (RT) without breaks. The interphase containing the PBMC is collected and washed with PBS (50 ml per cells from two gradients) and harvested by centrifugation at 300g for 10 minutes at RT. After resuspension of the pellet with PBS, the PBMC are counted and washed a second time by centrifugation at 200g for 10 minutes at RT. The cells are then resuspended in the appropriate medium for the subsequent procedures.

    [0267] The effector to target ratio used for the ADCC assays is 25:1 for PBMC. The effector cells are prepared in AIM-V medium at the appropriate concentration in order to add 50 l per well of round bottom 96 well plates. Target cells are human BCMA expressing cells (e.g., NCI-H929) grown in RPMI-1640 supplemented with 10% fetal bovine serum. Target cells are washed in PBS, counted and resuspended in complete RPMI-1640 at 0.3 million per ml in order to add 30,000 cells in 100 l per microwell. Antibodies are diluted in complete RPMI-1640, added in 50 l to the pre-plated target cells and allowed to bind to the targets for 10 min at room temperature. Then the effector cells are added and the plate is incubated for 4 hours at 37 C. in a humidified atmosphere containing 5% CO.sub.2. Killing of target cells is assessed by measurement of lactate dehydrogenase (LDH) release from damaged cells using the Cytotoxicity Detection kit (Roche Diagnostics). After the 4-hour incubation the plates are centrifuged at 800g. 100 l supernatant from each well is transferred to a new transparent flat bottom 96 well plate. 100 l color substrate buffer from the kit are added per well. The Vmax values of the color reaction are determined in an ELISA reader at 490 nm for at least 10 min using SOFTmax PRO software (Molecular Devices). Spontaneous LDH release is measured from wells containing only target and effector cells but no antibodies. Maximal release is determined from wells containing only target cells and 1% Triton X-100. Percentage of specific antibody-mediated killing is calculated as follows: ((xSR)/(MRSR)*100, where x is the mean of Vmax at a specific antibody concentration, SR is the mean of Vmax of the spontaneous release and MR is the mean of Vmax of the maximal release.

    Example 4. Conjugated Antibodies Delivering a Cytotoxic Small Molecule Moiety

    Example 4A. Generation of Antibody Drug-Conjugates

    [0268] Unconjugated IgG1 antibodies mediating ADCC generated in step Example 2A are further synthesized. Maleimidocaproyl-valine-citrulline-p-aminobenzoyl-monomethyl auristatin F (vcMMAF) is synthesized and conjugated to cysteine residues on IgG1 antibodies selected after step (e) above after DTT reduction as previously described in Ryan, 2007 (Mol Cancer Ther; 6 (11): 3009-18) and Doronina 2006 (Bioconjug Chem 17: 144-24).

    Example 4B. In Vitro Testing of Antibody Drug Conjugate: Cytotoxicity Assay

    [0269] BCMA-expressing NCI-H929 multiple myeloma target cells are plated at 5,000 per well in round-bottom 96-well plates in the presence or absence of antibody or antibody-drug conjugates and incubated at 37 C., 5% CO.sub.2. Cell viability is assessed 96 h after exposure to antibody or antibody-drug conjugates using a luminescent cell viability assay (CellTiter-Glo, Promega). Reading of luminescent signal is performed using a Fusion HT plate reader (Packard Instruments). The concentration of antibody-drug conjugate is then plotted against the mean luminescent signal as dose-response curve. The IC.sub.50 values are determined as the antibody-drug conjugate concentration that results in 50% of cell viability of the untreated control wells (Prism, GraphPad).

    Example 5Generation of Anti-BCMA/Anti-CD3 T Cell Bispecific Antibodies

    Example 5A. Generation of Anti-CD3 Antibodies

    [0270] The following protein sequences of the VH and VL regions are used to generate human and cynomolgus monkey cross reactive CD3E antibodies as described in WO2007/04 2261.

    TABLE-US-00013 H2C_VH(SEQIDNO:7): EVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVAR IRSKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVR HGNFGNSYISYWAYWGQGTLVTVSS H2C_VL(SEQIDNO:8) QTVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGYYPNWVQQKPGQAPRGLI GGTKFLAPGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCALWYSNRWVF GGGTKLTVL

    [0271] Briefly, for T cell bispecific without Fc (see Example 5B below) oliogonucleotides encoding the above sequences are joined together via PCR to synthesize a gene encoding a single-chain Fv (ScFv) where the VH are VL sequences are joined by a flexible linker containing serine and glycine residues as described in WO2007/042261. The fragments are joined in the anti-CD3-VL anti CD3VH orientation. This is called the anti-CD3 ScFv.

    [0272] Briefly, for T cell bispecific with Fc (see Example 5C below) oliogonucleotides encoding the above sequences are joined together via PCR to synthesize cDNAs encoding the VH are VL sequences, respectively, of the anti-CD3 antibody.

    Example 5B. Generation of Anti-BCMA/Anti-CD3 T Cell Bispecific Antibodies without Fc

    Example 5B1. Generation of Anti-BCMA/Anti-CD3 T Cell Bispecific: Two scFvs Fusion Proteins

    Example 5B1a. Generation of Anti-BCMA ScFvs

    [0273] cDNA fragments encoding a single-chain Fv (ScFv) are generated for each of the anti-BCMA-IgG1 antibodies that do not block ligand (APRIL, BAFF) binding and neither promote nor block signaling via the BCMA intracellular domain and whose binding to BCMA is not affected by 100 ng/ml preferably 1000 ng/mL of APRIL or by 100 ng/ml preferably 1000 ng/mL of BAFF, i.e., for the human IgG1 antibodies selected antibody selected after step (Example 1H6) of Example 1 above and for the humanized IgG1 antibodies generated after step (Example 2) above. This is done by PCR amplication of the cDNA segments encoding the respective VH and VL regions of each antibody. In each case the VH and VL regions are joined by an 18 amino acid linker, as disclosed in WO 2004106383, using primers similar to the ones described there. The fragments are cloned in the VH anti-BCMA-VL anti-BCMA orientation.

    Example 5B1b. Cloning of VH Anti-BCMA-VL Anti-BCMA Orientation Constructs

    [0274] cDNAs encoding anti-CD3anti-BCMA bispecific antibodies are generated for each of the anti-BCMA antibodies in step (Example 5B1a) above by joining in frame the sequences of the respective ScFv described in step (Example 5B1a) above with the sequence of the anti-CD3 ScFv described in step (Example 3A) above. Cloning is done in VH anti-CD3-VL anti CD3VH anti-BCMA-VL anti-BCMA orientation. A mammalian leader peptide encoding sequence is added in frame to each of the cDNAs encoding the anti-CD3anti-BCMA bispecific antibodies and each final construct is subsequently subcloned into a mammalian expression vector. The same vector and transfection method used for the IgG1 antibodies as described in Example 1 above is used. Alternatively, each final construct encoding the anti-CD3anti-BCMA bispecific antibodies including a leader sequence is subcloned into the mammalian expression vector pEFDHFR (as described in WO20041106383) and the bispecific antibodies are produced as described below in step (Example 5B1c).

    Example 5B1c. Expression and Characterization of the Bispecific Single Chain Binding Agent

    [0275] After confirmation of the desired sequence by DNA sequencing, each construct obtained in 5B1b is transfected, e.g. into dehydrofolate reductase negative CHO cells, and expressed for characterisation as described in WO20041106383. For example, for binding to Jurkat cells (ATCC) for CD3 and NCI-H929 (ATCC) for BCMA a flow cytometry experiment is performed. The cells are incubated with the supernatant of BCMA/CD3 bispecific construct expressing cells for approximately 1 h at 4 C., washed 2 in FACS buffer (phosphate-buffered saline containing fetal calf serum and 0.05 sodium azide) and bound construct is detected via the 6HIS tag incorporated in the expression vector pEFDHFR using a HIS antibody e.g. (Dianova). For the detection of bound anti-HIS antibody the cells are washed as described above and incubated with e.g. goat anti-mouse-FITC-conjugated antibody (BD 550003) or with anti-mouse-PE conjugated antibody (IgG) (Sigma, P8547) and analysed e.g. on a FACS Canto (BD Biosciences). The functional activity of the constructs is then analysed using a flow cytometry based assay after the constructs have been purified by a two-step purification process including immobilized metal affinity chromatography (IMAC) and gel filtration as described in WO20041106383, but using a CHO cell line transfected with a DNA construct expressing full-length BCMA on the surface.

    Example 5C. Generation of Anti-BCMA/Anti-CD3 T Cell Bispecific 1+1 Format with Fc

    [0276] Anti-BCMA/anti-CD3 T cell bispecific are produced for the human or humanized anti-BCMA antibodies selected after step (Example 1H6). cDNAs encoding the full heavy and light chains of the corresponding anti-BCMA IgG1 antibodies, as described in Example 2, as well as the anti-CD3 VH and VL cDNAs describe in Example 3A, are used as the starting materials. For each bispecific antibody, four protein chains are involved comprising the heavy and light chains of the corresponding anti-BCMA antibody and the heavy and light chains of the anti-CD3 antibody described above, respectively. In order to minimize the formation of side-products with mispaired heavy chains, for example with two heavy chains of the anti-CD3 antibody, a mutated heterodimeric Fc region is used carrying knob-into-hole mutations and an engineered disulphide bond, as described in WO2009080251 and in WO2009080252. In order to minimize the formation of side-products with mispaired light chains, for example with two light chains of the anti-BCMA antibody, a CH1constant kappa crossover is applied to the heavy and light chains of the anti-CD3 antibody using the methodology described in WO2009080251 and in WO2009080252.

    [0277] Briefly, each bispecific antibody is produced by simultaneous cotransfection of four mammalian expression vectors encoding, respectively: a) the full light chain cDNA of the corresponding BCMA antibody, b) the full heavy chain cDNA of the corresponding BCMA antibody carrying the hole mutations in the Fc region to produce a heterodimeric antibody (see details below), c) a fusion cDNA generated by standard molecular biology methods, such as splice-overlap-extension PCR, encoding a fusion protein made of (in N- to C-terminal order) secretory leader sequence, VL of the anti-CD3 antibody described above and human CH1 domain of an IgG1 antibody and d) a fusion cDNA generated by standard molecular biology methods, such as splice-overlap-extension PC, encoding a fusion protein made of (in N- to C-terminal order) secretory leader sequence, VH of the anti-CD3 antibody described above, constant kappa domain of a human light chain cDNA, hinge region of a human IgG1 antibody, and Fc region (CH2 and CH3 domains) of a human IgG1 antibody including a knob mutation (see details below) in the Fc region to produce a heterodimeric antibody. Co-transfection of mammalian cells and antibody production and purification using the methods described above for production of human or humanized IgG1 antibodies (see Example 2). The knob-into-hole mutations in the human IgG1 Fc region consist of: T366W, known as the knob mutation; and T366S, L368A, and Y407V, collectively known as the hole mutations. In addition, a disulfide can be included to increase the stability and yields as well as additional residues forming ionic bridges and increasing the heterodimerization yields (EP 1870459A1).

    Example 6Simultaneous Binding of Anti-BCMA/Anti-CD3 T Cell Bispecific Antibodies to BCMA and CD3 (Surface Plasmon Resonance)

    [0278] The binding properties to BCMA and CD3 of bispecific anti-BCMA/anti-CD3 T cell bispecific antibodies generated in Example 5 are analyzed by surface plasmon resonance (SPR) technology using a Biacore T100 instrument (Biacore AB) with HBS-EP as running buffer (0.01 M HEPES pH 7.4, 0.15 M NaCl, 3 mM EDTA, 0.005% Surfactant P20, Biacore). This system is well established for the study of molecule interactions. It allows a continuous real-time monitoring of ligand/analyte bindings and thus the determination of association rate constants (ka), dissociation rate constants (kd), and equilibrium constants (KD) in various assay settings. SPR-technology is based on the measurement of the refractive index close to the surface of a gold coated biosensor chip. Changes in the refractive index indicate mass changes on the surface caused by the interaction of immobilized ligand with analyte injected in solution. If molecules bind to immobilized ligand on the surface the mass increases, in case of dissociation the mass decreases.

    [0279] Capturing anti-His tag antibody is immobilized on the surface of a CM5 biosensorchip using amine-coupling chemistry. Flow cells are activated with a 1:1 mixture of 0.1 M N-hydroxysuccinimide and 0.1 M 3-(N,N-dimethylamino)propyl-N-ethylcarbodiimide at a flow rate of 5 l/min anti-human IgG antibody is injected in sodium acetate, pH 5.0 at 10 g/ml, which resulted in a surface density of approximately 12000 resonance units (RU). A reference control flow cell is treated in the same way but with vehicle buffers only instead of the capturing antibody. Surfaces are blocked with an injection of 1 M ethanolamine/HCl pH 8.5. The anti-BCMA/anti-CD3 T cell bispecific antibodies are diluted in HBS-P and injected at a flow rate of 5 l/min. The contact time (association phase) is 1 min for the antibodies at a concentration between 1 and 100 nM for the BCMA-ECD binding and 1 and 200 nM for the CD3 interaction. BCMA-ECD is injected at increasing concentrations of 3.125, 6.25, 12.5, 25, 50 and 100 nM, CD3 at concentrations of 0.21, 0.62, 1.85, 5.6, 16.7, 50, 100 and 200 nM. The contact time (association phase) is 3 min, the dissociation time (washing with running buffer) 5 min for both molecules at a flowrate of 30 l/min. All interactions are performed at 25 C. (standard temperature). The regeneration solution of 3 M Magnesium chloride is injected for 60 s at 5 l/min flow to remove any non-covalently bound protein after each binding cycle. Signals are detected at a rate of one signal per second. Samples are injected at increasing concentrations. SPR graphs showing the rate of signal (i.e. resonance unit) plotted against contact time are determined.

    Example 7Binding of Anti-BCMA/Anti-CD3 T Cell Bispecific Antibodies to BCMA on MM Cells or CD3 on T Cells (Flow Cytometry)

    [0280] Anti-BCMA/anti-CD3 T cell bispecific antibodies generated in Example 5 are also analyzed by flow cytometry for their binding properties to human BCMA expressed on NCI-H929 multiple myeloma cells or human CD3 expressed on human leukemic T cells Jurkat (ATCC). Briefly, cultured cells are harvested, counted and cell viability is evaluated using the Trypan Blue exclusion method. Viable cells are then adjusted to 210.sup.6 cells per ml in PBS containing 0.1% BSA. 90 l of this cell suspension are further aliquoted per well into a round-bottom 96-well plate. 10 l of the T cell bispecific antibody or corresponding IgG control are added to the cell-containing wells to obtain final concentrations of 0.1 pM to 200 nM. Anti-BCMA/anti-CD3 T cell bispecific antibodies and control IgG are used at the same molarity. After incubation for 30 min at 4 C., cells are centrifuged (5 min, 350g), washed with 150 l/well BSA-containing FACS Stain Buffer (BD Biosciences), resuspended and incubated for an additional 30 min at 4 C. with 12 l/well fluorochrome-conjugated anti-His antibody (Lucerna) for detection of the T cell bisepecific antibody. Cells are then washed by addition of 120 l/well FACS Stain Buffer and centrifugation at 350g for 5 min. A second washing step is performed with 150 l/well FACS Stain Buffer. The samples are resuspended in 200 l/well FACS Stain Buffer, acquired and analyzed using an LSR II flow cytometer with FACSDiva software (BD Biosciences). Binding of the anti-BCMA/anti-CD3 T cell bispecific antibodies to MM cells and T cells are evaluated and the mean fluorescence intensity is determined gated on either BCMA-expressing NCI-H929 MM cells or CD3-expressing Jurkat T cells and plotted in histograms or dot plots.

    Example 8Activation of T Cells Upon Engagement of Anti-BCMA/Anti-CD3 T Cell Bispecific Antibodies (Flow Cytometry)

    [0281] Anti-BCMA/anti-CD3 T cell bispecific antibodies generated in Example 5 are also analyzed by flow cytometry for their potential to induce T cell activation by evaluating the surface expression of the early activation marker CD69, or the late activation marker CD25 on CD4.sup.+ and CD8.sup.+ T cells in the presence or absence of human BCMA-expressing MM cells. Briefly, BCMA-expressing NCI-H929 MM cells are harvested with Cell Dissociation buffer, counted and cell viability is verified using Trypan Blue. Viable MM cells are adjusted to 0.210.sup.6 cells/mL in complete RPMI-1640 medium, 100 l of this cell suspension per well is pipetted into a round-bottom 96-well plate. 50 l of the T cell bispecific constructs are added to the MM cells-containing wells to obtain a final concentration of 1 nM. The 96-well plate is set aside and kept at 37 C., 5% CO.sub.2 until further manipulations.

    [0282] PBMC are isolated from fresh blood using density gradient centrifugation using Cell Preparation Tubes with Sodium citrate (Vacutainer CPT tubes, BD Biosciences). Total human T cells are then isolated using the Pan T Cell Isolation Kit II (Miltenyi Biotec), according to the manufacturer's instructions. Human total T cells (effector) are then adjusted to 210.sup.6 cells per ml in complete RPMI-1640 medium. 50 l of this cell suspension is added per well in the assay plate containing already BCMA-expressing MM cells to obtain a final E:T ratio of 5:1. To test whether the T cell bispecific constructs are able to activate T cells only in the presence of BCMA-expressing MM tumor target cells, wells containing final concentration(s) in the range of 0.1 pM to 200 nM of the respective bispecific molecules with effector cells but without MM tumor target cells are also included. After incubation for five days at 37 C., 5% CO.sub.2, cells are pelleted down by centrifugation (5 min, 350g) and washed twice with 150 l/well of FACS Stain Buffer (BD Biosciences). Surface staining of the effector cells with selected fluorochrome-conjugated antibodies against human CD4, CD8, CD69 or CD25 (BD Biosciences) is performed at 4 C. for 30 min, protected from light, in FACS Stain Buffer (BD Biosciences) according to the manufacturer's protocol. Cells are washed twice with 150 l/well FACS Stain Buffer, resuspended in 200 l/well FACS Stain Buffer, and acquired and analyzed using a LSRII flow cytometer complemented with FACSDiva software (BD Biosciences). The expression of CD69 and CD25 activation markers are determined by measuring the mean fluorescence intensity gated on CD4.sup.+ and CD8.sup.+ T cell populations as represented in histograms or dot plots.

    Example 9Proliferation of T Cells Upon Engagement of Anti-BCMA/Anti-CD3 T Cell Bispecific Antibodies (CFSE Dilution)

    [0283] Anti-BCMA/anti-CD3 T cell bispecific antibodies generated in Example 5 are also analyzed by flow cytometry for their potential to induce proliferation of CD8.sup.+ or CD4.sup.+ T cells in the presence or absence of human BCMA-expressing MM cells. Briefly, BCMA-expressing NCI-H929 MM cells are harvested with Cell Dissociation buffer, counted and looked for viability using Trypan Blue. Viable MM cells are adjusted to 0.210.sup.6 cells per ml in complete RPMI medium, 100 l of this cell suspension are pipetted per well into a round-bottom 96-well plate. 50 l of the T cell bispecific constructs are added to the MM cell-containing wells to obtain final concentration(s) in the range of 0.1 pM to 200 nM. The well plate is set aside and kept at 37 C., 5% CO.sub.2.

    [0284] PBMC are isolated from fresh blood using density gradient centrifugation using Cell Preparation Tubes with Sodium citrate (Vacutainer CPT tubes, BD Biosciences). Total human T cells are then isolated using the Pan T Cell Isolation Kit II (Miltenyi Biotec), according to the manufacturer's instructions. The total T cells are then adjusted to 1 million cells per ml in pre-warm RPMI without serum (37 C.) and stained with 1 M CFSE at room temperature for 6 min, protected from light. The staining volume is then doubled by addition of RPMI-1640 medium supplemented with 10% FCS and 1% GlutaMax to stop CFSE staining. After incubation at room temperature for further 20 min, the cells are washed three times with pre-warmed serum-containing medium to remove remaining CFSE. CFSE-stained total T cells (effector) are then adjusted to 210.sup.6 cells/mL in complete RPMI-1640 medium. 50 l of this cell suspension is added per well in the assay plate already containing BCMA-expressing NCI-H929 MM cells to obtain a final E:T ratio of 5:1. To test whether the T cell bispecific constructs are able to activate T cells only in the presence of BCMA-expressing MM tumor target cells, wells containing concentration(s) in the range of 0.1 pM to 200 nM of the T cell bispecific antibodies with effector cells but without MM tumor target cells are also included. After incubation for five days at 37 C., 5% CO.sub.2, cells are pelleted down by centrifugation (5 min, 350g) and washed twice with 150 l/well of FACS Stain Buffer (BD Biosciences). Surface staining of the effector cells with selected fluorochrome-conjugated antibodies against human CD4, CD8 or CD25 (BD) is performed at 4 C. for 30 min, protected from light, in FACS Stain Buffer according to the manufacturer's protocol. Cells are washed twice with 150 l/well FACS Stain Buffer, resuspended in 200 l/well FACS Stain Buffer, and acquired and analyzed using a LSR II flow cytometer complemented with FACSDiva software (BD). The percentage of non-proliferating cells is determined by gating on the far right undiluted CFSE peak in the group which the wells contain BCMA-expressing MM cells and CFSE-stained T cells but without the T cell bispecific antibodies, and compared that to other experimental groups (wells). The percentage of proliferating cells is measured by gating all the diluted CFSE peaks excluding the far right peak (if observable). The proliferation level of CD4.sup.+ and CD8.sup.+ T cells is determined by gating on that population first then to further look at the CFSE dilution peaks.

    Example 10Cytokine Production from Activated T Cells Upon Engagement of Anti-BCMA/Anti-CD3 T Cell Bispecific Antibodies

    Example 10A. Interferon- Production

    [0285] Anti-BCMA/anti-CD3 T cell bispecific antibodies generated in Example 5 are also analyzed for their potential to induce interferon- (IFN-) production by the T cells in the presence or absence of human BCMA-expressing MM cells. Briefly, BCMA-expressing NCI-H929 MM cells are harvested with Cell Dissociation buffer, counted and looked for viability using Trypan Blue. Approximately 20,000 viable cells per well are plated in a round-bottom 96-well-plate and the respective antibody dilution is added to obtain final concentration(s) in the range of 0.1 pM to 200 nM. Anti-human BCMA and anti-CD3 IgGs adjusted to the same molarity are used as controls. Human total T effector cells are added to obtain a final E:T ratio of 5:1. After 20 h incubation at 37 C., 5% CO.sub.2, human IFN- levels in the supernatant are measured by ELISA, according to the manufacturer's instructions (human IFN- ELISA Kit II, BD Biosciences). The levels of IFN- produced by T cells in the presence of anti-BCMA/anti-CD3 T cell bispecific antibody and BCMA-expressing MM cells is measured and plotted in histograms and compared to that produced by T cells in the presence of anti-BCMA/anti-CD3 T cell bispecific antibody and but without BCMA-expressing MM cells.

    Example 10B. Cytokine Release Assay (CBA Analysis)

    [0286] Anti-BCMA/anti-CD3 T cell bispecific antibodies generated in Example 5 are also analyzed for their potential to induce T-cell mediated cytokine production in the presence or absence of human BCMA-expressing MM cells. PBMC are isolated from fresh blood using density gradient centrifugation using Cell Preparation Tubes with Sodium citrate (Vacutainer CPT tubes, BD Biosciences) and a final cell concentration of 0.3 million cells/well are plated into a round-bottom 96-well plate. BCMA-expressing NCI-H929 MM cells are then added to obtain a final E:T-ratio of 10:1, as well as T cell bispecific constructs and IgG controls are added to obtain final concentration(s) in the range of 0.1 pM to 200 nM, for a 24 h incubation at 37 C., 5% CO.sub.2. The next day, the cells are centrifuged for 5 min at 350g and the supernatant is transferred into a new deep-well 96-well-plate for the further analysis. The CBA analysis is performed according to manufacturer's instructions for LSR II flow cytometer, using the Human Th1/Th2 Cytokine Kit II (BD Biosciences) including human IL-2, human IL-4, human IL-6, human IL-10, human TNF-, and human IFN-. The levels of cytokines produced by T cells in the presence of anti-BCMA/anti-CD3 T cell bispecific antibody and BCMA-expressing MM cells is measured and plotted in histograms and compared to that produced by T cells in the presence of anti-BCMA/anti-CD3 T cell bispecific antibody and but without BCMA-expressing MM cells.

    Example 11Redirected T Cell Cytotoxicity of MM Cells Upon Cross-Linking of Anti-BCMA/Anti-CD3 T Cell Bispecific Antibodies to CD3 on T Cells and BCMA on MM Cells (LDH Release Assay)

    [0287] Anti-BCMA/anti-CD3 T cell bispecific antibodies generated in Example 5 are also analyzed for their potential to induce T cell-mediated apoptosis in BCMA-expressing MM cells upon crosslinking of the construct via binding of the antigen binding moieties to BCMA on cells. Briefly, human BCMA-expressing NCI-H929 multiple myeloma target cells are harvested with Cell Dissociation Buffer, washed and resuspended in RPMI supplemented with 10% fetal bovine serum (Invitrogen). Approximately, 30,000 cells per well are plated in a round-bottom 96-well plate and the respective dilution of the construct is added for a desired final concentrations (in triplicates); final concentrations ranging from 0.1 pM to 200 nM. For an appropriate comparison, all T cell bispecific constructs and controls are adjusted to the same molarity. Human total T cells (effector) are added into the wells to obtain a final E:T ratio of 5:1. When human PBMC are used as effector cells, a final E:T ratio of 10:1 is used. PHA-L (Sigma) is used as positive control for human T cell activation at a concentration of 1 g/ml. Negative control groups are represented by effector or target cells only. For normalization, maximal lysis of the NCI-H929 MM target cells (=100%) is determined by incubation of the target cells with a final concentration of 1% Triton X-100, inducing cell death. Minimal lysis (=0%) is represented by target cells co-incubated with effector cells only, i.e. without any T cell bispecific antibody. After 20 h incubation at 37 C., 5% CO.sub.2, LDH release from the apoptotic/necrotic MM target cells into the supernatant is then measured with the LDH detection kit (Roche Applied Science), following the manufacturer's instructions. The percentage of LDH release is plotted against the concentrations of anti-BCMA/anti-CD3 T cell bispecific antibodies in concentration-response curves. The IC.sub.50 values are measured using Prism software (GraphPad) and determined as the T cell bispecific antibody concentration that results in 50% of LDH release.

    Example 12Comparison of T Cell Bispecifics Containing a Non-Ligand Blocking/Non-Competing Anti-BCMA Antibody Vs. A Ligand-Blocking/Competing Anti-BCMA Antibody on the Killing Potency of BCMA-Expressing MM Cells

    [0288] In certain hematological malignancies such as multiple myeloma, the level of circulating BCMA-ligands APRIL and BAFF can be elevated (Moreaux et al. 2004; Blood 103(8): 3148-3157). Thus, the inventors recognize that high levels of ligands in the serum may interfere with the binding of anti-BCMA antibodies to BCMA on the tumor cells. In comparison to healthy donors, the levels of circulating APRIL (the high affinity ligand to BCMA) in MM patient are 100 ng/mL vs. 10 ng/mL. For BAFF (the low affinity ligand to BCMA), the levels can fluctuate from 1-1000 ng/mL as compared to 3 ng/mL in healthy donors. Close to the tumor cells APRIL/BAFF concentrations may be well even higher than measured in the serum. In certain autoimmune diseases such as systemic lupus erythematosus, the levels of circulating APRIL are also elevated with 85 ng/mL (Koyama et al. 2005; Ann Rheum Dis 64: 1065-1067).

    [0289] Anti-BCMA/anti-CD3 T cell bispecific antibodies generated in Example 5 containing a non-ligand blocking/non-competing anti-BCMA antibody are also analyzed for their potential to induce T cell-mediated apoptosis in BCMA-expressing MM cells upon crosslinkage of the construct via binding of the antigen binding moieties to BCMA on cells in the presence of elevated concentrations (i.e. 100 ng/mL to 1000 ng/mL) of APRIL or BAFF in comparison to anti-BCMA/anti-CD3 T cell bispecific antibodies containing a ligand blocking/competing anti-BCMA antibody of the same format.

    [0290] As shown in FIG. 1, the increasing concentrations (i.e. 10, 100, 1000 ng/mL) of soluble APRIL or BAFF representative of the levels found in the blood and bone marrow of multiple myeloma patients do not alter the binding of a non-ligand blocking/non-competing anti-BCMA antibody to plate-bound-BCMA (continuous line). In contrast, the high concentrations of soluble APRIL or BAFF representative of the levels (i.e. 100 ng/mL to 1000 ng/mL) found in the blood and bone marrow of multiple myeloma patients decrease the binding of a ligand blocking/competing anti-BCMA antibody to bound-BCMA (dotted line).

    [0291] As shown in FIG. 2, the increasing concentrations (i.e. 10, 100, 1000 ng/mL) of soluble APRIL or BAFF representative of the levels found in the blood and bone marrow of multiple myeloma patients do not alter the killing potency of a T cell bispecific antibody containing a non-ligand blocking/non-competing anti-BCMA antibody specific to BCMA-expressing MM cells (continuous line). In contrast, the high concentrations (i.e. 100 ng/mL to 1000 ng/mL) of soluble APRIL or BAFF representative of the levels found in the blood and bone marrow of multiple myeloma patients decrease the killing potency of a T cell bispecific antibody containing a ligand blocking/competing anti-BCMA antibody specific to BCMA-expressing MM cells (dotted line).

    Example 12A. Binding Properties of Anti-BCMA/Anti-CD3 T Cell Bispecific Antibodies to BCMA-Expressing MM Cells with a Non-Ligand Binding/Blocking, Non-Competing Anti-BCMA Antibody in the Presence of 10, 100, 1000 ng/mL of APRIL or BAFF (Flow Cytometry)

    [0292] Anti-BCMA/anti-CD3 T cell bispecific antibodies with a non-ligand binding/blocking, non-competing anti-BCMA antibody generated in Example 5 are analyzed by flow cytometry for their binding properties to human BCMA expressed on NCI-H929 multiple myeloma cells in the presence of 10, 100 and 1000 ng/mL of APRIL or BAFF. Briefly, cultured cells are harvested, counted and cell viability is evaluated using the Trypan Blue exclusion method. Viable cells are then adjusted to 210.sup.6 cells per ml in PBS containing 0.1% BSA. 90 l of this cell suspension are further aliquoted per well into a round-bottom 96-well plate. 10 l of the T cell bispecific antibody or corresponding IgG control are added to the cell-containing wells to obtain preferably final concentrations ranging from 0.1 pM to 200 nM. Anti-BCMA/anti-CD3 T cell bispecific antibodies and control IgG are used at the same molarity. After incubation for 30 min at 4 C., cells are centrifuged (5 min, 350g), washed with 150 l/well BSA-containing FACS Stain Buffer (BD Biosciences), resuspended and incubated for an additional 30 min at 4 C. with 12 l/well fluorochrome-conjugated anti-His antibody (Lucerna) for detection of the T cell bisepecific antibody. Cells are then washed by addition of 120 l/well FACS Stain Buffer and centrifugation at 350g for 5 min. A second washing step is performed with 150 l/well FACS Stain Buffer. The samples are resuspended in 200 l/well FACS Stain Buffer, acquired and analyzed using an LSR II flow cytometer with FACSDiva software (BD Biosciences). Binding of the anti-BCMA/anti-CD3 T cell bispecific antibodies to MM cells and T cells are evaluated and the mean fluorescence intensity is determined gated on BCMA-expressing NCI-H929 MM cells and plotted in histograms or dot plots. The binding (e.g. MFI) of an anti-BCMA/anti-CD3 T cell bispecific antibodies with a non-ligand binding/blocking, non-competing anti-BCMA antibody to MM cells is then compared to that of an anti-BCMA/anti-CD3 T cell bispecific antibodies with a ligand binding/blocking, competing anti-BCMA antibody in the presence of 0, 10, 100, 1000 ng/mL of APRIL or BAFF.

    Example 12B. Killing Properties of Anti-BCMA/Anti-CD3 T Cell Bispecific Antibodies with a Non-Ligand Binding/Blocking, Non-Competing Anti-BCMA Antibody in the Presence of 10, 100, 1000 ng/mL of APRIL or BAFF: Redirected T Cell Cytotoxicity of BCMA-Expressing MM Cells (LDH Release Assay)

    [0293] Anti-BCMA/anti-CD3 T cell bispecific antibodies with a non-ligand binding/blocking, non-competing anti-BCMA antibody generated in Example 5 are analyzed for their potential to induce T cell-mediated apoptosis in BCMA-expressing MM cells upon crosslinking of the construct via binding of the antigen binding moieties to BCMA on cells, in the presence or absence of increasing concentrations (i.e. 10, 100, 1000 ng/mL) of APRIL or BAFF. Briefly, human BCMA-expressing NCI-H929 multiple myeloma target cells are harvested with Cell Dissociation Buffer, washed and resuspendend in RPMI supplemented with 10% fetal bovine serum (Invitrogen). Approximately, 30 000 cells per well are plated in a round-bottom 96-well plate and the respective dilution of the T cell bispecific antibody is added preferably for fixed concentration(s) in the range of 0.1 nM to 10 nM of 1 nM (in triplicates). For an appropriate comparison, all T cell bispecific antibodies and controls are adjusted to the same molarity. Increasing concentrations (i.e. 10, 100, 1000 ng/mL) of soluble human recombinant APRIL or BAFF are added to the cell cultures. Wells without addition of APRIL or BAFF are also included in the plate as controls. Human total T cells (effector) are then added into the wells to obtain a final E:T ratio of 5:1. When human PBMC are used as effector cells, a final E:T ratio of 10:1 is used. PHA-L (Sigma) is used as positive control for human T cell activation at a concentration of 1 g/ml. Negative control groups are represented by effector or target cells only. For normalization, maximal lysis of the NCI-H929 MM target cells (=100%) is determined by incubation of the target cells with a final concentration of 1% Triton X-100, inducing cell death. Minimal lysis (=0%) is represented by target cells co-incubated with effector cells only, i.e. without any construct or antibody. After 20 h incubation at 37 C., 5% CO.sub.2, LDH release from the apoptotic/necrotic MM target cells into the supernatant is then measured with the LDH detection kit (Roche Applied Science), following the manufacturer's instructions. The percentage of LDH release is plotted against the concentrations of APRIL or BAFF in the presence of fixed concentration(s) of anti-BCMA/anti-CD3 T cell bispecific antibodies preferably in the concentration range of 0.1 pM to 200 nM in concentration-response curves. The IC.sub.50 values are then measured using Prism software (GraphPad). The IC.sub.50 values of an anti-BCMA/anti-CD3 T cell bispecific antibodies with a non-ligand binding/blocking, non-competing anti-BCMA antibody is then compared to that of an anti-BCMA/anti-CD3 T cell bispecific antibodies with a ligand binding/blocking, competing anti-BCMA antibody in the presence of 0, 10, 100, 1000 ng/mL of APRIL or BAFF.

    Example 13Evaluation of Therapeutic Efficacy of Anti-BCMA/Anti-CD3 T Cell Bispecific Antibody in the Vk*MYC Multiple Myeloma Mouse Model

    [0294] Murine cross-reactive anti-BCMA/anti-CD3 T cell bispecific antibodies are tested for their potential to prevent multiple myeloma in Vk*MYC multiple myeloma prone mice as described in Chesi, 2012 (Chesi et al. 2012; Blood 120: 376-385). Multiple myeloma is a hematological malignancy involving an uncontrolled expansion of plasma cells in the bone marrow. Since BCMA is strongly expressed on malignant plasma cells, we hypothesize that an anti-BCMA/anti-CD3 T cell bispecific will be efficacious for the treatment of multiple myeloma. The Vk*MYC multiple myeloma mouse model is highly representative of human myeloma and predictive of drug response used in the clinic; representing an excellent tool for testing the preclinical proof-of-concept of anti-BCMA/anti-CD3 T cell bispecific antibodies. Briefly, Vk*MYC mice obtained from an academic collaboration at Mayo Clinic Arizona are crossed with human CD3 transgenic (huCD3 Tg) mice. T cells from huCD3 TgVk*MYC mice express both human CD3 and mouse CD3 on the cell surface and the mice are therefore responsive to anti-BCMA/anti-CD3 T cell bispecifics. Vk*MYC mice uniformly develop a monoclonal gammopathy initiated at around 30 weeks of age that progresses slowly over time associated with clinical signs representative of human myeloma such as anemia, osteoporosis and renal disease. Mice are periodically bled by tail grazing and blood is collected into Microtainer tubes (BD Biosciences), let coagulate at room temperature then spun for 10 min at 2,300 g. Sera are diluted 1:2 in normal saline buffer and analyzed on a QuickGel Chamber apparatus using pre-casted QuickGels (Helena Laboratories) according to manufacturer's instruction. Gamma/albumin ratio and serum fractions are measured by densitometric analysis.

    [0295] For therapeutic studies, Vk*MYC mice are enrolled and randomized into different treatment groups (n=5-8/group): for example, 1) control IgGs; 2) anti-BCMA/anti-CD3 T cell bispecific antibodies; 500 g/kg/week or 10 g/mouse/week administered intravenously via the tail vein; 3) bortezomib 1 mg/kg/i.p. on days 1,4,8,11 used as standard of care. Preferably, the dose(s) of anti-BCMA/anti-CD3 T cell bispecific antibodies could be multiple and range from 200 to 1000 g/kg/week. In each group, at least three aged (>1 year old) Vk*MYC mice with gamma/albumin ratio between 0.3-2.0, corresponding to a predominant M-spike between approximately 10-70 g/l as measured by densitometry. Serum protein electrophoresis (SPEP) is performed on day 0 and day 14 post treatment to measure treatment-mediated reduction in the M-spike as a marker of tumor response, as done in the clinic. In some therapeutic studies, transplanted Vk*MYC mice with an M-spike approximately 10-70 g/l and a bone marrow plasmacytosis of greater than 5% are enrolled and assigned to different treatment groups. The efficacy of anti-BCMA/anti-CD3 T cell bispecific antibodies to reduce M-spike is evaluated.

    Example 14Evaluation of Therapeutic Efficacy in the NZB/W Lupus Prone Mouse Model of Systemic Lupus Erythematosus

    [0296] Murine cross-reactive anti-BCMA/anti-CD3 T cell bispecific antibodies are tested for their potential to prevent systemic lupus erythematosus (SLE) in the NZB/W prone mice, a well-characterized model (Hass et al. 2010; J Immunol 184(9): 4789-4800). There is accumulating evidence suggesting that autoreactive plasma cells play an important role in SLE and depletion of the autoreactive plasma cells with an anti-BCMA/anti-CD3 T cell bispecific could be beneficial to SLE patients. Briefly, NZB and NZW mice are purchased from the Jackson Laboratory and crossed with huCD3 Tg mice. NZBhuCD3 Tg mice and NZWhuCD3 Tg mice are then crossed with each other and female huCD3 TgNZB/W F1 mice are selected for future studies. Mice are tested semiquantitatively for proteinuria with Albustix reagent strips (Siemens Healthcare Diagnostics Inc.) every other week, and scored on a scale from 0 to 4 according to protein concentration (from 0 to >20 g/l). huCD3 TgNZB/W F1 female mice of 7-8 months of age are enrolled in therapeutic studies and randomized into different treatment groups (n=16/group): for example, 1) control IgGs; 2) anti-BCMA/anti-CD3 T cell bispecific antibodies; 500 g/kg/week or 10 g/mouse/week administered intravenously via the tail vein; 3) anti-BAFF 20 mg/kg/week used as standard of care. Preferably, the dose(s) of anti-BCMA/anti-CD3 T cell bispecific antibodies could be multiple and range from 200 to 1000 g/kg/week. The baseline protein levels at the start of the therapeutic studies are between 30 and 300 mg/dL.

    [0297] The clinical endpoints representative of SLE consist of proteinuria, kidney diseases and manifestations such as glomerulonephritis, glomerular cellularity and size increase, periodic acid-Schiff (PAS)-positive deposits, and appearance of autoantibodies in sera such as dsDNA, total IgA, IgG and IgM as measured by ELISA.

    Example 15Evaluation of Therapeutic Efficacy in an Experimental Mouse Model of Acute Antibody-Mediated Humoral Rejection of Renal Allografts

    [0298] Murine cross-reactive anti-BCMA antibodies issued from Example 2, preferably unconjugated IgG1 antibodies (Example 3) and conjugated antibodies delivering a cytotoxic small molecule moiety (Example 4) are tested for their potential to treat acute antibody-mediated humoral rejection of allografts involving plasma cells and alloantibodies in an experimental mouse model of acute humoral rejection of renal allografts as described in Bickerstaff, 2008 (Bickerstaff et al., Am J Pathol 2008; 173 (2): 347-357).

    Example 15A. Presensitization with Skin Grafting in Mice

    [0299] C57BL/6 (H-2b) and DBA/2 (H-2d) adult mice are obtained from the Jackson Laboratory. C57BL/6 recipient mice are first pre-sensitized with skin allografts from DBA/2 donor mice. Briefly, full-thickness skin allografts (810 mm) are placed on the prepared graft beds of the recipient's flank and sutured at the four corners with 5-0 silk suture (Ethicon). The skin allograft is then covered with a protective bandage for 7 days. Graft rejection is expected to occur by day 7 post-transplant and characterized by dark coloration, scabbing and necrotic degeneration of the skin grafts. The pre-sensitized recipient mice subsequently receive renal allografts.

    Example 15B. Mouse Kidney Transplantation

    [0300] Presensitized mice from Example 15A are used as renal allograft recipients and enrolled in therapeutic studies and randomized into different treatment groups (n=10/group): 1) control IgGs; 2) anti-BCMA antibodies; 20 mg/kg/week or 400 g/mouse/week administered intravenously via the tail vein. As described in Bickerstaff et al. (2008), the donor left kidney from DBA/2 mice is isolated by ligating and dividing the adrenal and testicular vessels with 10-0 silk microsuture (Ethicon). The aorta and inferior vena cava are mobilized at their junction, with the left renal artery and vein. The aorta is ligated below the renal vessel. A patch of bladder containing the left ureterovesical junction is excised. The graft is perfused in situ with 0.2 to 0.4 ml of cold, heparinized Ringer's lactate. Finally, the kidney with vascular supply and ureter attached to the bladder patch are harvested en bloc. Presensitized C57BL/6 mice served as recipients of renal allografts. The recipient's right native kidney is removed immediately before transplantation. The infrarenal aorta and inferior vena cava are carefully isolated and cross-clamped. An end-to-side anastomosis between the donor renal vein and the recipient inferior vena cava is performed using continuous 10-0 sutures. The arterial anastomosis between the donor aortic cuff and recipient aorta is also performed. Instant perfusion of the kidney allograft proves successful anastomosis. Urinary reconstruction is then performed by a bladder-to-bladder anastomosis. The left native kidney is removed on day 5 after renal transplantation. Renal allograft survival is followed by daily examinations of overall animal health and measurement of creatinine levels and comparison with that of normal nave mice (e.g. approx. 20 mol/L). Renal allograft rejection is considered when the mouse showed signs of illness (e.g. weight loss, moribund state, crouched position, etc.) accompanied with creatinine levels higher than 100 mol/L for two consecutive days; the recipient is then anesthetized and renal allograft is harvested for histopathology analysis.

    Example 15C. Circulating Alloantibody Analysis

    [0301] The presence of donor-reactive antibodies or allo-antibodies is determined by the ability of sera to bind to DBA/2 splenocytes. Binding is detected by flow cytometry, using FITC-conjugated goat anti-mouse IgG (-chain-specific), rat anti-mouse IgG1, rat anti-mouse IgG2a, or rat anti-mouse IgG2b (BD Biosciences) detection antibodies. Antibody binding is measured as the mean fluorescence intensity MFI using DBA/2 splenocytes as targets for Ig binding. Background fluorescence is determined in control experiments for each subtype by taking the MFI value obtained from binding of five nave C57BL/6 sera. Negative staining controls include splenocytes plus each detection antibody.