SYNTHETIC ADENOVIRUSES WITH TROPISM TO DAMAGED TISSUE FOR USE IN PROMOTING WOUND REPAIR AND TISSUE REGENERATION

20180221423 ยท 2018-08-09

Assignee

Inventors

Cpc classification

International classification

Abstract

Synthetic adenoviruses having chimeric fiber proteins and liver detargeting mutations are described. The synthetic adenovirus vectors are capable of specifically infecting cells at wound sites or in regions of damaged tissue. The synthetic adenovirus vectors also are capable of expressing transgenes, such as wound healing factors, at sites of wounded or damaged tissue. Accordingly, the described vectors can be used to detect wounded or damaged tissue, and/or to promote wound healing and regeneration of damaged tissue, such as by expression of heterologous wound healing or tissue regeneration factors.

Claims

1. A method of expressing a transgene in cells at the site of a wound or damaged tissue in a subject, comprising administering to the subject a synthetic adenovirus comprising: the transgene; a native or modified capsid that detargets the synthetic adenovirus from the liver; and a chimeric fiber protein comprising an adenovirus type 5 (Ad5) shaft domain and an adenovirus type 34 (Ad34) knob domain.

2. The method of claim 1, wherein the transgene encodes at least one factor that promotes wound repair or tissue regeneration.

3. A method of promoting wound repair or tissue regeneration in a subject, comprising administering to the subject a synthetic adenovirus comprising: a transgene encoding at least one heterologous factor that promotes wound repair or tissue regeneration; a native or modified capsid that detargets the synthetic adenovirus from the liver; and a chimeric fiber protein comprising an adenovirus type 5 (Ad5) shaft domain and an adenovirus type 34 (Ad34) knob domain.

4. The method of claim 3, further comprising selecting a subject with a wound or damaged tissue.

5. The method of claim 4, wherein: the wound is a cutaneous wound; or the damaged tissue is kidney, heart, liver or lung tissue.

6. The method of claim 3, wherein the synthetic adenovirus comprises a modified capsid that detargets the virus from the liver.

7. The method of claim 6, wherein the synthetic adenovirus comprises a modified hexon protein.

8. The method of claim 7, wherein the modified hexon protein comprises an E451Q mutation.

9. The method claim 3, wherein the synthetic adenovirus further comprises one or more binding sites for a liver-specific microRNA.

10. The method of claim 9, wherein the liver-specific microRNA is miR-122.

11. The method of claim 9, wherein the one or more binding sites are in the 3 'UTR of the adenovirus E1 region.

12. The method of claim 3, wherein the at least one factor that promotes wound repair is a member of the Wnt signaling pathway or the TGF-43 signaling pathway.

13. The method of claim 12, wherein the at least one factor that promotes wound repair is PDGF-?.

14. The method of claim 3, wherein the transgene encodes at least one factor that promotes kidney tissue regeneration, heart tissue regeneration, liver tissue regeneration or lung tissue regeneration.

15. The method of claim 3, wherein expression of the at least one heterologous factor that promotes wound repair or tissue regeneration is regulated by a tissue-specific promoter.

16. A method of detecting a wound or damaged tissue in a subject, comprising administering to the subject a synthetic adenovirus comprising: a reporter gene; a native or modified capsid that detargets the synthetic adenovirus from the liver; and a chimeric fiber protein comprising an adenovirus type 5 (Ad5) shaft domain and an adenovirus type 34 (Ad34) knob domain.

17. The method of claim 16, wherein the reporter gene encodes a luciferase, a green fluorescent protein, a yellow fluorescent protein, a cyan fluorescent protein, a red fluorescent protein, a blue fluorescent protein, or an orange fluorescent protein.

18. The method of claim 3, wherein the synthetic adenovirus further comprises one or more binding sites for a spleen-specific microRNA.

19. The method of claim 18, wherein the spleen-specific microRNA is miR142-3p.

20. A synthetic adenovirus genome comprising SEQ ID NO: 6 or SEQ ID NO: 10.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0011] FIG. 1 is a schematic showing modifications introduced into exemplary synthetic adenoviruses disclosed herein. A replication defective virus is engineered by replacement of the E1 region with a reporter gene or a therapeutic factor. The hexon protein is mutated to prevent binding of the adenovirus capsid to factor X (fX), thereby detargeting the virus from the liver (Bradshaw et al., Blood 114(5):965-971, 2009). Binding sites for the liver-specific miR122 are inserted to prevent virus gene expression in the liver (Leja et al., PLoS ONE 5(1):e8916, 2010). The Ad5 knob domain is replaced with the Ad34 knob domain. AdSyn-CO176 (SEQ ID NO: 6) and AdSyn-CO877 (SEQ ID NO: 10) are exemplary synthetic viruses comprising these modifications.

[0012] FIGS. 2A-2B: A synthetic adenovirus with the fiber knob domain of Ad34 exhibits tropism to wound sites. (FIG. 2A) The adenovirus AdSyn-CO171 (?E1-EF1?-[luc-GFP]-miR122, hexon E451Q; SEQ ID NO: 1), AdSyn-CO172 (?E1-EF1?-[luc-GFP]-miR122; fiber chimera Ad5/5/3, hexon E451Q; SEQ ID NO: 2), AdSyn-CO174 (?E1-EF1?-[Luc-GFP]-miR122; fiber chimera Ad5/5/11, hexon E451Q; SEQ ID NO: 4), AdSyn-CO176 (?E1-EF1?-[luc-GFP]-miR122; fiber chimera Ad5/5/34, hexon E451Q; SEQ ID NO: 6) were injected into FVB/NJ mice by tail vein. The mouse that received saline served as the control. The mouse that received AdSyn-CO171 was tagged by left ear clip. The mouse that received AdSyn-CO172 was tagged by left ear and left forehand clip. The mice that received AdSyn-CO174 were tagged by right ear and right forehand clip. The mice that received AdSyn-CO176 were tagged by both ears and both forehands clip. IVIS? imaging was performed at 48 hours post injection. The exposure time was 1 minute. The luciferase signals from the wound sites are indicated with a rectangle. (FIG. 2B) Prior to wounding, AdSyn-CO176 was injected into the FVB/NJ mouse by tail vein. IVIS? imaging was performed at 72 hours post injection. Mice were then cut at both ears and both forehands and IVIS? imaging was performed 72 hours post clip (6 days after injection). The exposure time was 1 minute. Luciferase signals from the wound sites are indicated.

[0013] FIGS. 3A-3B: The specific infection of AdSyn-CO176 in the damaged kidney. FVB/NJ mice were induced with ischemia-reperfusion injury in one kidney by surgical operation. The chimeric adenovirus AdSyn-CO176 was injected into mice 24 hours later. IVIS? imaging was performed at 2 days (FIG. 3A) and 7 Days (FIG. 3B) post injection. The exposure time was 1 minute.

[0014] FIGS. 4A-4B: A higher dose injection of AdSyn-CO176 leads to specific expression of adenovirus in the IRI damaged kidney. (FIG. 4A) Flow chart of the experiment. Surgery was performed on the left kidney of mice to induce IRI damage. Forty-eight hours post-surgery, a 10-fold higher dose of AdSyn-CO176 (compared to the experiment shown in FIGS. 3A-3B) was injected into mice by tail vein injection. IVIS? imaging was performed 48 hours post-injection and both kidneys were separated and sectioned to observe GFP signal. (FIG. 4B) IVIS? image of an infected mouse showing that expression of AdSyn-CO176 concentrated at the damaged kidney part.

[0015] FIGS. 5A-5C: Wild-type Ad34 does not exhibit tropism to wound sites. Synthetic virus AdSyn-CO721 was generated by replacing the genes of the E1 region of wild-type Ad34 with the reporter EF1?-[luc-GFP]-miR122. FVB/NJ mice were injected by tail vein with AdSyn-CO171 (FIG. 5A), AdSyn-CO176 (FIG. 5B) or AdSyn-CO721 (FIG. 5C). Both ears of the mice were clipped at the same time as virus injection. IVIS? imaging was performed at 48 hours post injection. The exposure time was 1 minute.

[0016] FIGS. 6A-6B: Synthetic adenovirus encoding PDFG-? promotes wound healing in a scratch wound model. Human fetal lung fibroblasts (IMR-90) were plated in 96-well plates and cultured for 18 hours to nearly 100% confluence. The INCUCYTE? 96-pin WoundMaker was used to create a scratch wound in each well of the 96-well plate. Cells were either left untreated or were immediately infected with AdSyn-CO877 (expressing PDFG-?) at an MOI of 1. Cell migration and wound healing were evaluated by measuring wound confluence (FIG. 6A) and relative wound density (FIG. 6B).

[0017] FIGS. 7A-7B: Administration of a wound-targeting synthetic adenovirus encoding PDFG-? promotes recovery from kidney damage in an ischemia-reperfusion injury (IRI) mouse model. Ischemia-reperfusion injury was induced in both kidneys by clamping the renal pedicles for 30 minutes. Mice were then immediately injected intravenously via the tail vein with 200 ?l saline (Z337L), 10.sup.9 particles of non-wound targeting virus AdSyn-CO876 (Z338R) or 10.sup.9 particles of wound-targeting virus AdSyn-CO877 (Z340R and Z341L). Controls included a mouse with induced kidney damage that received no injection (Z336L), a sham-operated mouse (same surgical procedure except the clamp was not applied) that received no injection (Z342R), and a mouse with no kidney damage that did not receive an injection (Wild type). Blood was collected at the time of injection (0 h) and after 18 hours to measure blood urea nitrogen (BUN; FIG. 7A) and creatinine (FIG. 7B).

[0018] FIGS. 8A-8C: Spleen-specific miR142-3p silences virus expression in the spleen. A synthetic virus (AdSyn-CO338) containing four miR142-3p binding sites in the 3 UTR of E1A was generated to test whether miR142-3p can silence virus expression in the spleen. AdSyn-CO171 (?E1-EF1?-[luc-GFP]-miR122, hexon E451Q), AdSyn-CO338 (?E1-EF1?-[luc-GFP]-miR142-3p, hexon E451Q, ?E3A/E3B) and AdSyn-CO339 (?E1-EF1?-[luc-GFP], hexon E451Q, ?E3A/E3B) were injected into the tail vein of mice and luciferase expression was detected after 48 hours by IVIS? imaging. The exposure time was 1 minute. (FIG. 8A) Relative luciferase signal in the liver and spleen following injection with AdSyn-CO171. (FIG. 8B) Relative luciferase signal in the liver following injection of either AdSyn-CO338 or AdySyn-CO339. (FIG. 8C) Relative luciferase signal in the spleen following infection of AdSyn-CO338 or AdySyn-CO339.

SEQUENCE LISTING

[0019] The nucleic and amino acid sequences listed in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases, and three letter code for amino acids, as defined in 37 C.F.R. 1.822. Only one strand of each nucleic acid sequence is shown, but the complementary strand is understood as included by any reference to the displayed strand. The Sequence Listing is submitted as an ASCII text file, created on Mar. 29, 2018, 499 KB, which is incorporated by reference herein. In the accompanying sequence listing:

[0020] SEQ ID NO: 1 is the nucleotide sequence of synthetic adenovirus AdSyn-CO171.

[0021] SEQ ID NO: 2 is the nucleotide sequence of synthetic adenovirus AdSyn-CO172.

[0022] SEQ ID NO: 3 is the nucleotide sequence of synthetic adenovirus AdSyn-CO173.

[0023] SEQ ID NO: 4 is the nucleotide sequence of synthetic adenovirus AdSyn-CO174.

[0024] SEQ ID NO: 5 is the nucleotide sequence of synthetic adenovirus AdSyn-CO175.

[0025] SEQ ID NO: 6 is the nucleotide sequence of synthetic adenovirus AdSyn-CO176.

[0026] SEQ ID NO: 7 is the nucleotide sequence of synthetic adenovirus AdSyn-CO199.

[0027] SEQ ID NO: 8 is the amino acid sequence of Ad5 hexon.

[0028] SEQ ID NO: 9 is the amino acid sequence of Ad5 hexon E451Q.

[0029] SEQ ID NO: 10 is the nucleotide sequence of synthetic adenovirus AdSyn-CO877.

[0030] SEQ ID NO: 11 is the nucleotide sequence of synthetic adenovirus AdSyn-CO338.

DETAILED DESCRIPTION

I. Abbreviations

[0031] Ad adenovirus

[0032] BUN blood urea nitrogen

[0033] CAR coxsackie adenovirus receptor

[0034] GFP green fluorescent protein

[0035] IRI ischemia-reperfusion injury

[0036] miR microRNA

[0037] PDGF platelet-derived growth factor

[0038] UTR untranslated region

[0039] WT wild-type

II. Terms and Methods

[0040] Unless otherwise noted, technical terms are used according to conventional usage. Definitions of common terms in molecular biology may be found in Benjamin Lewin, Genes V, published by Oxford University Press, 1994 (ISBN 0-19-854287-9); Kendrew et al. (eds.), The Encyclopedia of Molecular Biology, published by Blackwell Science Ltd., 1994 (ISBN 0-632-02182-9); and Robert A. Meyers (ed.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 1-56081-569-8).

[0041] In order to facilitate review of the various embodiments of the disclosure, the following explanations of specific terms are provided:

[0042] Adenovirus: A non-enveloped virus with a linear, double-stranded DNA genome and an icosahedral capsid. There are currently 68 known serotypes of human adenovirus, which are divided into seven species (species A, B, C, D, E, F and G). Different serotypes of adenovirus are associated with different types of disease, with some serotypes causing respiratory disease (primarily species B and C), conjunctivitis (species B and D) and/or gastroenteritis (species F and G).

[0043] Administration: To provide or give a subject an agent, such as a therapeutic agent (e.g. a recombinant virus), by any effective route. Exemplary routes of administration include, but are not limited to, injection (such as subcutaneous, intramuscular, intradermal, intraperitoneal, and intravenous), oral, intraductal, sublingual, rectal, transdermal, intranasal, vaginal and inhalation routes. In some examples, the recombinant adenoviruses disclosed herein are administered directly to a wound site, for example on the skin.

[0044] Chimeric: Composed of at least two parts having different origins. In the context of the present disclosure, a chimeric adenovirus is an adenovirus having genetic material and/or proteins derived from at least two different serotypes (such as from Ad5 and a second serotype of adenovirus). In this context, a capsid-swapped adenovirus refers to a chimeric adenovirus in which the capsid proteins are derived from one serotype of adenovirus and the remaining proteins are derived from another adenovirus serotype. Similarly, a chimeric fiber is a fiber protein having amino acid sequence derived from at least two different serotypes of adenovirus. For example, a chimeric fiber can be composed of a fiber shaft from Ad5 and a fiber knob from a second serotype of adenovirus.

[0045] Contacting: Placement in direct physical association; includes both in solid and liquid form.

[0046] Degenerate variant: In the context of the present disclosure, a degenerate variant refers to a polynucleotide encoding a peptide that includes a sequence that is degenerate as a result of the genetic code. There are 20 natural amino acids, most of which are specified by more than one codon. Therefore, all degenerate nucleotide sequences encoding a peptide are included as long as the amino acid sequence of the peptide encoded by the nucleotide sequence is unchanged.

[0047] Detargeted: In the context of the present disclosure, a detargeted adenovirus is a recombinant or synthetic adenovirus comprising one or more modifications that alter tropism of the virus such that is no longer infects, or no longer substantially infects, a particular cell or tissue type. In some embodiments, the recombinant or synthetic adenovirus comprises a capsid mutation, such as a mutation in the hexon protein (for example, E451Q). In some embodiments, the recombinant or synthetic adenovirus comprises a native capsid from an adenovirus that naturally does not infect, or does not substantially infect, a particular cell or tissue type. In some embodiments herein, the recombinant or synthetic adenovirus is liver detargeted and/or spleen detargeted.

[0048] E1A: The adenovirus early region 1A (E1A) gene and polypeptides expressed from the gene. The E1A protein plays a role in viral genome replication by driving cells into the cell cycle. As used herein, the term E1A protein refers to the proteins expressed from the E1A gene and the term includes E1A proteins produced by any adenovirus serotype.

[0049] Fiber: The adenovirus fiber protein is a trimeric protein that mediates binding to cell surface receptors. The fiber protein is comprised of a long N-terminal shaft and globular C-terminal knob.

[0050] Fusion protein: A protein containing amino acid sequence from at least two different (heterologous) proteins or peptides. Fusion proteins can be generated, for example, by expression of a nucleic acid sequence engineered from nucleic acid sequences encoding at least a portion of two different (heterologous) proteins. To create a fusion protein, the nucleic acid sequences must be in the same reading frame and contain no internal stop codons. Fusion proteins, particularly short fusion proteins, can also be generated by chemical synthesis.

[0051] Heterologous: A heterologous protein or gene refers to a protein or gene derived from a different source or species.

[0052] Hexon: A major adenovirus capsid protein. An exemplary hexon sequence from Ad5 is set forth herein as SEQ ID NO: 8. A mutant hexon sequence comprising an E451Q substitution is set forth herein as SEQ ID NO: 9.

[0053] Isolated: An isolated biological component (such as a nucleic acid molecule, protein, virus or cell) has been substantially separated or purified away from other biological components in the cell or tissue of the organism, or the organism itself, in which the component naturally occurs, such as other chromosomal and extra-chromosomal DNA and RNA, proteins and cells. Nucleic acid molecules and proteins that have been isolated include those purified by standard purification methods. The term also embraces nucleic acid molecules and proteins prepared by recombinant expression in a host cell as well as chemically synthesized nucleic acid molecules and proteins.

[0054] MicroRNA (miRNA or miR): A single-stranded RNA molecule that regulates gene expression in plants, animals and viruses. A gene encoding a microRNA is transcribed to form a primary transcript microRNA (pri-miRNA), which is processed to form a short stem-loop molecule, termed a precursor microRNA (pre-miRNA), followed by endonucleolytic cleavage to form the mature microRNA. Mature microRNAs are approximately 21-23 nucleotides in length and are partially complementary to the 3UTR of one or more target messenger RNAs (mRNAs). MicroRNAs modulate gene expression by promoting cleavage of target mRNAs or by blocking translation of the cellular transcript. In the context of the present disclosure, a liver-specific microRNA is a microRNA that is preferentially expressed in the liver, such as a microRNA that is expressed only in the liver, or a microRNA that is expressed significantly more in the liver as compared to other organs or tissue types. In some embodiments, the microRNA is miR-122.

[0055] Modification: A change in the sequence of a nucleic acid or protein sequence. For example, amino acid sequence modifications include, for example, substitutions, insertions and deletions, or combinations thereof. Insertions include amino and/or carboxyl terminal fusions as well as intrasequence insertions of single or multiple amino acid residues. Deletions are characterized by the removal of one or more amino acid residues from the protein sequence. In some embodiments herein, the modification (such as a substitution, insertion or deletion) results in a change in function, such as a reduction or enhancement of a particular activity of a protein. As used herein, ? or delta refer to a deletion. Substitutional modifications are those in which at least one residue has been removed and a different residue inserted in its place. Amino acid substitutions are typically of single residues, but can occur at a number of different locations at once. Substitutions, deletions, insertions or any combination thereof may be combined to arrive at a final mutant sequence. These modifications can be prepared by modification of nucleotides in the DNA encoding the protein, thereby producing DNA encoding the modification. Techniques for making insertion, deletion and substitution mutations at predetermined sites in DNA having a known sequence are well known in the art. A modified protein, nucleic acid or virus is one that has one or more modifications as outlined above.

[0056] Operably linked: A first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence. For instance, a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence. Generally, operably linked DNA sequences are contiguous and, where necessary to join two protein-coding regions, in the same reading frame.

[0057] Pharmaceutically acceptable carrier: The pharmaceutically acceptable carriers (vehicles) useful in this disclosure are conventional. Remington's Pharmaceutical Sciences, by E. W. Martin, Mack Publishing Co., Easton, Pa., 15th Edition (1975), describes compositions and formulations suitable for pharmaceutical delivery of one or more therapeutic compounds, molecules or agents (e.g. a synthetic virus disclosed herein).

[0058] In general, the nature of the carrier will depend on the particular mode of administration being employed. For instance, parenteral formulations usually comprise injectable fluids that include pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle. For solid compositions (for example, powder, pill, tablet, or capsule forms), conventional non-toxic solid carriers can include, for example, pharmaceutical grades of mannitol, lactose, starch, or magnesium stearate. In addition to biologically-neutral carriers, pharmaceutical compositions to be administered can contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.

[0059] Polypeptide, peptide or protein: A polymer in which the monomers are amino acid residues which are joined together through amide bonds. When the amino acids are alpha-amino acids, either the L-optical isomer or the D-optical isomer can be used. The terms polypeptide, peptide and protein are used interchangeably herein. These terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers. The term residue or amino acid residue includes reference to an amino acid that is incorporated into a protein, polypeptide, or peptide.

[0060] A conservative substitution in a polypeptide is a substitution of one amino acid residue in a protein sequence for a different amino acid residue having similar biochemical properties. Typically, conservative substitutions have little to no impact on the activity of a resulting polypeptide. For example, a protein or peptide including one or more conservative substitutions (for example no more than 1, 2, 3, 4 or 5 substitutions) retains the structure and function of the wild-type protein or peptide. A polypeptide can be produced to contain one or more conservative substitutions by manipulating the nucleotide sequence that encodes that polypeptide using, for example, standard procedures such as site-directed mutagenesis or PCR. In one example, such variants can be readily selected by testing antibody cross-reactivity or its ability to induce an immune response. Examples of conservative substitutions are shown below.

TABLE-US-00001 Original Residue Conservative Substitutions Ala Ser Arg Lys Asn Gln, His Asp Glu Cys Ser Gln Asn Glu Asp His Asn; Gln Ile Leu, Val Leu Ile; Val Lys Arg; Gln; Glu Met Leu; Ile Phe Met; Leu; Tyr Ser Thr Thr Ser Trp Tyr Tyr Trp; Phe Val Ile; Leu

[0061] Conservative substitutions generally maintain (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain.

[0062] The substitutions which in general are expected to produce the greatest changes in protein properties will be non-conservative, for instance changes in which (a) a hydrophilic residue, for example, seryl or threonyl, is substituted for (or by) a hydrophobic residue, for example, leucyl, isoleucyl, phenylalanyl, valyl or alanyl; (b) a cysteine or proline is substituted for (or by) any other residue; (c) a residue having an electropositive side chain, for example, lysyl, arginyl, or histadyl, is substituted for (or by) an electronegative residue, for example, glutamyl or aspartyl; or (d) a residue having a bulky side chain, for example, phenylalanine, is substituted for (or by) one not having a side chain, for example, glycine.

[0063] Preventing, treating or ameliorating a disease: Preventing a disease refers to inhibiting the full development of a disease. Treating refers to a therapeutic intervention that ameliorates a sign or symptom of a disease or pathological condition after it has begun to develop. Ameliorating refers to the reduction in the number or severity of signs or symptoms of a disease.

[0064] Promoter: A region of DNA that directs/initiates transcription of a nucleic acid (e.g. a gene). A promoter includes necessary nucleic acid sequences near the start site of transcription. Typically, promoters are located near the genes they transcribe. A promoter also optionally includes distal enhancer or repressor elements which can be located as much as several thousand base pairs from the start site of transcription. A constitutive promoter is a promoter that is continuously active and is not subject to regulation by external signals or molecules. In contrast, the activity of an inducible promoter is regulated by an external signal or molecule (for example, a transcription factor or tetracycline). A tissue-specific promoter is a promoter that is substantially active only in a particular tissue or tissues.

[0065] Protein IX (pIX): A minor component of the adenovirus capsid that associates with the hexon protein

[0066] Purified: The term purified does not require absolute purity; rather, it is intended as a relative term. Thus, for example, a purified peptide, protein, virus, or other active compound is one that is isolated in whole or in part from naturally associated proteins and other contaminants. In certain embodiments, the term substantially purified refers to a peptide, protein, virus or other active compound that has been isolated from a cell, cell culture medium, or other crude preparation and subjected to fractionation to remove various components of the initial preparation, such as proteins, cellular debris, and other components.

[0067] Recombinant: A recombinant nucleic acid molecule, protein or virus is one that has a sequence that is not naturally occurring or has a sequence that is made by an artificial combination of two otherwise separated segments of sequence. This artificial combination can be accomplished by chemical synthesis or by the artificial manipulation of isolated segments of nucleic acid molecules, such as by genetic engineering techniques. The term recombinant also includes nucleic acids, proteins and viruses that have been altered solely by addition, substitution, or deletion of a portion of the natural nucleic acid molecule, protein or virus.

[0068] Sequence identity: The identity or similarity between two or more nucleic acid sequences, or two or more amino acid sequences, is expressed in terms of the identity or similarity between the sequences. Sequence identity can be measured in terms of percentage identity; the higher the percentage, the more identical the sequences are. Sequence similarity can be measured in terms of percentage similarity (which takes into account conservative amino acid substitutions); the higher the percentage, the more similar the sequences are. Homologs or orthologs of nucleic acid or amino acid sequences possess a relatively high degree of sequence identity/similarity when aligned using standard methods. This homology is more significant when the orthologous proteins or cDNAs are derived from species which are more closely related (such as human and mouse sequences), compared to species more distantly related (such as human and C. elegans sequences).

[0069] Methods of alignment of sequences for comparison are well known in the art. Various programs and alignment algorithms are described in: Smith & Waterman, Adv. Appl. Math. 2:482, 1981; Needleman & Wunsch, J. Mol. Biol. 48:443, 1970; Pearson & Lipman, Proc. Natl. Acad. Sci. USA 85:2444, 1988; Higgins & Sharp, Gene, 73:237-44, 1988; Higgins & Sharp, CABIOS 5:151-3, 1989; Corpet et al., Nuc. Acids Res. 16:10881-90, 1988; Huang et al. Computer Appls. in the Biosciences 8, 155-65, 1992; and Pearson et al., Meth. Mol. Bio. 24:307-31, 1994. Altschul et al., J. Mol. Biol. 215:403-10, 1990, presents a detailed consideration of sequence alignment methods and homology calculations.

[0070] The NCBI Basic Local Alignment Search Tool (BLAST) (Altschul et al., J. Mol. Biol. 215:403-10, 1990) is available from several sources, including the National Center for Biological Information (NCBI) and on the internet, for use in connection with the sequence analysis programs blastp, blastn, blastx, tblastn and tblastx. Additional information can be found at the NCBI web site.

[0071] Serotype: A group of closely related microorganisms (such as viruses) distinguished by a characteristic set of antigens.

[0072] Subject: Living multi-cellular vertebrate organisms, a category that includes human and non-human mammals, such as veterinary subjects, for example mice, dogs, cats, rabbits, cows, horses, sheep, and pigs.

[0073] Synthetic: Produced by artificial means in a laboratory, for example a synthetic nucleic acid or protein can be chemically synthesized in a laboratory.

[0074] Therapeutic agent: A chemical compound, small molecule, recombinant virus or other composition, such as an antisense compound, antibody, peptide or nucleic acid molecule capable of inducing a desired therapeutic or prophylactic effect when properly administered to a subject.

[0075] Therapeutically effective amount: A quantity of a specified pharmaceutical or therapeutic agent (e.g. a recombinant virus) sufficient to achieve a desired effect in a subject, or in a cell, being treated with the agent. The effective amount of the agent can be dependent on several factors, including, but not limited to the subject or cells being treated, and the manner of administration of the therapeutic composition.

[0076] Tissue damage: Refers to any damage or injury to a tissue that may result from, for example, a physical injury, or a disease or pathological condition. In some cases, the tissue damage is damage caused by ischemia, ischemia/reperfusion, cirrhosis, or abnormal fibrosis.

[0077] Tissue regeneration: In the context of the present disclosure, tissue regeneration refers to the growth of new tissue or to the healing of damaged tissue.

[0078] Transgene: A gene that has been inserted into the genome of a different organism (such as a virus). Transgenes can also be referred to as heterologous genes.

[0079] Uexon: An open reading frame located on the 1 strand (leftward transcription) between the early E3 region and the fiber gene (Tollefson et al., J Virol 81(23):12918-12926).

[0080] Vector: A nucleic acid molecule allowing insertion of foreign nucleic acid without disrupting the ability of the vector to replicate and/or integrate in a host cell. A vector can include nucleic acid sequences that permit it to replicate in a host cell, such as an origin of replication. A vector can also include one or more selectable marker genes and other genetic elements. An expression vector is a vector that contains the necessary regulatory sequences to allow transcription and translation of inserted gene or genes.

[0081] Wound: An injury or damage to living tissue.

[0082] Wound repair: The process of replacing damaged or missing cellular structures or tissue layers. Wound repair (or wound healing) is characterized by the steps of hemostasis (blood clotting), inflammation, proliferation (growth of new tissues) and remodeling.

III. Overview of Several Embodiments

[0083] Adenovirus (Ad) is a natural multi-gene expression vehicle. Certain coding regions of the virus (E1, E3 and E4) are either not necessary for replication in culture or can be complemented with available cell lines. Therefore, each of these regions can be replaced with non-viral genes to drive the expression of multiple therapeutic gene products from a single virus. Adenovirus genomes do not integrate into human cell genomes and are lost upon cell division and nuclear envelope breakdown. There are 68 different human adenovirus serotypes, each of which as different properties. Ad5 has been the predominant Ad vector used in basic research, gene therapy and oncolytic virus therapy. However, Ad5 has a limited tropism and only infects epithelial cells that have the CAR receptor for viral uptake. Furthermore, when injected intravenously, Ad5 binds to blood factors that cause it to be sequestered in the liver where it can trigger potentially limiting inflammation and toxicity. To overcome these issues, the present disclosure provides synthetic adenoviruses with genomic modifications in the E1 region and capsid modules that prevent uptake and expression in the liver, and allow for targeting specifically to the sites of wounds and tissue damage when injected intravenously.

[0084] Disclosed herein are synthetic adenoviruses comprising a chimeric fiber protein that includes an Ad5 shaft domain and an Ad34 knob domain. The disclosed viruses also include a native or modified capsid that detargets the synthetic adenovirus from the liver. The synthetic adenoviruses are capable of specifically infecting wound sites and regions of damaged or injured tissue. It is disclosed herein that the synthetic adenovirus vectors that specifically infect cells at wound sites or in regions of damaged tissue are capable of expressing heterologous proteins in these cells. Synthetic adenoviruses expressing reporter genes can be used, for example, to enable early detection of a wound site or damaged tissue, thereby allowing for appropriate treatment decisions. Synthetic adenoviruses expressing key regulators of wound repair or tissue regeneration can be used to promote wound repair and/or boost tissue regeneration in organs such as the kidney, heart, liver, lung and skin, for example to restore tissue homeostasis, reduce fibrosis or scarring, and enhance regenerative capacity without the increased risk of off-target effects in other tissues (such as in the liver) or of cellular transformation.

[0085] Provided herein is a method of expressing at least one transgene (such as at least 2, at least 3, at least 4 or at least 5 transgenes) at the site of a wound or damaged tissue in a subject. In some embodiments, the method includes administering to the subject a synthetic adenovirus comprising the transgene(s); a native or modified capsid that detargets the synthetic adenovirus from the liver; and a chimeric fiber protein comprising an Ad5 shaft domain and an Ad34 knob domain, thereby expressing the at least one transgene at the site of the wound or damaged tissue. In some examples, the at least one transgene encodes at least one factor (such as at least 2, at least 3, at least 4 or at least 5 factors) that promotes wound repair or tissue regeneration. In some examples, the method further includes the step of detecting expression of the at least one transgene at the site of the wound or damaged tissue.

[0086] Also provided herein is a method of promoting wound repair or tissue regeneration in a subject. In some embodiments, the method includes administering to the subject a synthetic adenovirus comprising a transgene encoding at least one heterologous factor that promotes wound repair or tissue regeneration; a native or modified capsid that detargets the synthetic adenovirus from the liver; and a chimeric fiber protein comprising an Ad5 shaft domain and an Ad34 knob domain, thereby promoting wound repair or tissue regeneration in the subject.

[0087] In some embodiments of the method disclosed herein, the method further includes selecting a subject with a wound or damaged tissue. In some embodiments, the method further includes measuring wound repair or tissue regeneration, or detecting an increase in wound repair or tissue regeneration.

[0088] In some embodiments, the wound is a cutaneous wound. In particular examples, the cutaneous wound comprises an incision, a laceration, an abrasion, a puncture wound, a closed wound, a burn, an infected lesion, a surgical site, an ulcer, a scar, a keloid, a blister, sepsis, stroke, myocardial infarction, or any combination thereof.

[0089] In some embodiments, the tissue is damaged as a result of an injury, disease or pathological condition. In some examples, the tissue damage or injury is an ischemic injury, an ischemia/reperfusion injury, a microvascular injury, inflammation, abnormal fibrosis, cirrhosis, or any combination thereof. In some examples, the damaged tissue is kidney, heart, liver or lung tissue.

[0090] In some embodiments, the synthetic adenovirus comprises a modified capsid that detargets the synthetic adenovirus from the liver. In some examples, the modified capsid includes one or more modifications that detarget the virus from the liver. In some examples, the synthetic adenovirus comprises a modified hexon protein. In one non-limiting examples, the modified hexon protein comprises an E451Q mutation, such as the hexon protein of SEQ ID NO: 9. In another example, the modified hexon protein comprises hypervariable regions from a different adenovirus serotype.

[0091] In other embodiments, the synthetic adenovirus comprises a native capsid that detargets the synthetic adenovirus from the liver. In some examples, the native capsid is an Ad11, Ad34 or Ad35 capsid.

[0092] In some embodiments, the synthetic adenovirus further comprises one or more binding sites for a liver-specific microRNA. In some examples, the liver-specific microRNA is miR-122, miR-30 or miR-192. In particular examples, the one or more (such as 1, 2, 3 or 4) miR binding sites are in the 3UTR of the adenovirus E1 region.

[0093] In some embodiments, the synthetic adenovirus further comprises one or more binding sites for a spleen-specific microRNA. In some examples, the spleen-specific microRNA is miR142-3p. In particular examples, the one or more (such as 1, 2, 3 or 4) miR binding sites are in the 3UTR of the adenovirus E1 region.

[0094] Also provided herein is a method of detecting a wound or damaged tissue in a subject. In some embodiments, the method includes administering to the subject a synthetic adenovirus comprising a reporter gene; a native or modified capsid that detargets the synthetic adenovirus from the liver; and a chimeric fiber protein comprising an Ad5 shaft domain and an Ad34 knob domain.

[0095] In some embodiments of the methods disclosed herein, the synthetic adenovirus encodes at least one reporter gene (such as at least 2, at least 3, at least 4 or at least 5 report genes) to detect a wound site or damaged tissue. In specific non-limiting examples, the at least one reporter gene comprises a fluorophore, such as luciferase, GFP, yellow fluorescent protein (YFP), cyan fluorescent protein (CFP), red fluorescent protein (RFP), blue fluorescent protein (BFP), and/or orange fluorescent protein (for example, mOrange), a soluble secreted factor, or a MRI/PET/CT probe.

[0096] In some embodiments, the synthetic adenovirus encodes at least one factor that promotes wound repair. In some examples, the factor(s) that promotes wound repair is a member of the Wnt signaling pathway or the TGF-? signaling pathway. In specific non-limiting examples, the at least one factor that promote wound repair is selected from the group consisting of Wnt1, Wnt2, Wnt2b, Wnt3, Wnt3a, Wnt4, Wnt5a, Wnt5b, Wnt6, Wnt7a, Wnt8a, Wnt8b, Wnt9a, Wnt9b, Wnt10a, Wnt10b, Wnt11, Wnt16, TGF-?1, TGF-?2, TGF-?3, PDGF-?, PDGF-?, PDGF-c, PDGF-d, and TNF-?. In one non-limiting examples, the factor is PDGF-?.

[0097] In some embodiments, the synthetic adenovirus encodes at least one factor that promotes kidney tissue regeneration. In some examples, the at least one factor that promotes kidney tissue regeneration is selected from the group consisting of Wt1, Pax2, Foxc1, Foxd1, Bmp4, Sall1, Fgf7, Gdnf, Notch2, Sox and progranulin (PGRN).

[0098] In some embodiments, the synthetic adenovirus encodes at least one factor that promotes heart tissue regeneration. In some examples, the at least one factor that promotes heart tissue regeneration is selected from the group consisting of Mef2c, Tbx20, Hand2, Foxhl and Bop.

[0099] In some embodiments, the synthetic adenovirus encodes at least one factor that promotes liver tissue regeneration. In some examples, the at least one factor that promotes liver tissue regeneration is selected from the group consisting of Hex, Gata4, Gata6, Tbx3, Cebp-?, Hnf1-?, Hnf1-?, Foxa1, Foxa2, Foxa3, Hnf4-? and Hnf6.

[0100] In some embodiments, the synthetic adenovirus encodes at least one factor that promotes lung tissue regeneration. In some examples, the at least one factor that promotes lung tissue regeneration is selected from the group consisting of stem cell factor (SCF), Hnf3-?, Shh, Nkx2.1, Foxf1, Gli, FGF-10, GATA and VEGF.

[0101] In some embodiments, the synthetic adenovirus encodes at least one factor that promotes pancreatic tissue regeneration. In some examples, the at least one factor that promotes pancreatic tissue regeneration is selected from the group consisting of Glul, Lgmn, Reg3?, Ngn3, Pdx1 and Mafa.

[0102] In some embodiments, expression of the at least one heterologous factor that promotes wound repair or tissue regeneration is regulated by a tissue-specific promoter. In some examples, the tissue-specific promoter is active in kidney, heart, lung, liver or pancreas tissue. In particular non-limiting examples the pancreas-specific promoter comprises Pdx1; the liver-specific promoter comprises albumin or ?1-antitrypsin; the heart-specific promoter comprises MLC-2v; the lung-specific promoter comprises surfactant protein A, B or C; or the kidney-specific promoter comprises Sglt2, nephrin, and kidney-specific cadherin.

[0103] In some embodiments of the methods disclosed herein, the synthetic adenovirus is generated from an Ad5 vector genome. In other embodiments, the synthetic adenovirus is generated from an Ad2 vector genome.

[0104] In alternative embodiments of the methods disclosed herein, the synthetic adenovirus comprises a chimeric fiber protein that includes an Ad2 shaft domain (instead of an Ad5 shaft domain) and an Ad34 knob domain.

[0105] Further provided herein are synthetic adenovirus genomes that include the nucleotide sequence of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 10 or SEQ ID NO: 11.

IV. Synthetic Adenoviruses

[0106] The Adsembly, AdSLICr and RapAD technologies enable the modular design and production of adenoviruses with unique capabilities (see PCT Publication Nos. WO2012/024351 and WO2013/138505, which are herein incorporated by reference). The ability to design custom viruses with novel functions and properties opens up the potential to expand the utility of adenovirus as a vehicle to deliver therapeutic proteins by persuading the host to produce proteins in situ. This provides the unique capability to use human proteins that are difficult to manufacture for therapeutic purposes, and enable flexible delivery of almost any protein to diseased tissues.

[0107] The specific modifications disclosed herein are described with reference to the adenovirus 5 (Ad5) genome sequence, but may be used with any adenovirus serotype. Adenovirus is a natural multi-gene expression vehicle. The E1, E3, and E4 regions are either not necessary for replication in culture or can be complemented with available cell lines. Each of these regions has independent promoter elements that can be replaced with cellular promoters if necessary to drive the expression of multiple gene products via alternative splicing.

[0108] As disclosed herein, to create Ad5 expression vectors for in vivo use and gene delivery, the E1A/E1 genes were deleted and replaced with at least one transgene. In some embodiments, the transgene is an EF1? driven luciferase-GFP fusion.

[0109] The synthetic adenoviruses disclosed herein may further include modifications that detarget the virus from the liver. Ad5 hexon can bind to Factor X in the blood, which can lead to its absorption by Kuppfer cells in the liver that prevent systemic dissemination and limiting inflammation. To overcome this, synthetic adenoviruses were engineered to include additional genomic modifications in the E1 and core modules that prevent uptake and expression in the liver, as described further below.

[0110] A. Ad34 Fiber and Chimeric Fiber Proteins for Retargeting

[0111] While the fiber proteins of Ad5 and many other serotypes have been shown to bind to the coxsackie adenovirus receptor (CAR) for cellular attachment, other serotypes have been shown to use CD46 (Gaggar et al., Nat Med 9:1408-1412, 2003), desmoglein 2 (Wang et al., Nat Med 17:96-104, 2011), sialic acid (Nilsson et al., Nat Med 17:105-109, 2011), or others (Arnberg, Trends Pharmacol Sci 33:442-448, 2012). The receptor usage of many serotypes has not been thoroughly examined and CD46 is not thought to be expressed in mature mice. Since the globular knob at the C-terminus of the fiber protein is typically responsible for receptor binding, chimeras were created by replacing the Ad5 fiber knob with that from either Ad3, Ad9, Ad11, Ad12, or Ad34 (see Example 1 below). Each virus was created with the same E1 module containing an E1A/E1B deletion and a luciferase-GFP fusion driven by an EF1? promoter. The panel was used to transduce the H9 stem cell line and luciferase expression was measured. Compared to Ad5 fibers, significantly higher luciferase-GFP expression was observed in almost all cells when using chimeras with either Ad3, Ad9, Ad12 or Ad34. Conversely, luciferase-GFP expression was almost universally lower in cells transduced with the Ad11 fiber chimera. These data demonstrate the ability to combine modified parts from other serotypes in order to improve Ad5-based vectors. In this case allowing for rapid assembly of viruses that are optimized for entry into specific cell types.

[0112] B. Liver Detargeting Modifications

[0113] Natural adenovirus type 5 vectors will only infect the lungs (via inhalation) or liver (via intravenous administration). Ad5 hexon binds to Factor X in the blood, which leads its absorption by Kuppfer cells in the liver, preventing systemic dissemination and inducing virus-limiting inflammation. To overcome this and enable intravenous delivery of viruses that could travel to the sites of wounds/injuries systemically, synthetic adenoviruses were engineered to include additional genomic modifications in the E1 and core modules that prevent uptake and expression in the liver.

[0114] To prevent virus uptake and sequestration in the liver through Ad5 hexon binding to Factor X, viruses were engineered with an additional mutation in hexon (E451Q) that prevents liver uptake. For example, AdSyn-CO171 does not accumulate in the liver and instead is able to target other organs, such as the spleen and lymph nodes. Thus, in some embodiments herein, the synthetic adenovirus comprises a modified hexon protein with an E451Q substitution.

[0115] To prevent off-target expression in the liver, viruses were engineered to include binding sites in the 3 untranslated region (UTR) of the E1 region for microRNAs that are specifically expressed in the liver. In particular embodiments, miR122 was selected as the liver-specific microRNA as its expression and binding sites are conserved in both human and mouse liver cells. In some examples, two micro-RNA binding sites for liver-specific miR122 were inserted in the 3UTR of E1A to prevent any residual virus uptake in the liver inducing viral gene expression and cellular inflammatory responses.

[0116] It is disclosed herein that a synthetic adenovirus with the miR-122 binding site and hexon mutation does not accumulate in the liver and instead is able to target other organs, such as the spleen and lymph nodes (see Example 1). In some embodiments, the one or more binding sites for the liver-specific microRNA are located in the 3-UTR of E1A. In some examples, the liver-specific microRNA is miR-122, miR-30 or miR-192.

[0117] Other mutations to the adenovirus hexon gene are contemplated herein to prevent adenovirus accumulation in the liver. For example, a synthetic adenovirus could be detargeted from the liver by replacing the nine hypervariable regions of hexon with those from different serotypes.

[0118] In some examples, the synthetic adenovirus comprises a hexon protein comprising or consisting of the amino acid sequence of SEQ ID NO: 8 or SEQ ID NO: 9.

TABLE-US-00002 Ad5hexon (SEQIDNO:8) MATPSMMPQWSYMHISGQDASEYLSPGLVQFARATETYFSLNNKFRNP TVAPTHDVTTDRSQRLTLRFIPVDREDTAYSYKARFTLAVGDNRVLDM ASTYFDIRGVLDRGPTFKPYSGTAYNALAPKGAPNPCEWDEAATALEI NLEEEDDDNEDEVDEQAEQQKTHVFGQAPYSGINITKEGIQIGVEGQT PKYADKTFQPEPQIGESQWYETEINHAAGRVLKKTTPMKPCYGSYAKP TNENGGQGILVKQQNGKLESQVEMQFFSTTEATAGNGDNLTPKVVLYS EDVDIETPDTHISYMPTIKEGNSRELMGQQSMPNRPNYIAFRDNFIGL MYYNSTGNMGVLAGQASQLNAVVDLQDRNTELSYQLLLDSIGDRTRYF SMWNQAVDSYDPDVRIIENHGTEDELPNYCFPLGGVINTETLTKVKPK TGQENGWEKDATEFSDKNEIRVGNNFAMEINLNANLWRNFLYSNIALY LPDKLKYSPSNVKISDNPNTYDYMNKRVVAPGLVDCYINLGARWSLDY MDNVNPFNHHRNAGLRYRSMLLGNGRYVPFHIQVPQKFFAIKNLLLLP GSYTYEWNFRKDVNMVLQSSLGNDLRVDGASIKFDSICLYATFFPMAH NTASTLEAMLRNDTNDQSFNDYLSAANMLYPIPANATNVPISIPSRNW AAFRGWAFTRLKTKETPSLGSGYDPYYTYSGSIPYLDGTFYLNHTFKK VAITFDSSVSWPGNDRLLTPNEFEIKRSVDGEGYNVAQCNMTKDWFLV QMLANYNIGYQGFYIPESYKDRMYSFFRNFQPMSRQVVDDTKYKDYQQ VGILHQHNNSGFVGYLAPTMREGQAYPANFPYPLIGKTAVDSITQKKF LCDRTLWRIPFSSNFMSMGALTDLGQNLLYANSAHALDMTFEVDPMDE PTLLYVLFEVFDVVRVHRPHRGVIETVYLRTPFSAGNATT Ad5hexonE451Q (SEQIDNO:9) MATPSMMPQWSYMHISGQDASEYLSPGLVQFARATETYFSLNNKFRNP TVAPTHDVTTDRSQRLTLRFIPVDREDTAYSYKARFTLAVGDNRVLDM ASTYFDIRGVLDRGPTFKPYSGTAYNALAPKGAPNPCEWDEAATALEI NLEEEDDDNEDEVDEQAEQQKTHVFGQAPYSGINITKEGIQIGVEGQT PKYADKTFQPEPQIGESQWYETEINHAAGRVLKKTTPMKPCYGSYAKP TNENGGQGILVKQQNGKLESQVEMQFFSTTEATAGNGDNLTPKVVLYS EDVDIETPDTHISYMPTIKEGNSRELMGQQSMPNRPNYIAFRDNFIGL MYYNSTGNMGVLAGQASQLNAVVDLQDRNTELSYQLLLDSIGDRTRYF SMWNQAVDSYDPDVRIIENHGTEDELPNYCFPLGGVINTETLTKVKPK TGQENGWEKDATEFSDKNQIRVGNNFAMEINLNANLWRNFLYSNIALY LPDKLKYSPSNVKISDNPNTYDYMNKRVVAPGLVDCYINLGARWSLDY MDNVNPFNHHRNAGLRYRSMLLGNGRYVPFHIQVPQKFFAIKNLLLLP GSYTYEWNFRKDVNMVLQSSLGNDLRVDGASIKFDSICLYATFFPMAH NTASTLEAMLRNDTNDQSFNDYLSAANMLYPIPANATNVPISIPSRNW AAFRGWAFTRLKTKETPSLGSGYDPYYTYSGSIPYLDGTFYLNHTFKK VAITFDSSVSWPGNDRLLTPNEFEIKRSVDGEGYNVAQCNMTKDWFLV QMLANYNIGYQGFYIPESYKDRMYSFFRNFQPMSRQVVDDTKYKDYQQ VGILHQHNNSGFVGYLAPTMREGQAYPANFPYPLIGKTAVDSITQKKF LCDRTLWRIPFSSNFMSMGALTDLGQNLLYANSAHALDMTFEVDPMDE PTLLYVLFEVFDVVRVHRPHRGVIETVYLRTPFSAGNATT (theE451Qsubstitutionisshowninbold underline)

[0119] C. Capsid Swaps for Evading Neutralizing Antibodies

[0120] The majority of the human population already has antibodies that recognize Ad5, the serotype most frequently used in research and therapeutic applications. Moreover, once a particular adenovirus serotype is used in a patient, new antibodies that recognize the viral capsid will be generated, making repeated administration of the same vector problematic. Therefore, the present disclosure further contemplates exploiting natural adenovirus modularity to create chimeric viruses capable of evading existing neutralizing antibodies. For example, the synthetic adenoviruses disclosed herein may further have complete capsid module swaps (almost 60% of genome), which render them invisible to pre-existing antibodies and enables repeated inoculations.

[0121] In some embodiments, the E1, E3 and E4 regions of the genome are derived from a first adenovirus serotype and the E2B, L1, L2, L3, E2A and L4 regions of the genome are derived from a second adenovirus serotype, such as Ad34. In some examples, the E1 region of the first adenovirus serotype is modified to encode a pIX protein from the second adenovirus serotype; and/or the E3 region of the first adenovirus serotype is modified to encode Uexon and fiber proteins from the second adenovirus serotype. In particular examples, the first adenovirus serotype is Ad5 and the second adenovirus serotype is Ad34.

[0122] D. Expression of Transgenes for Research and Therapeutic Applications

[0123] It is disclosed herein that synthetic adenoviruses comprising a chimeric fiber protein having an Ad34 knob domain and liver detargeting mutations is capable of specifically infecting sites of wounded or damaged tissue. It is further disclosed that the synthetic adenoviruses are capable of expressing transgenes in cells of wounds/injured tissue. In one example, the transgene is a reporter, such as a luciferase-GFP reporter that enables detection of virus expression. The present disclosure contemplates synthetic adenoviruses encoding reporter genes to detect the wound sites and/or damaged tissue. The present disclosure further contemplates transgenes encoding factors that promote wound repair and/or tissue regeneration. Such synthetic vectors could be used for a variety of therapeutic applications.

[0124] The present disclosure provides synthetic adenoviruses encoding reporter genes to detect wound sites and/or damaged tissue. Early detection and treatment of a wound or tissue damage is desirable in order to prevent or limit potentially severe consequences of a wound, particularly sepsis. Sepsis is a heightened systemic immune response state and the eleventh leading cause of death (Murphy et al., Natl Vital Stat Rep 61:1-117, 2013). In some embodiments, the synthetic adenoviruses encode on or more reporter genes selected from luciferase, GFP, yellow fluorescent protein (YFP), cyan fluorescent protein (CFP), red fluorescent protein (RFP), blue fluorescent protein (BFP) and orange fluorescent protein (such as mOrange).

[0125] The major signaling pathways involved in cutaneous wound repair have been investigated, including, for example, the Wnt and TGF-? pathways (Bielefeld et al., Cell Mol Life Sci 70: 2059-2081, 2013). The synthetic adenoviruses disclosed herein are capable of specifically infecting wound sites. In some embodiments, the synthetic adenoviruses encode at least one factor involved in wound repair, such as a member of the Wnt or TGF-? pathway. In some examples, the at least one factor includes one or more of (such as at least 2, at least 3, at least 4, or at least 5 of) Wnt1, Wnt2, Wnt2b, Wnt3, Wnt3a, Wnt4, Wnt5a, Wnt5b, Wnt6, Wnt7a, Wnt8a, Wnt8b, Wnt9a, Wnt9b, Wnt10a, Wnt10b, Wnt11, Wnt16 TGF-?1, TGF-?2, TGF-?3, PDGF-?, PDGF-?, PDGF-c, PDCF-d, and TNF-?.

[0126] In other embodiments, the factors involved in wound repair may include growth factors, cytokines, therapeutic proteins, hormones, peptide fragments of hormones, inhibitors of cytokines, peptide growth and differentiation factors, interleukins, chemokines, interferons, colony stimulating factors and angiogenic factors. In some examples, the at least one factor involved in wound repair includes, but is not limited to, a member of the TGF-? superfamily, such as one of the five TGF-? isoforms, bone morphogenetic proteins (BMP), or latent TGF-? binding proteins (LTBP); keratinocyte growth factor (KGF); hepatocyte growth factor (HGF); platelet derived growth factor (PDGF); insulin-like growth factor (IGF); the basic fibroblast growth factors (FGF-1, FGF-2 etc.), vascular endothelial growth factor (VEGF); Factor VIII and Factor IX; erythropoietin (EPO); tissue plasminogen activator (TPA); and activins and inhibins. In some examples, the at least one factor involved in wound repair is a hormone, such as growth hormone (GH) or parathyroid hormone (PTH). The at least one factor involved in wound repair may also include extracellular proteins, such as extracellular matrix proteins, for example collagen, laminin, and fibronectin. In other examples, the at least one factor involved in wound repair includes cell adhesion molecules (for example, integrins, selectins, Ig family members, such as N-CAM and L1, and cadherins); cytokine signaling receptors, such as the type I and type II TGF-? receptors and the FGF receptor; and non-signaling co-receptors such as betaglycan and syndecan. In yet other examples, the at least one factor involved in wound repair includes cytoskeletal proteins, such as talin and vinculin; cytokine binding proteins, such as the family of latent TGF-? binding proteins; and nuclear trans-acting proteins, such as transcription factors and enhancing factors.

[0127] Although damaged tissues share a similar repair process after almost any destructive stimulus, tissue specific growth factors, especially the genes that play key roles in tissue development, may play a role in recovery from the injury and avoid fibrosis. In some embodiments, the synthetic adenovirus encodes at least one factor for promoting tissue regeneration or healing of damaged kidney tissue. In some examples, the at least one factor is selected from Wt1, Pax2, Foxc1, Foxd1, Bmp4, Sall1, Fgf7, Gdnf, Notch2 and Sox9 (Vainio and Lin, Nat Rev Genet 3:533-543, 2002).

[0128] The present disclosure also contemplates the use of the disclosed synthetic adenoviruses for promoting tissue regeneration/repair following myocardial infarction, cirrhosis of the liver, fibrosis of the lung and fibrosis of the pancreas. Myocardial infarction can lead to the formation of scar tissue, ultimately resulting in congestive heart failure. Congestive heart failure accounts for more than 100,000 deaths each year in the United States. Cirrhosis of the liver and fibrosis of the lungs are also life-threatening conditions (2012 NHLBI Morbidity and Mortality Chart Book). Fibrosis in the pancreas is caused by alcohol consumption, tobacco use, genetic mutations or autoimmune destruction. The necrosis/apoptosis, inflammation or duct obstruction in the processes of fibrosis result in exocrine and endocrine insufficiency, and ultimately diabetes.

[0129] In some embodiments, the synthetic adenovirus disclosed herein encodes at least one factor for promoting heart tissue regeneration or healing of damaged heart tissue. In some examples, the at least one factor is selected from Mef2c, Tbx20, Hand2, Foxhl and Bop (Chen and Fishman, Trends Genet 16:383-388, 2000).

[0130] In some embodiments, the synthetic adenovirus disclosed herein encodes at least one factor for promoting liver tissue regeneration or healing of damaged liver tissue. In some examples, the at least one factor is selected from Hex, Gata4, Gata6, Tbx3, Cebp-?, Hnf1-?, Hnf1-?, Foxa1, Foxa2, Foxa3, Hnf4-? and Hnf6 (Gordillo et al., Development 142:2094-2108, 2015).

[0131] In some embodiments, the synthetic adenovirus disclosed herein encodes at least one factor for promoting lung tissue regeneration or healing of damaged lung tissue. In some examples, the at least one factor is selected from stem cell factor (SCF), Hnf3-?, Shh, Nkx2.1, Foxf1, Gli, FGF-10, GATA and VEGF (Kumar et al., Adv Clin Chem 40:261-316, 2005).

[0132] In some embodiments, the synthetic adenovirus disclosed herein encodes at least one factor for promoting pancreatic tissue regeneration or healing of damaged pancreatic tissue. In some examples, the at least one factor is selected from Glul, Lgmn, Reg3a, Ngn3, Pdx1 and Mafa (Choi et al., Bio Chem 391:1019-1029, 2010; Zhou et al., Nature 455:627-632, 2008).

[0133] In some embodiments, the expression cassette/transgene(s) is inserted into and replace the E1 and/or E3 and/or E4 region(s). Appropriate transgene insertion sites are well known in the art (see, for example, PCT Publication No. WO2012/024351).

[0134] The transgene (or nucleic acid encoding the factor that promotes wound repair and/or tissue regeneration) is operably linked to a promoter. In some embodiments, the promoter is a heterologous promoter. In some examples, the promoter is the EF1? promoter. The selection of promoter is within the capabilities of one of skill in the art. In some cases, the promoter is an inducible promoter or a tissue-specific promoter. For instances in which a tissue-specific promoter is used to regulate expression of the transgene, exemplary promoters include, but are not limited to, Pdx1 (pancreas), albumin (liver), al-antitrypsin (liver), MLC-2v (heart), surfactant proteins A, B or C (lung), Sglt2 (kidney), nephrin (kidney) and kidney-specific cadherin (kidney).

[0135] In some cases a single promoter is used to regulate expression of multiple genes, which can be achieved by use of an internal ribosomal entry site (IRES) or 2A peptide.

V. Pharmaceutical Compositions and Administration Thereof

[0136] Provided herein are compositions comprising a synthetic adenovirus (or one or more nucleic acids or vectors encoding the synthetic adenovirus). The compositions are, optionally, suitable for formulation and administration in vitro or in vivo. Optionally, the compositions comprise one or more of the provided agents and a pharmaceutically acceptable carrier. Suitable carriers and their formulations are described in Remington: The Science and Practice of Pharmacy, 22.sup.nd Edition, Loyd V. Allen et al., editors, Pharmaceutical Press (2012). Pharmaceutically acceptable carriers include materials that are not biologically or otherwise undesirable, i.e., the material is administered to a subject without causing undesirable biological effects or interacting in a deleterious manner with the other components of the pharmaceutical composition in which it is contained. If administered to a subject, the carrier is optionally selected to minimize degradation of the active ingredient and to minimize adverse side effects in the subject.

[0137] The synthetic viruses (or one or more nucleic acids or vectors encoding the synthetic adenovirus) are administered in accord with known methods, such as intravenous administration, e.g., as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerobrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, topical, intratumoral or inhalation routes. The administration may be local or systemic, and in some examples directly to a wound site. The compositions can be administered via any of several routes of administration, including topically, orally, parenterally, intravenously, intra-articularly, intraperitoneally, intramuscularly, subcutaneously, intracavity, transdermally, intrahepatically, intracranially, nebulization/inhalation, or by installation via bronchoscopy. Thus, the compositions are administered in a number of ways depending on whether local or systemic treatment is desired, and on the area to be treated.

[0138] In some embodiments, the compositions for administration will include a synthetic adenovirus (or synthetic genome) as described herein dissolved in a pharmaceutically acceptable carrier, preferably an aqueous carrier. A variety of aqueous carriers can be used, e.g., buffered saline and the like. These solutions are sterile and generally free of undesirable matter. These compositions may be sterilized by conventional, well known sterilization techniques. The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like. The concentration of active agent in these formulations can vary widely, and will be selected primarily based on fluid volumes, viscosities, body weight and the like in accordance with the particular mode of administration selected and the subject's needs.

[0139] Pharmaceutical formulations, particularly, of the synthetic viruses can be prepared by mixing the synthetic adenovirus (or one or more nucleic acids encoding the synthetic adenovirus) having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers. Such formulations can be lyophilized formulations or aqueous solutions.

[0140] Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations used. Acceptable carriers, excipients or stabilizers can be acetate, phosphate, citrate, and other organic acids; antioxidants (e.g., ascorbic acid) preservatives, low molecular weight polypeptides; proteins, such as serum albumin or gelatin, or hydrophilic polymers such as polyvinylpyllolidone; and amino acids, monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents; and ionic and non-ionic surfactants (e.g., polysorbate); salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants. The synthetic adenovirus (or one or more nucleic acids encoding the synthetic adenovirus) can be formulated at any appropriate concentration of infectious units.

[0141] Formulations suitable for oral administration can consist of (a) liquid solutions, such as an effective amount of the synthetic adenovirus suspended in diluents, such as water, saline or PEG 400; (b) capsules, sachets or tablets, each containing a predetermined amount of the active ingredient, as liquids, solids, granules or gelatin; (c) suspensions in an appropriate liquid; and (d) suitable emulsions. Tablet forms can include one or more of lactose, sucrose, mannitol, sorbitol, calcium phosphates, corn starch, potato starch, microcrystalline cellulose, gelatin, colloidal silicon dioxide, talc, magnesium stearate, stearic acid, and other excipients, colorants, fillers, binders, diluents, buffering agents, moistening agents, preservatives, flavoring agents, dyes, disintegrating agents, and pharmaceutically compatible carriers. Lozenge forms can comprise the active ingredient in a flavor, e.g., sucrose, as well as pastilles comprising the active ingredient in an inert base, such as gelatin and glycerin or sucrose and acacia emulsions, gels, and the like containing, in addition to the active ingredient, carriers known in the art.

[0142] The synthetic adenovirus (or one or more nucleic acids encoding the synthetic adenovirus), alone or in combination with other suitable components, can be made into aerosol formulations (i.e., they can be nebulized) to be administered via inhalation. Aerosol formulations can be placed into pressurized acceptable propellants, such as dichlorodifluoromethane, propane, nitrogen, and the like.

[0143] Formulations suitable for parenteral administration, such as, for example, by intraarticular (in the joints), intravenous, intramuscular, intratumoral, intradermal, intraperitoneal, and subcutaneous routes, include aqueous and non-aqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives. In the provided methods, compositions can be administered, for example, by intravenous infusion, orally, topically, intraperitoneally, intravesically intratumorally, or intrathecally. Parenteral administration, intratumoral administration, and intravenous administration are the preferred methods of administration. The formulations of compounds can be presented in unit-dose or multi-dose sealed containers, such as ampules and vials.

[0144] Injection solutions and suspensions can be prepared from sterile powders, granules, and tablets of the kind previously described. Cells transduced or infected by adenovirus or transfected with nucleic acids for ex vivo therapy can also be administered intravenously or parenterally as described above.

[0145] The pharmaceutical preparation is preferably in unit dosage form. In such form the preparation is subdivided into unit doses containing appropriate quantities of the active component. Thus, the pharmaceutical compositions can be administered in a variety of unit dosage forms depending upon the method of administration. For example, unit dosage forms suitable for oral administration include, but are not limited to, powder, tablets, pills, capsules and lozenges.

[0146] In some embodiments, the compositions include at least two different synthetic adenoviruses, such as synthetic adenoviruses that encode different transgenes. In some examples, the composition includes two, three, four, five or six different synthetic adenoviruses.

[0147] In therapeutic applications, synthetic adenoviruses or compositions thereof are administered to a subject in a therapeutically effective amount or dose. Amounts effective for this use will depend upon the severity of the disease and the general state of the patient's health. Single or multiple administrations of the compositions may be administered depending on the dosage and frequency as required and tolerated by the patient. A patient or subject includes both humans and other animals, particularly mammals. Thus, the methods are applicable to both human therapy and veterinary applications.

[0148] An effective amount of a synthetic adenovirus is determined on an individual basis and is based, at least in part, on the particular synthetic adenovirus used; the individual's size, age, gender and general health. For example, for treatment of a human, at least 10.sup.3 plaque forming units (PFU) of a synthetic virus is used, such as at least 10.sup.4, at least 10.sup.5, at least 10.sup.6, at least 10.sup.7, at least 10.sup.8, at least 10.sup.9, at least 10.sup.10, at least 10.sup.11, or at least 10.sup.12 PFU, for example approximately 10.sup.3 to 10.sup.12 PFU of a synthetic virus is used, depending on the type, size and number of proliferating cells or neoplasms present. The effective amount can be from about 1.0 pfu/kg body weight to about 10.sup.15 pfu/kg body weight (e.g., from about 10.sup.2 pfu/kg body weight to about 10.sup.13 pfu/kg body weight). A synthetic adenovirus is administered in a single dose or in multiple doses (e.g., two, three, four, six, or more doses). Multiple doses can be administered concurrently or consecutively (e.g., over a period of days or weeks).

[0149] In some embodiments, the provided methods include administering to the subject one or more additional therapeutic agents, such as one or more agents that promote wound healing or tissue regeneration.

[0150] The following examples are provided to illustrate certain particular features and/or embodiments. These examples should not be construed to limit the disclosure to the particular features or embodiments described.

EXAMPLES

[0151] Using genome assembly technologies and structure based design, a library of synthetic adenovirus vectors that express GFP-luciferase and have multiple different combinations of capsid protein modifications were generated. To prevent liver uptake and limit inflammation, viral and transgene expression cassettes were engineered with binding sites for liver specific microRNAs and hexon modifications that prevent binding to factor X and uptake through toll-like receptors in Kupffer cells. These modifications prevented synthetic Ad5 vector sequestration in the liver. The detargeted Ad5 viruses were used as a genomic platform to screen for novel in vivo tropisms by swapping regions of the Ad5 fiber knob and shaft with those of other human Ad serotypes. These viruses were screened in vivo using luciferase bioluminescence and IVIS imaging.

Example 1: Synthetic Adenoviruses Expressing Chimeric Fiber Proteins and Liver Detargeting Modifications

[0152] This example describes synthetic adenoviruses expressing chimeric fiber proteins and liver detargeting modifications to direct infection to specific cell types.

[0153] While the fiber proteins of Ad5 and many other serotypes have been shown to bind to CAR for cellular attachment, other serotypes have been shown to use CD46 (Gaggar et al., Nat Med 9:1408-1412, 2003), desmoglein 2 (Wang et al., Nat Med 17:96-104, 2011), sialic acid (Nilsson et al., Nat Med 17:105-109, 2011), or others (Arnberg, Trends Pharmacol Sci 33:442-448, 2012). The receptor usage of many serotypes has not been thoroughly examined and CD46 is not thought to be expressed in mature mice. Since Adsembly/AdSLIC (see PCT Publication No. WO 2012/024351, incorporated herein by reference) allows for the rapid creation of chimeric viruses, an initial panel of six fiber chimeric viruses was generated in order to examine the alternate cellular targeting capabilities of various serotypes. Since the globular knob at the C-terminus of the fiber protein is typically responsible for receptor binding, chimeras were created by replacing the Ad5 fiber knob with fiber knob from Ad3, Ad9, Ad11, Ad12, or Ad34 (Table 1). Each virus was created with the same E1 module containing an E1A/E1B deletion and a luciferase-GFP fusion driven by an EF1? promoter. The panel was used to transduce the H9 stem cell line and luciferase expression measured. Compared to Ad5 fibers, significantly higher luciferase-GFP expression was observed in almost all cells when using chimeras with either Ad3, Ad9, Ad12 or Ad34. Conversely, luciferase-GFP expression was almost universally lower in cells transduced with the Ad11 fiber chimera. These data demonstrate a powerful use for being able to combine modified parts from other serotypes in order to improve Ad5-based vectors and optimize synthetic viruses for entry into specific cell types.

[0154] The synthetic viruses listed in Table 1 also include liver detargeting modifications. Natural adenovirus type 5 vectors will only infect the lungs (via inhalation) or liver (via intravenous administration). Ad5 hexon binds to Factor X in the blood, which leads to its absorption by Kuppfer cells in the liver, preventing systemic dissemination and inducing limited inflammation. To overcome this and enable intravenous delivery of viruses that can travel to sites of wounds/injuries systemically, the synthetic adenoviruses were engineered to include additional genomic modifications in the E1 and core regions that prevent uptake and expression in the liver. These viruses include binding sites in the 3UTR of the E1 expression module for a microRNA that is specifically expressed in the liver (miR-122) and an E451Q mutation in hexon.

[0155] To evaluate the effect of the liver detargeting modifications on adenovirus tropism, AdSyn-CO171 (with the liver detargeting modifications) and AdSyn-CO199 (a control virus) were injected into the tail vain of FVB/NJ mice. IVIS? imaging was performed 72 hours after the injection to detect expression of luciferase. In contrast to control virus AdSyn-CO199, liver detargeted virus AdSyn-CO171 did not accumulate in the liver and instead was able to target other organs, including the spleen and lymph nodes.

TABLE-US-00003 TABLE 1 Adenoviruses with Chimeric Fiber Proteins and Liver Detargeting Modifications SEQ ID Virus Name NO: E1 L3 E3 E4 AdSyn- 1 ?E1 + EF1?- hexon wt wt CO171 luciferase-miR122 E451Q AdSyn- 2 ?E1 + EF1?- hexon Ad3 knob wt CO172 luciferase-miR122 E451Q Ad5 shaft fiber chimera AdSyn- 3 ?E1 + EF1?- hexon Ad9 knob wt CO173 luciferase-miR122 E451Q Ad5 shaft fiber chimera AdSyn- 4 ?E1 + EF1?- hexon Ad11 knob wt CO174 luciferase-miR122 E451Q Ad5 shaft fiber chimera AdSyn- 5 ?E1 + EF1?- hexon Ad12 knob wt CO175 luciferase-miR122 E451Q Ad5 shaft fiber chimera AdSyn- 6 ?E1 + EF1?- hexon Ad34 knob wt CO176 luciferase-miR122 E451Q Ad5 shaft fiber chimera AdSyn- 7 ?E1 + EF1?- wt wt wt CO199 luciferase-miR122

Example 2: Acute Skin/Ear and Limb Wounding Models

[0156] To identify synthetic viruses that travel to the sites of skin wounds, synthetic adenoviruses AdSyn-CO171 (WT fiber), AdSyn-CO172 (Ad3 fiber knob), AdSyn-CO174 (Ad11 fiber knob) or AdSyn-CO176 (Ad34 fiber knob) were injected into FVB/NJ mice by tail vein injection. At the same time, the ears and forehands of the mice were cut. By detection of luciferase (IVIS imaging) and GFP (fluorescence imaging), it was determined that synthetic adenovirus AdSyn-CO176, with the fiber knob of adenovirus type 34, transduces cells at the wound sites specifically, while injection of other synthetic adenoviruses, including AdSyn-CO171, AdSyn-CO172 and AdSyn-CO174, resulted in no luciferase activity at the wound parts (FIG. 2A). The detection of GFP by tissue section also showed the same result. In particular, only the forehands were cut in this experiment and signal could only be detected from the forehands, not the hindhands, which indicates that the signal represents the specific infection in the wound sites on the forehands. In addition, chimeric adenovirus AdSyn-CO176 did not travel to the ears and forehands if no damage was present in those tissue. Furthermore, even 3 days after the injection, the induction of cutaneous damage (via the cut) led to expression of luciferase on the ears and forehands (FIG. 2B). This result demonstrates that the specific infection of AdSyn-CO176 was driven by the injury. During subsequent observation, it was found that the luciferase signals from other tissues, mainly from liver and spleen, were silenced within one week. In contrast, the signals from wound sites lasted for three weeks. This result indicates that the synthetic adenovirus with Ad34 fiber knob exhibits prolonged transgene expression and is not silenced, which are ideal features for wound repair.

Example 3: Post Wounding Transduction and Site Specific Delivery to Wounded Tissue

[0157] Cutaneous wound repair is characterized by three overlapping stages, termed the (1) hemostasis and inflammation, (2) proliferation, and (3) remodeling stages (Bielefeld et al., Cell Mol Life Sci 70:2059-2081, 2013). The hemostasis/inflammation phase lasts up to 48 hours. The proliferation stage lasts about 2 to 10 days and the process of remodeling lasts for a year or longer (Gurtner et al., Nature 453:314-321, 2008). To determine if the delivery of synthetic adenovirus vectors can infect cells at the site of a wound several days after injury, as opposed to prior to or at time of injury, ear clipping was performed 48 hours prior to administering synthetic adenovirus vectors (AdSyn-CO171, AdSyn-CO174 and AdSyn-CO176). Adenovirus type 11 (AdSyn-CO174) and type 34 (AdSyn-CO176) both belong to species B and subspecies B1 so they were expected to have similar target tissues. Luciferase detection showed that the synthetic adenovirus with Ad34 knob/Ad5 shaft chimeric fiber (AdSyn-CO176) still expressed specifically at wound sites. But other adenoviruses, including the chimeric adenovirus with Ad11 fiber knob/Ad5 fiber shaft (AdSyn-CO174), gave no signal at the wound site. This result indicates that the chimeric adenovirus with a fiber knob from type 34 can also infect the wound sites at the later phase after the injury.

Example 4: Acute Kidney Damage Model

[0158] The observation of the specific expression of the synthetic adenovirus with the fiber knob domain of type 34 cutaneous skin lesion and bone digit clips prompted the investigation of whether the synthetic adenovirus can infect additional internal tissues damaged through alternative mechanisms. To explore this issue, the renal ischemia-reperfusion injury (IRI) model was established. IRI has been most widely used as a model to study the pathobiology of acute kidney injury, which is associated with diverse clinical conditions including trauma, sepsis, toxicity, and cardiac arrest (Himmelfarb and Ikizler, Kidney Int 71:971-976, 2007). Depending on the severity of the ischemic insult, acute IRI can either resolve with regeneration of damaged tubules, or it can progress to chronic kidney disease with interstitial fibrosis (Burne-Taney et al., Kidney Int 67:1002-1009, 2005). In the model used herein, moderate ischemic injury (25 minutes) results in a regenerative response and resolution of injury.

[0159] Mice were injected with chimeric adenovirus AdSyn-CO176 by tail vein 24 hours after the induction of the injury. The expression of luciferase was detected at the damaged kidney side 48 hours after the injection. The kidney of an infected mouse without damage gave no signal of the luciferase. In addition, uninfected mice in which damage was induced at the same time as for infected mice also gave no signal (FIG. 3A). On day 7, expression of the adenovirus in liver and spleen was silenced, but expression in the damaged kidney remained (FIG. 3B). The detection of GFP by tissue section also supported this result. Interestingly, for the mouse that didn't get the surgery, luciferase expression was limited to the liver and spleen. However, when the damage was induced at the kidney, AdSyn-CO176 infected the damaged kidney and exhibited reduced uptake by the liver. This phenomenon prompted a study to determine whether a more concentrated signal could be obtained if more virus is injected. Therefore, a second experiment was performed in which mice received a 10-fold higher dose of AdSyn-CO176 than mice received for the prior study. IRI surgery was performed on the left kidney of the mice to induce IRI damage. Forty-eight hours post-surgery, the higher dose of AdSyn-CO176 was injected into the mice by tail vein injection. IVIS? imaging was performed 48 hours post-injection. Both kidneys were then separated and sectioned to observe GFP signal (FIG. 4A). An IVIS? image of the mice showed that expression of AdSyn-CO176 concentrated at the damaged kidney, with reduced accumulation in the liver and spleen (FIG. 4B). Sections from normal kidney showed no GFP signal. The sections from IRI damaged kidney showed a strong GFP signal, indicating that AdSyn-CO176 is specifically expressed at the site of damaged tissue. Collectively, these findings reveal that a synthetic adenovirus, having a chimeric Ad5 shaft/Ad34 knob fiber, has the ability to infect the IRI kidney specifically.

Example 5: Wild-Type Ad34 does not Exhibit Tropism to Wound Sites

[0160] The Examples above demonstrated that a synthetic adenovirus comprising the knob domain of Ad34 was capable of homing to sites of wounded tissue. To evaluate whether wild-type Ad34 also is capable of tracking to the wound, a synthetic reporter virus based on wild-type Ad34 was engineered. AdSyn-CO721 was generated by replacing the genes of the E1 region of wild-type Ad34 with the reporter EF1?-[luc-GFP]-miR122. AdSyn-CO721 contains no other modifications. FVB/NJ mice were injected by tail vein with AdSyn-CO171, AdSyn-CO176 or AdSyn-CO721. Both ears of the mice were clipped at the same time as virus injection. IVIS? imaging was performed at 48 hours post injection. The results are shown in FIGS. 5A-5C. As expected, AdSyn-CO176 infected the wound sites, while AdSyn-CO171 did not. The Ad34 virus (AdSyn-CO721) gave no specific luciferase signal following intravenous injection, which is consistent with the published literature. These results demonstrated that wild-type Ad34 does not exhibit tropism to wounded tissue.

Example 6: Synthetic Adenovirus Encoding PDGF-? in a Renal Ischemia-Reperfusion Injury (IRI) Model

[0161] The renal ischemia-reperfusion injury (IRI) model was used as an example to determine whether synthetic adenovirus that specifically homes to damaged tissue could deliver a wound healing factor to promote tissue repair. Platelet-derived growth factor-? (PDGF-?) was selected as the wound healing factor because this growth factor has been previously reported to be important in the wound healing process in other models of tissue damage. It has also been previously disclosed that a synthetic adenovirus encoding PDGF-? was capable of healing damaged ear tissue when injected directly into an ischemic rabbit ear (Liechty et al., J Invest Dermatol 113:375-383, 1999). However, this virus is not capable of specifically infecting wound sites after systemic administration and was thus injected directly into the injured tissue. As disclosed in the Examples above, synthetic adenovirus AdSyn-CO176 is capable of specifically infecting sites of tissue injury and can thus be used to target damaged tissue following intravenous administration.

[0162] For the following study, two additional synthetic adenoviruses were generated:

[0163] (1) AdSyn-CO876 is a modified version of AdSyn-CO171 (which is a liver detargeted vector that does not target wounded tissues) that expresses PDGF-?; and

[0164] (2) AdSyn-CO877 (SEQ ID NO: 10) is a modified version of AdSyn-CO176 (which is a liver detargeted vectors that transduces s wounded tissues) that expresses PDGF-?.

[0165] To evaluate these viruses in the renal IRI model, ischemia-reperfusion injury was induced in both kidneys by clamping the renal pedicles for 30 minutes. Mice were then immediately injected intravenously via the tail vein with 200 ?l saline, 10.sup.9 virus particles of AdSyn-CO876 or 10.sup.9 virus particles of AdSyn-CO877. Controls included a mouse with induced kidney damage that received no injection, a sham-operated mouse (same surgical procedure except the clamp was not applied) that received no infection, and a mouse with no kidney damage that did not receive an injection. Blood was collected at the time of injection (0 h) and after 18 hours to measure blood urea nitrogen (BUN) and creatinine. The results are shown in FIG. 7A (BUN) and FIG. 7B (creatinine).

[0166] IRI mice that did not receive any therapeutic treatment showed elevated BUN and creatinine levels, consistent with the induction of kidney damage. Treatment of IRI mice with AdSyn-CO876 did not reduce serum BUN and creatinine levels. This is consistent with the fact that a liver detargeted Ad5 vector with a wild-type Ad5 shaft (based on AdSyn-CO171) is unable to home to damaged tissue. In contrast, treatment of IRI mice with AdSyn-CO877 led to a significant reduction in serum BUN and creatinine levels. This demonstrates that AdSyn-CO877 (based on AdSyn-CO176) can home to damaged tissue and deliver a wound repair factor capable of healing the damaged kidney.

[0167] These results demonstrate that liver detargeted, synthetic adenoviruses expressing a chimeric Ad34 knob/Ad5 shaft fiber protein (such as AdSyn-CO176 or AdSyn-CO877) can be used as therapeutic viruses for the treatment of damaged or wounded tissues.

Example 7: Synthetic Adenovirus Encoding PDGF-? in a Scratch Wound Model

[0168] Fibroblasts are critical in supporting normal wound healing involved in key processes, such as breaking down the fibrin clot, creating new extra cellular matrix (ECM), supporting other cells associated with effective wound healing, and contracting the wound. In order to test whether AdSyn-CO877 could accelerate the wound healing process in vitro, a Scratch Wound assay was performed with human fibroblast cells using the INCUCYTE? Cell Migration Kit (Essen Bioscience). This system allows for the analysis of the therapeutic effects of different agents on the migration and/or invasion potential of the cell type being assayed.

[0169] To perform this study, human fetal lung fibroblasts (IMR-90) were plated in 96-well ImageLock plates (Essen Bioscience) and cultured for 18 hours to nearly 100% confluence. The INCUCYTE? 96-pin WoundMaker was then used to create a scratch wound in each well of the 96-well plate. Cells were then either left untreated or were immediately infected with AdSyn-CO877 at an MOI of 1. The INCUCYTE? Cell Migration Analysis software module was used to assess cell migration and wound healing according to the following metrics:

[0170] Wound Confluence (%): A report of the confluence of cells within the wound region, given as the percentage of the wound region area occupied by cells.

[0171] Relative Wound Density (%): Relies on measuring the spatial cell density in the wound area relative to the spatial cell density outside of the wound area at every time point.

[0172] FIG. 6A and FIG. 6B show wound confluence and relative wound density, respectively, of scratch wounded IMR-90 cells left untreated or infected with AdSyn-CO877. The results demonstrate that cultures infected with AdSyn-CO877 (encoding the wound healing factor PDGF-3) heal more quickly than untreated cultures.

Example 8: Spleen-Specific miR142-3p Silences Virus Expression in the Spleen

[0173] A synthetic virus (AdSyn-CO338) containing four miR142-3p binding sites in the 3 UTR of E1A was generated to test whether miR142-3p can silence virus expression in the spleen. AdSyn-CO171 (?E1-EF1?-[Luc-GFP]-miR122, hexon E451Q; SEQ ID NO: 1), AdSyn-CO338 (?E1-EF1?-[luc-GFP]-miR142-3p, hexon E451Q, ?E3A/E3B; SEQ ID NO: 11) and AdSyn-CO339 (?E1-EF1?-[luc-GFP], hexon E451Q, ?E3A/E3B) were injected into the tail vein of mice and luciferase expression was detected after 48 hours by IVIS? imaging. The results are shown in FIGS. 8A-8C. In mice injected with AdSyn-CO171, significant luciferase signal was detected in both the liver and spleen (FIG. 8A). Luciferase signal was also detected in the liver of mice injected with either AdSyn-CO338 or AdSyn-CO339 (FIG. 8B). However, luciferase signal in the spleen of mice injected with AdSyn-CO338 was at least 10-fold lower than in mice injected with AdSyn-CO339 or AdSyn-CO171 (FIG. 8C). These results demonstrate that miR142-3p can silence virus expression in the spleen. Luciferase expression in the liver of mice injected with AdSyn-CO338 was also lower than either AdSyn-CO339 or AdSyn-CO171, indicating that miR14203p also has some effect on reducing virus expression in the liver.

[0174] In view of the many possible embodiments to which the principles of the disclosure may be applied, it should be recognized that the illustrated embodiments are only examples of the invention and should not be taken as limiting the scope of the invention. Rather, the scope of the invention is defined by the following claims. We therefore claim as our invention all that comes within the scope and spirit of these claims.