ANTI-IL-17RA IMMUNOGLOBULIN SINGLE HEAVY VARIABLE DOMAIN ANTIBODIES
20180215829 · 2018-08-02
Inventors
- Bryan EDWARDS (Cambridge, GB)
- Ulla Lashmar (Cambridge, GB)
- Brian McGuinness (Cambridge, GB)
- Mike Romanos (Cambridge, GB)
- Thomas Sandal (Cambridge, GB)
- Joyce Young (Cambridge, GB)
Cpc classification
A01K2217/07
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
C07K16/2866
CHEMISTRY; METALLURGY
A01K2217/15
HUMAN NECESSITIES
C07K2317/569
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
A01K67/0278
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
Abstract
Binding molecules that bind specifically to IL-17RA. The binding molecules are useful in the treatment of disease, for example psoriasis.
Claims
1. A binding molecule that binds human IL-17RA, comprising a human heavy chain variable immunoglobulin domain (V.sub.H) that comprises a CDR1, a CDR2, and a CDR3 sequence, a) wherein said CDR3 sequence comprises the amino acid sequence of SEQ ID NO. 3, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto; or b) wherein said CDR3 sequence comprises the amino acid sequence of SEQ ID NO. 1267, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto; or c) wherein said CDR3 sequence comprises the amino acid sequence of SEQ ID NO. 1767, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto; or d) wherein said CDR3 sequence comprises the amino acid sequence of SEQ ID NO. 2131, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto; or e) wherein said CDR3 sequence comprises the amino acid sequence of SEQ ID NO. 2559, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto; or f) wherein said CDR3 sequence comprises the amino acid sequence of SEQ ID NO. 2575, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto; or g) wherein said CDR3 sequence comprises the amino acid sequence of SEQ ID NO. 2579, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto; and wherein said molecule has a KD (M) value in the range of from 610.sup.11 to 310.sup.7 when assessed by BIAcore.
2. The binding molecule according to claim 1 wherein said molecule is an immunoglobulin single domain antibody.
3. The binding molecule according to claim 1, a) wherein said molecule comprises the amino acid sequence of SEQ ID NO. 3, or said amino acid sequence with homology thereto, and said CDR1 sequence comprises the amino acid sequence of SEQ ID NO. 1, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto and said CDR2 sequence comprises the amino acid sequence of SEQ ID NO. 2, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto; or b) wherein said molecule comprises the amino acid sequence of SEQ ID NO. 1267, or said amino acid sequence with homology thereto, and said CDR1 sequence comprises the amino acid sequence of SEQ ID NO. 1265, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto, and said CDR2 sequence comprises the amino acid sequence of SEQ ID NO. 1266, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto; or c) wherein said molecule comprises the amino acid sequence of SEQ ID NO. 1767, or said amino acid sequence with homology thereto, and said CDR1 sequence comprises the amino acid sequence of SEQ ID NO. 1765, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto, and said CDR2 sequence comprises the amino acid sequence of SEQ ID NO. 1766, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto; or d) wherein said molecule comprises the amino acid sequence of SEQ ID NO. 2131, or said amino acid sequence with homology thereto, and said CDR1 sequence comprises the amino acid sequence of SEQ ID NO. 2129, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto, and said CDR2 sequence comprises the amino acid sequence of SEQ ID NO. 2130, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto; or e) wherein said molecule comprises the amino acid sequence of SEQ ID NO. 2559, or said amino acid sequence with homology thereto, and said CDR1 sequence comprises the amino acid sequence of SEQ ID NO. 2557, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto, and said CDR2 sequence comprises the amino acid sequence of SEQ ID NO. 2558, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto; or f) wherein said molecule comprises the amino acid sequence of SEQ ID NO. 2575, or said amino acid sequence with homology thereto, and said CDR1 sequence comprises the amino acid sequence of SEQ ID NO. 2573, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto, and said CDR2 sequence comprises the amino acid sequence of SEQ ID NO. 2574, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto; or g) wherein said molecule comprises the amino acid sequence of SEQ ID NO. 2579, or said amino acid sequence with homology thereto, and said CDR1 sequence comprises the amino acid sequence of SEQ ID NO. 2577, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto, and said CDR2 sequence comprises the amino acid sequence of SEQ ID NO. 2578, or an amino acid sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto.
4. The binding molecule according to claim 3, (a) wherein said CDR1 sequence comprises or consists of the amino acid sequence of SEQ ID NO. 1, 5, 9, 13, 17 or 21, said CDR2 sequence comprises or consists of the amino acid sequence of SEQ ID NO. 2, 6, 10, 14, 18 or 22, and said CDR3 sequence comprises or consists of the amino acid sequence of SEQ ID NO: 3, 7, 11, 15, 19 or 23; or (b) wherein said CDR1 sequence comprises or consists of the amino acid sequence of SEQ ID NO. 1265, 1269, or 1273, said CDR2 sequence comprises or consists of the amino acid sequence of SEQ ID NO. 1266, 1270, or 1274, and said CDR3 comprises or consists of the amino acid sequence of SEQ ID NO. 1267, 1271, or 1275; c) wherein said CDR1 sequence comprises or consists of the amino acid sequence of SEQ ID NO. 1765, said CDR2 sequence comprises or consists of the amino acid sequence of SEQ ID NO. 1766, and said CDR3 sequence comprises or consists of the amino acid sequence SEQ ID NO: 1767; d) wherein said CDR1 sequence comprises or consists of the amino acid sequence of SEQ ID NO. 2129, said CDR2 sequence comprises or consists of the amino acid sequence of SEQ ID NO. 2130, and said CDR3 sequence comprises or consists of the amino acid sequence SEQ ID NO: 2131; e) wherein said CDR1 sequence comprises or consists of the amino acid sequence of SEQ ID NO. 2557, said CDR2 sequence comprises or consists of the amino acid sequence of SEQ ID NO. 2558, and said CDR3 sequence comprises or consists of the amino acid sequence SEQ ID NO: 2559; f) wherein said CDR1 sequence comprises or consists of the amino acid sequence of SEQ ID NO. 2573, said CDR2 sequence comprises or consists of the amino acid sequence of SEQ ID NO. 2574, and said CDR3 sequence comprises or consists of the amino acid sequence SEQ ID NO: 2575; or (g) wherein said CDR1 sequence comprises or consists of the amino acid sequence of SEQ ID NO. 2577, said CDR2 sequence comprises or consists of the amino acid sequence of SEQ ID NO. 2578, and said CDR3 sequence comprises or consists of the amino acid sequence SEQ ID NO: 2579.
5. (canceled)
6. The binding molecule according to claim 1 wherein said V.sub.H domain comprises or consists of the amino acid sequence of SEQ ID NO. 4, 1268, 1768, 2132, 2560, 2576, or 2580, or an amino acid sequence with at least 70%, 80%, 90% or 95% homology to any one of said amino acid sequences; or wherein said V.sub.H domain comprises or consist of the amino acid sequence of SEQ ID NO. 8, 12, 16, 20, or 24.
7-46. (canceled)
47. The binding molecule according to claim 1, wherein said binding molecule further comprises: one or more additional V.sub.H domains; and/or a conjugated toxin, enzyme, or radioisotope.
48-50. (canceled)
51. A binding molecule that competes for binding to human IL-17RA with the binding molecule of claim 1.
52. A pharmaceutical composition comprising the binding molecule according to claim 1 and a pharmaceutical carrier.
53. The pharmaceutical composition according to claim 52, wherein the composition is formulated for administration topically to the skin; and/or wherein the composition further comprises a chemical skin penetration enhancer.
54. A method for treating at least one disease or condition selected from the group consisting of an autoimmune disease, an inflammatory condition, an allergy, an allergic condition, a hypersensitivity reaction, a severe infection, and an organ or tissue transplant rejection, comprising: administering an effective amount of the pharmaceutical composition according to claim 52.
55-63. (canceled)
64. The method according to claim 54 wherein said disease or condition is at least one selected from the group consisting of: psoriasis, spondyloarthropathies, uveitis, atopic dermatitis, systemic lupus erythematosis, rheumatoid arthritis, osteoarthritis, juvenile chronic arthritis, systemic sclerosis, idiopathic inflammatory myopathies, Sjogren's syndrome, systemic vasculitis, sarcoidosis, autoimmune hemolytic anemia, autoimmune thrombocytopenia, thyroiditis, diabetes mellitus, immune-mediated renal disease, a demyelinating disease of the central and peripheral nervous systems, multiple sclerosis, idiopathic demyelinating polyneuropathy, Guillain Barre syndrome, chronic inflammatory demyelinating polyneuropathy, a hepatobiliary disease, infectious hepatitis, autoimmune chronic active hepatitis, primary biliary cirrhosis, granulomatous hepatitis, sclerosing cholangitis, inflammatory bowel disease, gluten-sensitive enteropathy, Whipple's disease, an autoimmune skin disease, an immune-mediated skin disease, bullous skin disease, erythema multiforme, contact dermatitis, disease, asthma, allergic rhinitis, food hypersensitivity, urticaria, an immunologic disease of the lung, eosinophilic pneumonia, idiopathic pulmonary fibrosis, hypersensitivity pneumonitis, an autoimmune haematological disorder, hemolytic anaemia, aplastic anaemia, pure red cell anaemia, idiopathic thrombocytopenia, autoimmune inflammatory bowel disease, ulcerative colitis, Crohn's disease, Irritable Bowel Syndrome, a transplantation associated disease, graft rejection, and graft-versus-host-disease.
65. An in vivo or in vitro method for reducing human IL-17RA activity comprising contacting human IL-17RA with the binding molecule according to claim 1.
66. A method for determining the presence of IL-17RA in a test sample by an immunoassay comprising: contacting said sample with the binding molecule according to claim 1 and at least one detectable label.
67. (canceled)
68. An isolated nucleic acid molecule comprising a nucleotide sequence encoding the binding molecule according to claim 1.
69. A nucleic construct comprising the nucleic acid according to claim 68.
70. An isolated host cell comprising the construct according to claim 69.
71. A method for producing the binding molecule according to claim 1 comprising expressing a nucleic acid encoding the binding molecule in a host cell and isolating the binding molecule from the host cell culture.
72. A kit comprising the binding molecule according to claim 1.
73. A method for producing a binding molecule comprising at least one immunoglobulin single domain antibody that binds IL-17RA, wherein said domain is a human V.sub.H domain, said method comprising a) immunizing a transgenic mouse with an IL-17RA antigen, wherein said transgenic mouse expresses a nucleic acid construct comprising human heavy chain V.sub.H genes and is not capable of making functional endogenous light or heavy chains; b) generating a library from said mouse, wherein said library comprises amino acid sequences that comprise V.sub.H domain amino acid sequences; and c) isolating at least one amino acid sequence comprising said V.sub.H domain amino acid sequence from said library, thereby obtaining said binding molecule comprising a single domain antibody that comprises a human V.sub.H domain for binding IL-17RA.
74. A biparatopic, bivalent, or multispecific binding molecule comprising the binding molecule according to claim 1.
Description
DRAWINGS
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055] A: the x-axis shows the concentration of V.sub.H (M), the y-axis shows the OD.sub.450 nm, for V.sub.H 49G11 (.circle-solid.) the IC.sub.50 (nM) was 900 and for V.sub.H 2.1 (.square-solid.) the IC.sub.50 (nM) was 4.
[0056] B: the x-axis shows V.sub.H concentration M (log).sub.10, the y-axis shows the OD.sub.450 nm, for V.sub.H 4.55 (.circle-solid.) the IC.sub.50 (nM) was 6928; for V.sub.H 3.1 (.square-solid.) the IC.sub.50 (nM) was 11; for V.sub.H 3.20 (.box-tangle-solidup.), the IC.sub.50 (nM) was 22; for V.sub.H 49G11 (.Math.), the IC.sub.50 (nM) was 885.
[0057]
[0058] A: the x-axis shows V.sub.H concentration M (log).sub.10, the y-axis shows the OD.sub.450 nm; V.sub.H SEV49G11 (.circle-solid.) had a weak IC.sub.50 (nM), V.sub.H 2.1 (.square-solid.) had an IC.sub.50 (nM) of 363, V.sub.H 62A4 (.box-tangle-solidup.) (QVQLVESGGGLVQPGRSLTLSCTASGFTFHDYAMHWVRQPPGGGLEVWAGVSWN GNNVGYADSVKGRFTISRDNAKKSLYLQMNSLRSEDTALYYCAKGGMGSGSHPDSF STWGQGTMVTVSS, SEQ ID No. 2604) had a weak IC.sub.50 (nM), V.sub.H SEV136H4L () had an IC.sub.50 (nM) of 5; no IC.sub.50 (nM) was recorded for V.sub.H 846A5 ().
[0059] B: the x-axis shows V.sub.H concentration M (log).sub.10, the y-axis shows the OD.sub.450 nm; MAB177 (.circle-solid.) had an IC.sub.50 (nM) of 65, V.sub.H 2.2 (.square-solid.) had an IC.sub.50 (nM) of 165, V.sub.H 1.1 (.box-tangle-solidup.) had an IC.sub.50 (nM) of 39, V.sub.H 1.2 (.Math.) had an IC.sub.50 (nM) of 141, no IC.sub.50 (nM) was recorded for LH86A5 ().
[0060]
[0061]
[0062]
[0063]
[0064]
DETAILED DESCRIPTION
[0065] The present invention will now be further described. In the following passages, different aspects of the invention are defined in more detail. Each aspect so defined may be combined with any other aspect or aspects unless clearly indicated to the contrary. In particular, any feature indicated as being preferred or advantageous may be combined with any other feature or features indicated as being preferred or advantageous.
[0066] Generally, nomenclatures used in connection with, and techniques of, cell and tissue culture, pathology, oncology, molecular biology, immunology, microbiology, genetics and protein and nucleic acid chemistry and hybridization described herein are those well-known and commonly used in the art. The methods and techniques of the present disclosure are generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the present specification unless otherwise indicated. See, e.g., Sambrook et al. Molecular Cloning: A Laboratory Manual (2d ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989)). Enzymatic reactions and purification techniques are performed according to the manufacturer's specifications, as commonly accomplished in the art or as described herein. The nomenclatures used in connection with, and the laboratory procedures and techniques of, analytical chemistry, synthetic organic chemistry, medicinal and pharmaceutical chemistry described herein are those well-known and commonly used in the art. Standard techniques are used for chemical syntheses, chemical analyses, pharmaceutical preparation, formulation, and delivery, and treatment of patients.
[0067] The IL-17 family of cytokines includes six members, IL-17/IL-17A, IL-17B, IL-17C, IL-17D, IL-17E/IL-25, and IL-17F, which are produced by multiple cell types. Members of this family have a highly conserved C-terminus containing a cysteine-knot fold structure. Most IL-17 proteins are secreted as disulfide-linked dimers, with the exception of IL-17B, which is secreted as a non-covalent homodimer.
[0068] Signaling by IL-17 family cytokines is mediated by members of the IL-17 receptor family (IL-17R), IL-17 R/IL-17 RA, IL-17 B R/IL-17 RB, IL-17 RC, IL-17 RD, and IL-17 RE. Activation of these receptors triggers intracellular pathways that induce the production of pro-inflammatory cytokines and anti-microbial peptides. IL-17A, IL-17F, and IL-17A/F are produced primarily by activated T cells and signal through an oligomerized receptor complex consisting of IL-17 RA and IL-17 RC. Ligand binding to this complex leads to recruitment of the intracellular adaptor proteins, Act1 and TRAF-6, and downstream activation of the transcription factors, NF kappa B, AP-1, and C/EBP. IL-17E activates similar signaling pathways through a receptor complex formed by IL-17 RA and IL-17 B R/IL-17RB. Signaling by IL-17E induces Th2-type immune responses and may be involved in promoting the pathogenesis of asthma. Less is known about the signaling pathways activated by other IL-17 family cytokines. Recent studies suggest that IL-17C is produced primarily by epithelial cells and binds to a receptor complex consisting of IL-17 RA and IL-17 RE. Autocrine signaling by IL-17C in epithelial cells stimulates the production of anti-microbial peptides and pro-inflammatory cytokines, but like IL-17A, overexpression of IL-17C may contribute to the development of autoimmune diseases. Similar to IL-17E, IL-17B binds to IL-17 B R/IL-17 RB, but the major target cells and effects of IL-17B signaling have not been reported. In addition, the receptor for IL-17D and the ligand for IL-17 RD are currently unknown.
[0069] The invention provides isolated IL-17RA binding molecules that bind human IL-17RA, pharmaceutical compositions comprising such binding molecules, as well as isolated nucleic acids encoding such binding molecules, recombinant expression vectors and isolated host cells for making such binding proteins. Also provided by the invention are methods of using the binding molecules disclosed herein to detect human IL-17RA, to inhibit human IL-17RA either in vitro or in vivo, and methods of treating disease. One aspect of the invention provides isolated human anti-human IL-17RA binding molecules, specifically those comprising, or consisting of, single domain antibodies that bind to human IL-17RA with high affinity, a slow off rate and high neutralizing capacity. In one embodiment, the binding molecule is a heavy chain only antibody.
[0070] In preferred embodiments, the binding molecules of the invention bind specifically to human IL-17RA and do not cross react with, or do not show substantial binding to, other members of the human IL-17R receptor family. This limited cross-reactivity with IL-17R homologues exhibited by the binding members of the invention offers advantages for their therapeutic and/or diagnostic use as side effects by undesirable cross reactivity are reduced. This also offers advantages in dosing for therapeutic applications.
[0071] Binding molecules of the invention are isolated from their natural environment.
[0072] An IL-17RA binding molecule of the invention is directed against, that is capable of binding to human IL-17RA (Protein accession NO. Q96F46 Uniprot, SEQ ID NO. 2601) showing the full-length precursor IL-17RA including the signal peptide) and/or cynomolgus monkey IL-17R.
TABLE-US-00001 SEQIDNO.2603 MGAARSPPSAVPGPLLGLLLLLLGVLAPGGASLRLLDHRALVCSQPG LNCTVKNSTCLDDSWIHPRNLITSSPKDLQIQLHFAHTQQGDLFPVA HIEWTLQTDASILYLEGAELSVLQLNTNERLCVRFEFLSKLRHHHRR WRFTFSHFVVDPDQEYEVTVHHLPKPIPDGDPNHQSKNFLVPDCEHA RMKVTTPCMSSGSLWDPNITVETLEAHQLRVSFTLWNESTHYQILLT SFPHMENHSCFEHMHHIPAPRPEEFHQRSNVTLTLRNLKGCCRHQVQ IQPFFSSCLNDCLRHSATVSCPEMPDTPEPIPDYMPLWVYWFITGIS ILLVGSVILLIVCMTWRLAGPGSEKYSDDTKYTDGLPAADLIPPPLK PRKVWIIYSADHPLYVDVVLKFAQFLLTACGTEVALDLLEEQAISEA GVMTWVGRQKQEMVESNSKIIVLCSRGTRAKWQALLGRGAPVRLRCD HGKPVGDLFTAAMNMILPDFKRPACFGTYVVCYFSEVSCDGDVPDLF GAAPRYPLMDRFEEVYFRIQDLEMFQPGRMHRVGELSGDNYLRSPGG RQLRAALDRFRDWQVRCPDWFECENLYSADDQDAPSLDEEVFEEPLL PPGTGIVKRAPLVREPGSQACLAIDPLVGEEGGAAVAKLEPHLQPRG QPAPQPLHTLVLAAEEGALVAAVEPGPLADGAAVRLALAGEGEACPL LGSPGAGRNSVLFLPVDPEDSPLGSSTPMASPDLLPEDVREHLEGLM LSLFEQSLSCQAQGGCSRPAMVLTDPHTPYEEEQRQSVQSDQGYISR SSPQPPEGLTEMEEEEEEEQDPGKPALPLSPEDLESLRSLQRQLLFR QLQKNSGWDTMGSESEGPSA
[0073] The terms IL-17R binding molecule, IL-17R binding protein, anti-IL-17R single domain antibody or anti-IL-17R antibody all refer to a molecule capable of binding to/directed to the IL-17RA antigen. Thus, unless otherwise stated, the term human IL-17R refers to human IL-17RA. The binding reaction may be shown by standard methods (qualitative assays) including, for example, a binding assay, competition assay or a bioassay for determining the inhibition of IL-17R binding to its receptor or any kind of binding assays, with reference to a negative control test in which an antibody of unrelated specificity. The term IL-17R binding molecule includes an IL-17R binding protein or peptide.
[0074] The invention relates to isolated binding molecules capable of binding to human IL-17RA comprising a heavy chain variable immunoglobulin domain (V.sub.H) comprising a CDR3 sequence as shown in any of
[0075] In another aspect, the invention relates to an isolated binding molecule comprising at least one immunoglobulin single domain antibody directed against/capable of binding to IL-17RA wherein said domain is a V.sub.H domain and wherein said IL-17RA binding molecule comprises at least one antigen binding site.
[0076] In one embodiment, the binding molecule may comprise at least one single domain antibody directed against IL-17RA wherein said domain is a V.sub.H domain comprising a CDR3 as shown in any of
[0077] In one embodiment, said at least one single variable heavy chain domain antibody comprises a set of CDR1, 2 and 3 sequences or a V.sub.H a set of CDR1, 2 and 3 sequences wherein the CDR sequences are selected from the sets of CDR1, 2 and 3 sequences as shown in any of
[0078] In one embodiment of the aspects above, said homology is at least 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 82%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%.
[0079] Homology generally refers to the percentage of amino acid residues in the candidate sequence that are identical with the residues of the polypeptide with which it is compared (sequence identity), after aligning the sequences and in some embodiments after introducing gaps, if necessary, to achieve the maximum percent homology, and not considering any conservative substitutions as part of the sequence identity. Neither N- or C-terminal extensions, tags or insertions shall be construed as reducing identity or homology. Methods and computer programs for the alignment are well known.
[0080] The term antibody, broadly refers to any immunoglobulin (Ig) molecule, or antigen binding portion thereof, comprised of four polypeptide chains, two heavy (H) chains and two light (L) chains, or any functional fragment, mutant, variant, or derivation thereof, which retains the essential epitope binding features of an Ig molecule. Such mutant, variant, or derivative antibody formats are known in the art. In a full-length antibody, each heavy chain is comprised of a heavy chain variable region (abbreviated herein as HCVR or V.sub.H) and a heavy chain constant region. The heavy chain constant region is comprised of three domains, C.sub.H1, C.sub.H2 and C.sub.H3. Each light chain is comprised of a light chain variable region (abbreviated herein as LCVR or V.sub.L) and a light chain constant region. The light chain constant region is comprised of one domain, CL. The V.sub.H and V.sub.L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each V.sub.H and V.sub.L is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. Immunoglobulin molecules can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG 1, IgG2, IgG 3, IgG4, IgA1 and IgA2) or subclass.
[0081] In certain embodiments, the binding molecules of the invention comprise or consist of at least one single domain antibody wherein said domain is a V.sub.H immunoglobulin domain. Thus, the binding molecules of the invention comprise or consist of at least one immunoglobulin single variable heavy chain domain antibody (sVD, sdAb or ISV) that has a V.sub.H domain, but is devoid of a V.sub.L domain. Single domain antibodies have been described in the art; they are antibodies whose complementary determining regions are part of a single domain polypeptide, for example a V.sub.H polypeptide.
[0082] As described further herein, the binding molecule may comprise two or more V.sub.H domains. Such binding molecules may be monospecific or multispecific.
[0083] Binding molecules that comprise a single domain antibody wherein said domain is a V.sub.H domain are also termed Humabody V.sub.H.
[0084] Thus, in some embodiments the binding molecule does not comprise a light chain. In some embodiments the binding molecule does not comprise heavy chain domains C.sub.H2 and C.sub.H3. In some embodiments the binding molecule does not comprise a hinge region and heavy chain domains C.sub.H2 and C.sub.H3. In some embodiments the binding molecule does not comprise heavy chain domains C.sub.H1, C.sub.H2, and CH3. In some embodiments the binding molecule does not comprise heavy chain domain C.sub.H1, a hinge region heavy chain domain C.sub.H2 and heavy chain domain C.sub.H3. In preferred embodiments the binding molecule does not comprise a light chain, a heavy chain domain C.sub.H1, a hinge region heavy chain domain C.sub.H2 and heavy chain domain C.sub.H3.
[0085] Each V.sub.H domain comprises three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. For example, the V.sub.H domain may comprise C or N terminal extensions. In one embodiment, the V.sub.H domain comprises C terminal extensions of from 1 to 10, for example 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 additional amino acids. In one embodiment, the V.sub.H domain comprises C terminal extensions of from 1 to 12, for example 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 additional amino acids of the C.sub.H1 domain. In one embodiment, said extension comprises at least 1 alanine residue, for example a single alanine residue, a pair of alanine residues or a triplet of alanine residues. Such extended V.sub.H domains are within the scope of the invention. Also within the scope of the invention are V.sub.H domains that comprise additional C or N terminal residues, for example linker residues introduced from the expression vector used or His tags, e.g. hexa-His (HHHHHH, SEQ ID NO: 2605).
[0086] Preferably, the one or more V.sub.H domain is a human V.sub.H domain. As used herein, a human V.sub.H domain includes a V.sub.H domain that is derived from or based on a human V.sub.H domain amino acid or nucleic acid sequence. Thus, the term includes variable heavy chain regions derived from human germline immunoglobulin sequences. As used herein, the term human V.sub.H domain includes V.sub.H domains that are isolated from transgenic mice expressing human immunoglobulin V genes, in particular in response to an immunisation with an antigen of interest. The human V.sub.H domains of the invention may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced in vitro, e.g. by random or site-specific mutagenesis, or introduced by somatic mutation in vivo). The term human V.sub.H domain therefore also includes modified human V.sub.H sequences.
[0087] Thus, the invention provides a binding molecule comprising at least one immunoglobulin single domain antibody capable of binding/directed against IL-17RA wherein said domain is a human V.sub.H domain and wherein said IL-17A binding molecule comprises at least one antigen binding site. The single domain antibody is specifically directed against/capable of binding human IL-17RA.
[0088] As used herein, the term V.sub.H or variable domain refers to immunoglobulin variable domains defined by Kabat et al., Sequences of Immunological Interest, 5.sup.th ed., U.S. Dept. Health & Human Services, Washington, D.C. (1991). The numbering and positioning of CDR amino acid residues within the variable domains is in accordance with the well-known Kabat numbering convention.
[0089] More particularly, the invention provides a V.sub.H immunoglobulin domain that can bind to human IL-17RA with an affinity, a Kon-rate, a Koff rate, KD and/or KA as further described herein.
[0090] The binding molecules of the invention comprise amino acid sequences and preferred sequences and/or parts thereof, such as CDRs, as defined herein.
[0091] The term CDR refers to the complementarity-determining region within antibody variable sequences. There are three CDRs in each of the variable regions of the heavy chain and the light chain, which are designated CDR1, CDR2 and CDR3, for each of the variable regions. The term CDR set refers to a group of three CDRs that occur in a single variable region capable of binding the antigen. The exact boundaries of these CDRs have been defined differently according to different systems. The system described by Kabat as used herein. The terms Kabat numbering, Kabat definitions and Kabat labeling are used interchangeably herein. These terms, which are recognized in the art, refer to a system of numbering amino acid residues which are more variable (i.e., hypervariable) than other amino acid residues in the heavy and light chain variable regions of an antibody, or an antigen binding portion thereof (Kabat et al. (1971) Ann. NY Acad. Sci. 190:382-391 and Kabat, et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
[0092] As described in more detail in the experimental part, the inventors isolated parent molecules (resulting in 7 families of clones: done 1.1 is the parent done for family 1 as shown in
[0093] In one aspect, the invention relates to a binding molecule capable of binding human IL-17RA comprising a human V.sub.H domain wherein said V.sub.H domain comprises a family 1 or family 1-like sequence.
[0094] In one embodiment, the binding molecule comprises or consists of at least one immunoglobulin single domain antibody capable of binding/directed against IL-17RA, preferably human IL-17RA, wherein said domain is a human V.sub.H domain and wherein said V.sub.H domain comprises a family 1 or family 1-like sequence. These include the V.sub.H sequence of the parent clone (clone 1.1) or a part thereof, for example a CDR3 sequence and V.sub.H sequences of clones or parts thereof that are derived from the parent clone 1.1 through a process of optimization, for example sequences as shown as shown in
TABLE-US-00002 TABLE 1 This shows SEQ ID NOs. of family 1 CDR sequences and of family 1 full-length V.sub.H sequences that are within the scope of the invention. Corresponding sequences are shown in FIG. 1. Clone VH FULL LENGTH name CDR1 SEQ ID NO. CDR2 SEQ ID NO. CDR3 SEQ ID NO. SEQ ID NO. 1.1 SEQ ID NO. 1 SEQ ID NO. 2 SEQ ID NO. 3 SEQ ID NO. 4 1.2 SEQ ID NO. 5 SEQ ID NO. 6 SEQ ID NO. 7 SEQ ID NO. 8 1.3 SEQ ID NO. 9 SEQ ID NO. 10 SEQ ID NO. 11 SEQ ID NO. 12 1.4 SEQ ID NO. 13 SEQ ID NO. 14 SEQ ID NO. 15 SEQ ID NO. 16 1.5 SEQ ID NO. 17 SEQ ID NO. 18 SEQ ID NO. 19 SEQ ID NO. 20 1.6 SEQ ID NO. 21 SEQ ID NO. 22 SEQ ID NO. 23 SEQ ID NO. 24 1.7 SEQ ID NO. 25 SEQ ID NO. 26 SEQ ID NO. 27 SEQ ID NO. 28 1.8 SEQ ID NO. 29 SEQ ID NO. 30 SEQ ID NO. 31 SEQ ID NO. 32 1.9 SEQ ID NO. 33 SEQ ID NO. 34 SEQ ID NO. 35 SEQ ID NO. 36 1.10 SEQ ID NO. 37 SEQ ID NO. 38 SEQ ID NO. 39 SEQ ID NO. 40 1.11 SEQ ID NO. 41 SEQ ID NO. 42 SEQ ID NO. 43 SEQ ID NO. 44 1.12 SEQ ID NO. 45 SEQ ID NO. 46 SEQ ID NO. 47 SEQ ID NO. 48 1.13 SEQ ID NO. 49 SEQ ID NO. 50 SEQ ID NO. 51 SEQ ID NO. 52 1.14 SEQ ID NO. 53 SEQ ID NO. 54 SEQ ID NO. 55 SEQ ID NO. 56 1.15 SEQ ID NO. 57 SEQ ID NO. 58 SEQ ID NO. 59 SEQ ID NO. 60 1.16 SEQ ID NO. 61 SEQ ID NO. 62 SEQ ID NO. 63 SEQ ID NO. 64 1.17 SEQ ID NO. 65 SEQ ID NO. 66 SEQ ID NO. 67 SEQ ID NO. 68 1.18 SEQ ID NO. 69 SEQ ID NO. 70 SEQ ID NO. 71 SEQ ID NO. 72 1.19 SEQ ID NO. 73 SEQ ID NO. 74 SEQ ID NO. 75 SEQ ID NO. 76 1.20 SEQ ID NO. 77 SEQ ID NO. 78 SEQ ID NO. 79 SEQ ID NO. 80 1.21 SEQ ID NO. 81 SEQ ID NO. 82 SEQ ID NO. 83 SEQ ID NO. 84 1.22 SEQ ID NO. 85 SEQ ID NO. 86 SEQ ID NO. 87 SEQ ID NO. 88 1.23 SEQ ID NO. 89 SEQ ID NO. 90 SEQ ID NO. 91 SEQ ID NO. 92 1.24 SEQ ID NO. 93 SEQ ID NO. 94 SEQ ID NO. 95 SEQ ID NO. 96 1.25 SEQ ID NO. 97 SEQ ID NO. 98 SEQ ID NO. 99 SEQ ID NO. 100 1.26 SEQ ID NO. 101 SEQ ID NO. 102 SEQ ID NO. 103 SEQ ID NO. 104 1.27 SEQ ID NO. 105 SEQ ID NO. 106 SEQ ID NO. 107 SEQ ID NO. 108 1.28 SEQ ID NO. 109 SEQ ID NO. 110 SEQ ID NO. 111 SEQ ID NO. 112 1.29 SEQ ID NO. 113 SEQ ID NO. 114 SEQ ID NO. 115 SEQ ID NO. 116 1.30 SEQ ID NO. 117 SEQ ID NO. 118 SEQ ID NO. 119 SEQ ID NO. 120 1.31 SEQ ID NO. 121 SEQ ID NO. 122 SEQ ID NO. 123 SEQ ID NO. 124 1.32 SEQ ID NO. 125 SEQ ID NO. 126 SEQ ID NO. 127 SEQ ID NO. 128 1.33 SEQ ID NO. 129 SEQ ID NO. 130 SEQ ID NO. 131 SEQ ID NO. 132 1.34 SEQ ID NO. 133 SEQ ID NO. 134 SEQ ID NO. 135 SEQ ID NO. 136 1.35 SEQ ID NO. 137 SEQ ID NO. 138 SEQ ID NO. 139 SEQ ID NO. 140 1.36 SEQ ID NO. 141 SEQ ID NO. 142 SEQ ID NO. 143 SEQ ID NO. 144 1.37 SEQ ID NO. 145 SEQ ID NO. 146 SEQ ID NO. 147 SEQ ID NO. 148 1.38 SEQ ID NO. 149 SEQ ID NO. 150 SEQ ID NO. 151 SEQ ID NO. 152 1.39 SEQ ID NO. 153 SEQ ID NO. 154 SEQ ID NO. 155 SEQ ID NO. 156 1.40 SEQ ID NO. 157 SEQ ID NO. 158 SEQ ID NO. 159 SEQ ID NO. 160 1.41 SEQ ID NO. 161 SEQ ID NO. 162 SEQ ID NO. 163 SEQ ID NO. 164 1.42 SEQ ID NO. 165 SEQ ID NO. 166 SEQ ID NO. 167 SEQ ID NO. 168 1.43 SEQ ID NO. 169 SEQ ID NO. 170 SEQ ID NO. 171 SEQ ID NO. 172 1.44 SEQ ID NO. 173 SEQ ID NO. 174 SEQ ID NO. 175 SEQ ID NO. 176 1.45 SEQ ID NO. 177 SEQ ID NO. 178 SEQ ID NO. 179 SEQ ID NO. 180 1.46 SEQ ID NO. 181 SEQ ID NO. 182 SEQ ID NO. 183 SEQ ID NO. 184 1.47 SEQ ID NO. 185 SEQ ID NO. 186 SEQ ID NO. 187 SEQ ID NO. 188 1.48 SEQ ID NO. 189 SEQ ID NO. 190 SEQ ID NO. 191 SEQ ID NO. 192 1.49 SEQ ID NO. 193 SEQ ID NO. 194 SEQ ID NO. 195 SEQ ID NO. 196 1.50 SEQ ID NO. 197 SEQ ID NO. 198 SEQ ID NO. 199 SEQ ID NO. 200 1.51 SEQ ID NO. 201 SEQ ID NO. 202 SEQ ID NO. 203 SEQ ID NO. 204 1.52 SEQ ID NO. 205 SEQ ID NO. 206 SEQ ID NO. 207 SEQ ID NO. 208 1.53 SEQ ID NO. 209 SEQ ID NO. 210 SEQ ID NO. 211 SEQ ID NO. 212 1.54 SEQ ID NO. 213 SEQ ID NO. 214 SEQ ID NO. 215 SEQ ID NO. 216 1.55 SEQ ID NO. 217 SEQ ID NO. 218 SEQ ID NO. 219 SEQ ID NO. 220 1.56 SEQ ID NO. 221 SEQ ID NO. 222 SEQ ID NO. 223 SEQ ID NO. 224 1.57 SEQ ID NO. 225 SEQ ID NO. 226 SEQ ID NO. 227 SEQ ID NO. 228 1.58 SEQ ID NO. 229 SEQ ID NO. 230 SEQ ID NO. 231 SEQ ID NO. 232 1.59 SEQ ID NO. 233 SEQ ID NO. 234 SEQ ID NO. 235 SEQ ID NO. 236 1.60 SEQ ID NO. 237 SEQ ID NO. 238 SEQ ID NO. 239 SEQ ID NO. 240 1.61 SEQ ID NO. 241 SEQ ID NO. 242 SEQ ID NO. 243 SEQ ID NO. 244 1.62 SEQ ID NO. 245 SEQ ID NO. 246 SEQ ID NO. 247 SEQ ID NO. 248 1.63 SEQ ID NO. 249 SEQ ID NO. 250 SEQ ID NO. 251 SEQ ID NO. 252 1.64 SEQ ID NO. 253 SEQ ID NO. 254 SEQ ID NO. 255 SEQ ID NO. 256 1.65 SEQ ID NO. 257 SEQ ID NO. 258 SEQ ID NO. 259 SEQ ID NO. 260 1.66 SEQ ID NO. 261 SEQ ID NO. 262 SEQ ID NO. 263 SEQ ID NO. 264 1.67 SEQ ID NO. 265 SEQ ID NO. 266 SEQ ID NO. 267 SEQ ID NO. 268 1.68 SEQ ID NO. 269 SEQ ID NO. 270 SEQ ID NO. 271 SEQ ID NO. 272 1.69 SEQ ID NO. 273 SEQ ID NO. 274 SEQ ID NO. 275 SEQ ID NO. 276 1.70 SEQ ID NO. 277 SEQ ID NO. 278 SEQ ID NO. 279 SEQ ID NO. 280 1.71 SEQ ID NO. 281 SEQ ID NO. 282 SEQ ID NO. 283 SEQ ID NO. 284 1.72 SEQ ID NO. 285 SEQ ID NO. 286 SEQ ID NO. 287 SEQ ID NO. 288 1.73 SEQ ID NO. 289 SEQ ID NO. 290 SEQ ID NO. 291 SEQ ID NO. 292 1.74 SEQ ID NO. 293 SEQ ID NO. 294 SEQ ID NO. 295 SEQ ID NO. 296 1.75 SEQ ID NO. 297 SEQ ID NO. 298 SEQ ID NO. 299 SEQ ID NO. 300 1.76 SEQ ID NO. 301 SEQ ID NO. 302 SEQ ID NO. 303 SEQ ID NO. 304 1.77 SEQ ID NO. 305 SEQ ID NO. 306 SEQ ID NO. 307 SEQ ID NO. 308 1.78 SEQ ID NO. 309 SEQ ID NO. 310 SEQ ID NO. 311 SEQ ID NO. 312 1.79 SEQ ID NO. 313 SEQ ID NO. 314 SEQ ID NO. 315 SEQ ID NO. 316 1.80 SEQ ID NO. 317 SEQ ID NO. 318 SEQ ID NO. 319 SEQ ID NO. 320 1.81 SEQ ID NO. 321 SEQ ID NO. 322 SEQ ID NO. 323 SEQ ID NO. 324 1.82 SEQ ID NO. 325 SEQ ID NO. 326 SEQ ID NO. 327 SEQ ID NO. 328 1.83 SEQ ID NO. 329 SEQ ID NO. 330 SEQ ID NO. 331 SEQ ID NO. 332 1.84 SEQ ID NO. 333 SEQ ID NO. 334 SEQ ID NO. 335 SEQ ID NO. 336 1.85 SEQ ID NO. 337 SEQ ID NO. 338 SEQ ID NO. 339 SEQ ID NO. 340 1.86 SEQ ID NO. 341 SEQ ID NO. 342 SEQ ID NO. 343 SEQ ID NO. 344 1.87 SEQ ID NO. 345 SEQ ID NO. 346 SEQ ID NO. 347 SEQ ID NO. 348 1.88 SEQ ID NO. 349 SEQ ID NO. 350 SEQ ID NO. 351 SEQ ID NO. 352 1.89 SEQ ID NO. 353 SEQ ID NO. 354 SEQ ID NO. 355 SEQ ID NO. 356 1.90 SEQ ID NO. 357 SEQ ID NO. 358 SEQ ID NO. 359 SEQ ID NO. 360 1.91 SEQ ID NO. 361 SEQ ID NO. 362 SEQ ID NO. 363 SEQ ID NO. 364 1.92 SEQ ID NO. 365 SEQ ID NO. 366 SEQ ID NO. 367 SEQ ID NO. 368 1.93 SEQ ID NO. 369 SEQ ID NO. 370 SEQ ID NO. 371 SEQ ID NO. 372 1.94 SEQ ID NO. 373 SEQ ID NO. 374 SEQ ID NO. 375 SEQ ID NO. 376 1.95 SEQ ID NO. 377 SEQ ID NO. 378 SEQ ID NO. 379 SEQ ID NO. 380 1.96 SEQ ID NO. 381 SEQ ID NO. 382 SEQ ID NO. 383 SEQ ID NO. 384 1.97 SEQ ID NO. 385 SEQ ID NO. 386 SEQ ID NO. 387 SEQ ID NO. 388 1.98 SEQ ID NO. 389 SEQ ID NO. 390 SEQ ID NO. 391 SEQ ID NO. 392 1.99 SEQ ID NO. 393 SEQ ID NO. 394 SEQ ID NO. 395 SEQ ID NO. 396 1.100 SEQ ID NO. 397 SEQ ID NO. 398 SEQ ID NO. 399 SEQ ID NO. 400 1.101 SEQ ID NO. 401 SEQ ID NO. 402 SEQ ID NO. 403 SEQ ID NO. 404 1.102 SEQ ID NO. 405 SEQ ID NO. 406 SEQ ID NO. 407 SEQ ID NO. 408 1.103 SEQ ID NO. 409 SEQ ID NO. 410 SEQ ID NO. 411 SEQ ID NO. 412 1.104 SEQ ID NO. 413 SEQ ID NO. 414 SEQ ID NO. 415 SEQ ID NO. 416 1.105 SEQ ID NO. 417 SEQ ID NO. 418 SEQ ID NO. 419 SEQ ID NO. 420 1.106 SEQ ID NO. 421 SEQ ID NO. 422 SEQ ID NO. 423 SEQ ID NO. 424 1.107 SEQ ID NO. 425 SEQ ID NO. 426 SEQ ID NO. 427 SEQ ID NO. 428 1.108 SEQ ID NO. 429 SEQ ID NO. 430 SEQ ID NO. 431 SEQ ID NO. 432 1.109 SEQ ID NO. 433 SEQ ID NO. 434 SEQ ID NO. 435 SEQ ID NO. 436 1.110 SEQ ID NO. 437 SEQ ID NO. 438 SEQ ID NO. 439 SEQ ID NO. 440 1.111 SEQ ID NO. 441 SEQ ID NO. 442 SEQ ID NO. 443 SEQ ID NO. 444 1.112 SEQ ID NO. 445 SEQ ID NO. 446 SEQ ID NO. 447 SEQ ID NO. 448 1.113 SEQ ID NO. 449 SEQ ID NO. 450 SEQ ID NO. 451 SEQ ID NO. 452 1.114 SEQ ID NO. 453 SEQ ID NO. 454 SEQ ID NO. 455 SEQ ID NO. 456 1.115 SEQ ID NO. 457 SEQ ID NO. 458 SEQ ID NO. 459 SEQ ID NO. 460 1.116 SEQ ID NO. 461 SEQ ID NO. 462 SEQ ID NO. 463 SEQ ID NO. 464 1.117 SEQ ID NO. 465 SEQ ID NO. 466 SEQ ID NO. 467 SEQ ID NO. 468 1.118 SEQ ID NO. 469 SEQ ID NO. 470 SEQ ID NO. 471 SEQ ID NO. 472 1.119 SEQ ID NO. 473 SEQ ID NO. 474 SEQ ID NO. 475 SEQ ID NO. 476 1.120 SEQ ID NO. 477 SEQ ID NO. 478 SEQ ID NO. 479 SEQ ID NO. 480 1.121 SEQ ID NO. 481 SEQ ID NO. 482 SEQ ID NO. 483 SEQ ID NO. 484 1.122 SEQ ID NO. 485 SEQ ID NO. 486 SEQ ID NO. 487 SEQ ID NO. 488 1.123 SEQ ID NO. 489 SEQ ID NO. 490 SEQ ID NO. 491 SEQ ID NO. 492 1.124 SEQ ID NO. 493 SEQ ID NO. 494 SEQ ID NO. 495 SEQ ID NO. 496 1.125 SEQ ID NO. 497 SEQ ID NO. 498 SEQ ID NO. 499 SEQ ID NO. 500 1.126 SEQ ID NO. 501 SEQ ID NO. 502 SEQ ID NO. 503 SEQ ID NO. 504 1.127 SEQ ID NO. 505 SEQ ID NO. 506 SEQ ID NO. 507 SEQ ID NO. 508 1.128 SEQ ID NO. 509 SEQ ID NO. 510 SEQ ID NO. 511 SEQ ID NO. 512 1.129 SEQ ID NO. 513 SEQ ID NO. 514 SEQ ID NO. 515 SEQ ID NO. 516 1.130 SEQ ID NO. 517 SEQ ID NO. 518 SEQ ID NO. 519 SEQ ID NO. 520 1.131 SEQ ID NO. 521 SEQ ID NO. 522 SEQ ID NO. 523 SEQ ID NO. 524 1.132 SEQ ID NO. 525 SEQ ID NO. 526 SEQ ID NO. 527 SEQ ID NO. 528 1.133 SEQ ID NO. 529 SEQ ID NO. 530 SEQ ID NO. 531 SEQ ID NO. 532 1.134 SEQ ID NO. 533 SEQ ID NO. 534 SEQ ID NO. 535 SEQ ID NO. 536 1.135 SEQ ID NO. 537 SEQ ID NO. 538 SEQ ID NO. 539 SEQ ID NO. 540 1.136 SEQ ID NO. 541 SEQ ID NO. 542 SEQ ID NO. 543 SEQ ID NO. 544 1.137 SEQ ID NO. 545 SEQ ID NO. 546 SEQ ID NO. 547 SEQ ID NO. 548 1.138 SEQ ID NO. 549 SEQ ID NO. 550 SEQ ID NO. 551 SEQ ID NO. 552 1.139 SEQ ID NO. 553 SEQ ID NO. 554 SEQ ID NO. 555 SEQ ID NO. 556 1.140 SEQ ID NO. 557 SEQ ID NO. 558 SEQ ID NO. 559 SEQ ID NO. 560 1.141 SEQ ID NO. 561 SEQ ID NO. 562 SEQ ID NO. 563 SEQ ID NO. 564 1.142 SEQ ID NO. 565 SEQ ID NO. 566 SEQ ID NO. 567 SEQ ID NO. 568 1.143 SEQ ID NO. 569 SEQ ID NO. 570 SEQ ID NO. 571 SEQ ID NO. 572 1.144 SEQ ID NO. 573 SEQ ID NO. 574 SEQ ID NO. 575 SEQ ID NO. 576 1.145 SEQ ID NO. 577 SEQ ID NO. 578 SEQ ID NO. 579 SEQ ID NO. 580 1.146 SEQ ID NO. 581 SEQ ID NO. 582 SEQ ID NO. 583 SEQ ID NO. 584 1.147 SEQ ID NO. 585 SEQ ID NO. 586 SEQ ID NO. 587 SEQ ID NO. 588 1.148 SEQ ID NO. 589 SEQ ID NO. 590 SEQ ID NO. 591 SEQ ID NO. 592 1.149 SEQ ID NO. 593 SEQ ID NO. 594 SEQ ID NO. 595 SEQ ID NO. 596 1.150 SEQ ID NO. 597 SEQ ID NO. 598 SEQ ID NO. 599 SEQ ID NO. 600 1.151 SEQ ID NO. 601 SEQ ID NO. 602 SEQ ID NO. 603 SEQ ID NO. 604 1.152 SEQ ID NO. 605 SEQ ID NO. 606 SEQ ID NO. 607 SEQ ID NO. 608 1.153 SEQ ID NO. 609 SEQ ID NO. 610 SEQ ID NO. 611 SEQ ID NO. 612 1.154 SEQ ID NO. 613 SEQ ID NO. 614 SEQ ID NO. 615 SEQ ID NO. 616 1.155 SEQ ID NO. 617 SEQ ID NO. 618 SEQ ID NO. 619 SEQ ID NO. 620 1.156 SEQ ID NO. 621 SEQ ID NO. 622 SEQ ID NO. 623 SEQ ID NO. 624 1.157 SEQ ID NO. 625 SEQ ID NO. 626 SEQ ID NO. 627 SEQ ID NO. 628 1.158 SEQ ID NO. 629 SEQ ID NO. 630 SEQ ID NO. 631 SEQ ID NO. 632 1.159 SEQ ID NO. 633 SEQ ID NO. 634 SEQ ID NO. 635 SEQ ID NO. 636 1.160 SEQ ID NO. 637 SEQ ID NO. 638 SEQ ID NO. 639 SEQ ID NO. 640 1.161 SEQ ID NO. 641 SEQ ID NO. 642 SEQ ID NO. 643 SEQ ID NO. 644 1.162 SEQ ID NO. 645 SEQ ID NO. 646 SEQ ID NO. 647 SEQ ID NO. 648 1.163 SEQ ID NO. 649 SEQ ID NO. 650 SEQ ID NO. 651 SEQ ID NO. 652 1.164 SEQ ID NO. 653 SEQ ID NO. 654 SEQ ID NO. 655 SEQ ID NO. 656 1.165 SEQ ID NO. 657 SEQ ID NO. 658 SEQ ID NO. 659 SEQ ID NO. 660 1.166 SEQ ID NO. 661 SEQ ID NO. 662 SEQ ID NO. 663 SEQ ID NO. 664 1.167 SEQ ID NO. 665 SEQ ID NO. 666 SEQ ID NO. 667 SEQ ID NO. 668 1.168 SEQ ID NO. 669 SEQ ID NO. 670 SEQ ID NO. 671 SEQ ID NO. 672 1.169 SEQ ID NO. 673 SEQ ID NO. 674 SEQ ID NO. 675 SEQ ID NO. 676 1.170 SEQ ID NO. 677 SEQ ID NO. 678 SEQ ID NO. 679 SEQ ID NO. 680 1.171 SEQ ID NO. 681 SEQ ID NO. 682 SEQ ID NO. 683 SEQ ID NO. 684 1.172 SEQ ID NO. 685 SEQ ID NO. 686 SEQ ID NO. 687 SEQ ID NO. 688 1.173 SEQ ID NO. 689 SEQ ID NO. 690 SEQ ID NO. 691 SEQ ID NO. 692 1.174 SEQ ID NO. 693 SEQ ID NO. 694 SEQ ID NO. 695 SEQ ID NO. 696 1.175 SEQ ID NO. 697 SEQ ID NO. 698 SEQ ID NO. 699 SEQ ID NO. 700 1.176 SEQ ID NO. 701 SEQ ID NO. 702 SEQ ID NO. 703 SEQ ID NO. 704 1.177 SEQ ID NO. 705 SEQ ID NO. 706 SEQ ID NO. 707 SEQ ID NO. 708 1.178 SEQ ID NO. 709 SEQ ID NO. 710 SEQ ID NO. 711 SEQ ID NO. 712 1.179 SEQ ID NO. 713 SEQ ID NO. 714 SEQ ID NO. 715 SEQ ID NO. 716 1.180 SEQ ID NO. 717 SEQ ID NO. 718 SEQ ID NO. 719 SEQ ID NO. 720 1.181 SEQ ID NO. 721 SEQ ID NO. 722 SEQ ID NO. 723 SEQ ID NO. 724 1.182 SEQ ID NO. 725 SEQ ID NO. 726 SEQ ID NO. 727 SEQ ID NO. 728 1.183 SEQ ID NO. 729 SEQ ID NO. 730 SEQ ID NO. 731 SEQ ID NO. 732 1.184 SEQ ID NO. 733 SEQ ID NO. 734 SEQ ID NO. 735 SEQ ID NO. 736 1.185 SEQ ID NO. 737 SEQ ID NO. 738 SEQ ID NO. 739 SEQ ID NO. 740 1.186 SEQ ID NO. 741 SEQ ID NO. 742 SEQ ID NO. 743 SEQ ID NO. 744 1.187 SEQ ID NO. 745 SEQ ID NO. 746 SEQ ID NO. 747 SEQ ID NO. 748 1.188 SEQ ID NO. 749 SEQ ID NO. 750 SEQ ID NO. 751 SEQ ID NO. 752 1.189 SEQ ID NO. 753 SEQ ID NO. 754 SEQ ID NO. 755 SEQ ID NO. 756 1.190 SEQ ID NO. 757 SEQ ID NO. 758 SEQ ID NO. 759 SEQ ID NO. 760 1.191 SEQ ID NO. 761 SEQ ID NO. 762 SEQ ID NO. 763 SEQ ID NO. 764 1.192 SEQ ID NO. 765 SEQ ID NO. 766 SEQ ID NO. 767 SEQ ID NO. 768 1.193 SEQ ID NO. 769 SEQ ID NO. 770 SEQ ID NO. 771 SEQ ID NO. 772 1.194 SEQ ID NO. 773 SEQ ID NO. 774 SEQ ID NO. 775 SEQ ID NO. 776 1.195 SEQ ID NO. 777 SEQ ID NO. 778 SEQ ID NO. 779 SEQ ID NO. 780 1.196 SEQ ID NO. 781 SEQ ID NO. 782 SEQ ID NO. 783 SEQ ID NO. 784 1.197 SEQ ID NO. 785 SEQ ID NO. 786 SEQ ID NO. 787 SEQ ID NO. 788 1.198 SEQ ID NO. 789 SEQ ID NO. 790 SEQ ID NO. 791 SEQ ID NO. 792 1.199 SEQ ID NO. 793 SEQ ID NO. 794 SEQ ID NO. 795 SEQ ID NO. 796 1.200 SEQ ID NO. 797 SEQ ID NO. 798 SEQ ID NO. 799 SEQ ID NO. 800 1.201 SEQ ID NO. 801 SEQ ID NO. 802 SEQ ID NO. 803 SEQ ID NO. 804 1.202 SEQ ID NO. 805 SEQ ID NO. 806 SEQ ID NO. 807 SEQ ID NO. 808 1.203 SEQ ID NO. 809 SEQ ID NO. 810 SEQ ID NO. 811 SEQ ID NO. 812 1.204 SEQ ID NO. 813 SEQ ID NO. 814 SEQ ID NO. 815 SEQ ID NO. 816 1.205 SEQ ID NO. 817 SEQ ID NO. 818 SEQ ID NO. 819 SEQ ID NO. 820 1.206 SEQ ID NO. 821 SEQ ID NO. 822 SEQ ID NO. 823 SEQ ID NO. 824 1.207 SEQ ID NO. 825 SEQ ID NO. 826 SEQ ID NO. 827 SEQ ID NO. 828 1.208 SEQ ID NO. 829 SEQ ID NO. 830 SEQ ID NO. 831 SEQ ID NO. 832 1.209 SEQ ID NO. 833 SEQ ID NO. 834 SEQ ID NO. 835 SEQ ID NO. 836 1.210 SEQ ID NO. 837 SEQ ID NO. 838 SEQ ID NO. 839 SEQ ID NO. 840 1.211 SEQ ID NO. 841 SEQ ID NO. 842 SEQ ID NO. 843 SEQ ID NO. 844 1.212 SEQ ID NO. 845 SEQ ID NO. 846 SEQ ID NO. 847 SEQ ID NO. 848 1.213 SEQ ID NO. 849 SEQ ID NO. 850 SEQ ID NO. 851 SEQ ID NO. 852 1.214 SEQ ID NO. 853 SEQ ID NO. 854 SEQ ID NO. 855 SEQ ID NO. 856 1.215 SEQ ID NO. 857 SEQ ID NO. 858 SEQ ID NO. 859 SEQ ID NO. 860 1.216 SEQ ID NO. 861 SEQ ID NO. 862 SEQ ID NO. 863 SEQ ID NO. 864 1.217 SEQ ID NO. 865 SEQ ID NO. 866 SEQ ID NO. 867 SEQ ID NO. 868 1.218 SEQ ID NO. 869 SEQ ID NO. 870 SEQ ID NO. 871 SEQ ID NO. 872 1.219 SEQ ID NO. 873 SEQ ID NO. 874 SEQ ID NO. 875 SEQ ID NO. 876 1.220 SEQ ID NO. 877 SEQ ID NO. 878 SEQ ID NO. 879 SEQ ID NO. 880 1.221 SEQ ID NO. 881 SEQ ID NO. 882 SEQ ID NO. 883 SEQ ID NO. 884 1.222 SEQ ID NO. 885 SEQ ID NO. 886 SEQ ID NO. 887 SEQ ID NO. 888 1.223 SEQ ID NO. 889 SEQ ID NO. 890 SEQ ID NO. 891 SEQ ID NO. 892 1.224 SEQ ID NO. 893 SEQ ID NO. 894 SEQ ID NO. 895 SEQ ID NO. 896 1.225 SEQ ID NO. 897 SEQ ID NO. 898 SEQ ID NO. 899 SEQ ID NO. 900 1.226 SEQ ID NO. 901 SEQ ID NO. 902 SEQ ID NO. 903 SEQ ID NO. 904 1.227 SEQ ID NO. 905 SEQ ID NO. 906 SEQ ID NO. 907 SEQ ID NO. 908 1.228 SEQ ID NO. 909 SEQ ID NO. 910 SEQ ID NO. 911 SEQ ID NO. 912 1.229 SEQ ID NO. 913 SEQ ID NO. 914 SEQ ID NO. 915 SEQ ID NO. 916 1.230 SEQ ID NO. 917 SEQ ID NO. 918 SEQ ID NO. 919 SEQ ID NO. 920 1.231 SEQ ID NO. 921 SEQ ID NO. 922 SEQ ID NO. 923 SEQ ID NO. 924 1.232 SEQ ID NO. 925 SEQ ID NO. 926 SEQ ID NO. 927 SEQ ID NO. 928 1.233 SEQ ID NO. 929 SEQ ID NO. 930 SEQ ID NO. 931 SEQ ID NO. 932 1.234 SEQ ID NO. 933 SEQ ID NO. 934 SEQ ID NO. 935 SEQ ID NO. 936 1.235 SEQ ID NO. 937 SEQ ID NO. 938 SEQ ID NO. 939 SEQ ID NO. 940 1.236 SEQ ID NO. 941 SEQ ID NO. 942 SEQ ID NO. 943 SEQ ID NO. 944 1.237 SEQ ID NO. 945 SEQ ID NO. 946 SEQ ID NO. 947 SEQ ID NO. 948 1.238 SEQ ID NO. 949 SEQ ID NO. 950 SEQ ID NO. 951 SEQ ID NO. 952 1.239 SEQ ID NO. 953 SEQ ID NO. 954 SEQ ID NO. 955 SEQ ID NO. 956 1.240 SEQ ID NO. 957 SEQ ID NO. 958 SEQ ID NO. 959 SEQ ID NO. 960 1.241 SEQ ID NO. 961 SEQ ID NO. 962 SEQ ID NO. 963 SEQ ID NO. 964 1.242 SEQ ID NO. 965 SEQ ID NO. 966 SEQ ID NO. 967 SEQ ID NO. 968 1.243 SEQ ID NO. 969 SEQ ID NO. 970 SEQ ID NO. 971 SEQ ID NO. 972 1.244 SEQ ID NO. 973 SEQ ID NO. 974 SEQ ID NO. 975 SEQ ID NO. 976 1.245 SEQ ID NO. 977 SEQ ID NO. 978 SEQ ID NO. 979 SEQ ID NO. 980 1.246 SEQ ID NO. 981 SEQ ID NO. 982 SEQ ID NO. 983 SEQ ID NO. 984 1.247 SEQ ID NO. 985 SEQ ID NO. 986 SEQ ID NO. 987 SEQ ID NO. 988 1.248 SEQ ID NO. 989 SEQ ID NO. 990 SEQ ID NO. 991 SEQ ID NO. 992 1.249 SEQ ID NO. 993 SEQ ID NO. 994 SEQ ID NO. 995 SEQ ID NO. 996 1.250 SEQ ID NO. 997 SEQ ID NO. 998 SEQ ID NO. 999 SEQ ID NO. 1000 1.251 SEQ ID NO. 1001 SEQ ID NO. 1002 SEQ ID NO. 1003 SEQ ID NO. 1004 1.252 SEQ ID NO. 1005 SEQ ID NO. 1006 SEQ ID NO. 1007 SEQ ID NO. 1008 1.253 SEQ ID NO. 1009 SEQ ID NO. 1010 SEQ ID NO. 1011 SEQ ID NO. 1012 1.254 SEQ ID NO. 1013 SEQ ID NO. 1014 SEQ ID NO. 1015 SEQ ID NO. 1016 1.255 SEQ ID NO. 1017 SEQ ID NO. 1018 SEQ ID NO. 1019 SEQ ID NO. 1020 1.256 SEQ ID NO. 1021 SEQ ID NO. 1022 SEQ ID NO. 1023 SEQ ID NO. 1024 1.257 SEQ ID NO. 1025 SEQ ID NO. 1026 SEQ ID NO. 1027 SEQ ID NO. 1028 1.258 SEQ ID NO. 1029 SEQ ID NO. 1030 SEQ ID NO. 1031 SEQ ID NO. 1032 1.259 SEQ ID NO. 1033 SEQ ID NO. 1034 SEQ ID NO. 1035 SEQ ID NO. 1036 1.260 SEQ ID NO. 1037 SEQ ID NO. 1038 SEQ ID NO. 1039 SEQ ID NO. 1040 1.261 SEQ ID NO. 1041 SEQ ID NO. 1042 SEQ ID NO. 1043 SEQ ID NO. 1044 1.262 SEQ ID NO. 1045 SEQ ID NO. 1046 SEQ ID NO. 1047 SEQ ID NO. 1048 1.263 SEQ ID NO. 1049 SEQ ID NO. 1050 SEQ ID NO. 1051 SEQ ID NO. 1052 1.264 SEQ ID NO. 1053 SEQ ID NO. 1054 SEQ ID NO. 1055 SEQ ID NO. 1056 1.265 SEQ ID NO. 1057 SEQ ID NO. 1058 SEQ ID NO. 1059 SEQ ID NO. 1060 1.266 SEQ ID NO. 1061 SEQ ID NO. 1062 SEQ ID NO. 1063 SEQ ID NO. 1064 1.267 SEQ ID NO. 1065 SEQ ID NO. 1066 SEQ ID NO. 1067 SEQ ID NO. 1068 1.268 SEQ ID NO. 1069 SEQ ID NO. 1070 SEQ ID NO. 1071 SEQ ID NO. 1072 1.269 SEQ ID NO. 1073 SEQ ID NO. 1074 SEQ ID NO. 1075 SEQ ID NO. 1076 1.270 SEQ ID NO. 1077 SEQ ID NO. 1078 SEQ ID NO. 1079 SEQ ID NO. 1080 1.271 SEQ ID NO. 1081 SEQ ID NO. 1082 SEQ ID NO. 1083 SEQ ID NO. 1084 1.272 SEQ ID NO. 1085 SEQ ID NO. 1086 SEQ ID NO. 1087 SEQ ID NO. 1088 1.273 SEQ ID NO. 1089 SEQ ID NO. 1090 SEQ ID NO. 1091 SEQ ID NO. 1092 1.274 SEQ ID NO. 1093 SEQ ID NO. 1094 SEQ ID NO. 1095 SEQ ID NO. 1096 1.275 SEQ ID NO. 1097 SEQ ID NO. 1098 SEQ ID NO. 1099 SEQ ID NO. 1100 1.276 SEQ ID NO. 1101 SEQ ID NO. 1102 SEQ ID NO. 1103 SEQ ID NO. 1104 1.277 SEQ ID NO. 1105 SEQ ID NO. 1106 SEQ ID NO. 1107 SEQ ID NO. 1108 1.278 SEQ ID NO. 1109 SEQ ID NO. 1110 SEQ ID NO. 1111 SEQ ID NO. 1112 1.279 SEQ ID NO. 1113 SEQ ID NO. 1114 SEQ ID NO. 1115 SEQ ID NO. 1116 1.280 SEQ ID NO. 1117 SEQ ID NO. 1118 SEQ ID NO. 1119 SEQ ID NO. 1120 1.281 SEQ ID NO. 1121 SEQ ID NO. 1122 SEQ ID NO. 1123 SEQ ID NO. 1124 1.282 SEQ ID NO. 1125 SEQ ID NO. 1126 SEQ ID NO. 1127 SEQ ID NO. 1128 1.283 SEQ ID NO. 1129 SEQ ID NO. 1130 SEQ ID NO. 1131 SEQ ID NO. 1132 1.284 SEQ ID NO. 1133 SEQ ID NO. 1134 SEQ ID NO. 1135 SEQ ID NO. 1136 1.285 SEQ ID NO. 1137 SEQ ID NO. 1138 SEQ ID NO. 1139 SEQ ID NO. 1140 1.286 SEQ ID NO. 1141 SEQ ID NO. 1142 SEQ ID NO. 1143 SEQ ID NO. 1144 1.287 SEQ ID NO. 1145 SEQ ID NO. 1146 SEQ ID NO. 1147 SEQ ID NO. 1148 1.288 SEQ ID NO. 1149 SEQ ID NO. 1150 SEQ ID NO. 1151 SEQ ID NO. 1152 1.289 SEQ ID NO. 1153 SEQ ID NO. 1154 SEQ ID NO. 1155 SEQ ID NO. 1156 1.290 SEQ ID NO. 1157 SEQ ID NO. 1158 SEQ ID NO. 1159 SEQ ID NO. 1160 1.291 SEQ ID NO. 1161 SEQ ID NO. 1162 SEQ ID NO. 1163 SEQ ID NO. 1164 1.292 SEQ ID NO. 1165 SEQ ID NO. 1166 SEQ ID NO. 1167 SEQ ID NO. 1168 1.293 SEQ ID NO. 1169 SEQ ID NO. 1170 SEQ ID NO. 1171 SEQ ID NO. 1172 1.294 SEQ ID NO. 1173 SEQ ID NO. 1174 SEQ ID NO. 1175 SEQ ID NO. 1176 1.295 SEQ ID NO. 1177 SEQ ID NO. 1178 SEQ ID NO. 1179 SEQ ID NO. 1180 1.296 SEQ ID NO. 1181 SEQ ID NO. 1182 SEQ ID NO. 1183 SEQ ID NO. 1184 1.297 SEQ ID NO. 1185 SEQ ID NO. 1186 SEQ ID NO. 1187 SEQ ID NO. 1188 1.298 SEQ ID NO. 1189 SEQ ID NO. 1190 SEQ ID NO. 1191 SEQ ID NO. 1192 1.299 SEQ ID NO. 1193 SEQ ID NO. 1194 SEQ ID NO. 1195 SEQ ID NO. 1196 1.300 SEQ ID NO. 1197 SEQ ID NO. 1198 SEQ ID NO. 1199 SEQ ID NO. 1200 1.301 SEQ ID NO. 1201 SEQ ID NO. 1202 SEQ ID NO. 1203 SEQ ID NO. 1204 1.302 SEQ ID NO. 1205 SEQ ID NO. 1206 SEQ ID NO. 1207 SEQ ID NO. 1208 1.303 SEQ ID NO. 1209 SEQ ID NO. 1210 SEQ ID NO. 1211 SEQ ID NO. 1212 1.304 SEQ ID NO. 1213 SEQ ID NO. 1214 SEQ ID NO. 1215 SEQ ID NO. 1216 1.305 SEQ ID NO. 1217 SEQ ID NO. 1218 SEQ ID NO. 1219 SEQ ID NO. 1220 1.306 SEQ ID NO. 1221 SEQ ID NO. 1222 SEQ ID NO. 1223 SEQ ID NO. 1224 1.307 SEQ ID NO. 1225 SEQ ID NO. 1226 SEQ ID NO. 1227 SEQ ID NO. 1228 1.308 SEQ ID NO. 1229 SEQ ID NO. 1230 SEQ ID NO. 1231 SEQ ID NO. 1232 1.309 SEQ ID NO. 1233 SEQ ID NO. 1234 SEQ ID NO. 1235 SEQ ID NO. 1236 1.310 SEQ ID NO. 1237 SEQ ID NO. 1238 SEQ ID NO. 1239 SEQ ID NO. 1240 1.311 SEQ ID NO. 1241 SEQ ID NO. 1242 SEQ ID NO. 1243 SEQ ID NO. 1244 1.312 SEQ ID NO. 1245 SEQ ID NO. 1246 SEQ ID NO. 1247 SEQ ID NO. 1248 1.313 SEQ ID NO. 1249 SEQ ID NO. 1250 SEQ ID NO. 1251 SEQ ID NO. 1252 1.314 SEQ ID NO. 1253 SEQ ID NO. 1254 SEQ ID NO. 1255 SEQ ID NO. 1256 1.315 SEQ ID NO. 1257 SEQ ID NO. 1258 SEQ ID NO. 1259 SEQ ID NO. 1260 1.316 SEQ ID NO. 1261 SEQ ID NO. 1262 SEQ ID NO. 1263 SEQ ID NO. 1264
[0095] In one aspect of the invention, the family 1 or family 1-like binding molecule comprises a human V.sub.H domain comprising a CDR3 sequence comprising SEQ ID NO. 3 or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology to SEQ ID NO. 3.
[0096] In one embodiment, the family 1 or family 1-like binding molecule comprises at least one immunoglobulin single domain antibody directed against IL-17RA wherein said domain is a human V.sub.H domain and wherein said V.sub.H domain comprises at least one antigen binding site comprising a CDR3 sequence having SEQ ID NO. 3 or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology to SEQ ID NO. 3.
[0097] In one embodiment, homology is at least 90% homology to SEQ ID NO. 3.
[0098] In one embodiment, the CDR3 sequence is selected from one of the CDR3 sequences as shown in table 1 with reference to
[0099] In one embodiment, the family 1 or family 1-like binding molecule comprises at least one antigen binding site comprising CDR1, CDR2 and CDR3, said CDR1 region comprising or consisting of amino acid sequence SEQ ID NO. 1 or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto, said CDR2 region comprising or consisting of the amino acid sequence SEQ ID NO. 2 or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto, and said CDR3 region comprising or consisting of the amino acid sequence SEQ ID NO. 3 or a sequence with at least 60%, at least 70%, at least 80%, at least 90%, or at least 95% homology thereto. For example, the CDR sequence may be a CDR sequence selected from those shown in
[0100] In one embodiment, said CDR1 comprises or consists of the amino acid sequence as shown in SEQ ID NO. 1 or a sequence with at least 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto. In one embodiment, said CDR2 comprises or consists of the amino acid sequence as shown in SEQ ID NO: 2 or a sequence with at least 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto. In one embodiment, said CDR3 comprises or consists of the amino acid sequence as shown in SEQ ID NO. 3 or a sequence with at least 60%, 65%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto.
[0101] In one embodiment, CDR1 comprises or consists of one of the CDR1 amino acid sequence listed above in table 1 with reference to
[0102] Thus, in one embodiment, CDR1 is SEQ ID NO. 1, CDR2 is SEQ ID NO. 2 and CDR3 is SEQ ID NO. 3. In another embodiment, CDR1 is SEQ ID NO. 5, CDR2 is SEQ ID NO. 6 and CDR3 is SEQ ID NO. 7. In another embodiment, CDR1 is SEQ ID NO. 9, CDR2 is SEQ ID NO. 10 and CDR3 is SEQ ID NO. 11. In another embodiment, CDR1 is SEQ ID NO. 13, CDR2 is SEQ ID NO. 14 and CDR3 is SEQ ID NO. 15. In another embodiment, CDR1 is SEQ ID NO. 17, CDR2 is SEQ ID NO. 18 and CDR3 is SEQ ID NO. 19. In another embodiment, CDR1 is SEQ ID NO. 21, CDR2 is SEQ ID NO. 22 and CDR3 is SEQ ID NO. 23.
[0103] In one embodiment, the family 1 or family 1-like sequence has a V.sub.H domain that comprises or consists of SEQ ID NO. 4 or a sequence with at least 40%, 50%, 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto. CDR sequences of such sequences are shown in
[0104] In one embodiment, said V.sub.H domain comprises or consists of a sequence selected from SEQ ID NOs. 4, 8, 12, 16, 20 or 24 or a sequence with at least 40%, 50%, 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto.
[0105] In another aspect, the invention relates to a binding molecule comprising or consisting of a V.sub.H domain as shown in SEQ ID NO. 4 or a variant thereof comprising amino acid substitutions compared to SEQ ID NO. 4 as follows residue 1 is E, residue 30 is A, residue 55 is A, residue 58 is K, I, residue 59 is G, residue 63 is T, residue 100 is S, residue 101 is S, residue 104 is Y and/or residue 106 is S.
[0106] The family 1 or family 1-like binding molecules preferably have KD, Koff, KA, Kd and IC.sub.50 values as further described herein and as shown in the examples.
[0107] The term KD refers to the equilibrium dissociation constant and refers to the value obtained in a titration measurement at equilibrium, or by dividing the dissociation rate constant (Koff) by the association rate constant (Kon). KA refers to the affinity constant. The association rate constant, the dissociation rate constant and the equilibrium dissociation constant are used to represent the binding affinity of an antibody to an antigen. Methods for determining association and dissociation rate constants are well known in the art. Using fluorescence-based techniques offers high sensitivity and the ability to examine samples in physiological buffers at equilibrium. Other experimental approaches and instruments such as a BIAcore (biomolecular interaction analysis) assay can be used.
[0108] In another aspect, the invention relates to a binding molecule capable of binding human IL-17RA comprising a human V.sub.H domain wherein said V.sub.H domain comprises a family 2 or family 2-like sequence.
[0109] In one embodiment, the binding molecule comprises or consists of at least one immunoglobulin single domain antibody directed against IL-17RA, preferably human IL-17RA, wherein said domain is a human V.sub.H domain and wherein said IL-17RA binding molecule comprises a family 2 or family 2-like sequence. These include the parent sequence and sequences of clones that are derived from the parent clone (clone 2.2) or a part thereof, for example a CDR3 sequence, and V.sub.H sequences of clones or parts thereof that are derived from the parent clone 2.1 through a process of optimization, for example as shown in
TABLE-US-00003 TABLE 2 This shows SEQ ID NOs of family 2 CDR sequences and of family 2 full-length V.sub.H sequences that are within the scope of the invention. Corresponding sequences are shown in FIG. 2. Clone VH Full length name CDR1 Seq ID No CDR2 Seq ID No CDR3 Seq ID No sequence Seq ID No 2.1 SEQ ID NO. 1265 SEQ ID NO. 1266 SEQ ID NO. 1267 SEQ ID NO. 1268 2.2 SEQ ID NO. 1269 SEQ ID NO. 1270 SEQ ID NO. 1271 SEQ ID NO. 1272 2.3 SEQ ID NO. 1273 SEQ ID NO. 1274 SEQ ID NO. 1275 SEQ ID NO. 1276 2.4 SEQ ID NO. 1277 SEQ ID NO. 1278 SEQ ID NO. 1279 SEQ ID NO. 1280 2.5 SEQ ID NO. 1281 SEQ ID NO. 1282 SEQ ID NO. 1283 SEQ ID NO. 1284 2.6 SEQ ID NO. 1285 SEQ ID NO. 1286 SEQ ID NO. 1287 SEQ ID NO. 1288 2.7 SEQ ID NO. 1289 SEQ ID NO. 1290 SEQ ID NO. 1291 SEQ ID NO. 1292 2.8 SEQ ID NO. 1293 SEQ ID NO. 1294 SEQ ID NO. 1295 SEQ ID NO. 1296 2.9 SEQ ID NO. 1297 SEQ ID NO. 1298 SEQ ID NO. 1299 SEQ ID NO. 1300 2.10 SEQ ID NO. 1301 SEQ ID NO. 1302 SEQ ID NO. 1303 SEQ ID NO. 1304 2.11 SEQ ID NO. 1305 SEQ ID NO. 1306 SEQ ID NO. 1307 SEQ ID NO. 1308 2.12 SEQ ID NO. 1309 SEQ ID NO. 1310 SEQ ID NO. 1311 SEQ ID NO. 1312 2.13 SEQ ID NO. 1313 SEQ ID NO. 1314 SEQ ID NO. 1315 SEQ ID NO. 1316 2.14 SEQ ID NO. 1317 SEQ ID NO. 1318 SEQ ID NO. 1319 SEQ ID NO. 1320 2.15 SEQ ID NO. 1321 SEQ ID NO. 1322 SEQ ID NO. 1323 SEQ ID NO. 1324 2.16 SEQ ID NO. 1325 SEQ ID NO. 1326 SEQ ID NO. 1327 SEQ ID NO. 1328 2.17 SEQ ID NO. 1329 SEQ ID NO. 1330 SEQ ID NO. 1331 SEQ ID NO. 1332 2.18 SEQ ID NO. 1333 SEQ ID NO. 1334 SEQ ID NO. 1335 SEQ ID NO. 1336 2.19 SEQ ID NO. 1337 SEQ ID NO. 1338 SEQ ID NO. 1339 SEQ ID NO. 1340 2.20 SEQ ID NO. 1341 SEQ ID NO. 1342 SEQ ID NO. 1343 SEQ ID NO. 1344 2.21 SEQ ID NO. 1345 SEQ ID NO. 1346 SEQ ID NO. 1347 SEQ ID NO. 1348 2.22 SEQ ID NO. 1349 SEQ ID NO. 1350 SEQ ID NO. 1351 SEQ ID NO. 1352 2.23 SEQ ID NO. 1353 SEQ ID NO. 1354 SEQ ID NO. 1355 SEQ ID NO. 1356 2.24 SEQ ID NO. 1357 SEQ ID NO. 1358 SEQ ID NO. 1359 SEQ ID NO. 1360 2.25 SEQ ID NO. 1361 SEQ ID NO. 1362 SEQ ID NO. 1363 SEQ ID NO. 1364 2.26 SEQ ID NO. 1365 SEQ ID NO. 1366 SEQ ID NO. 1367 SEQ ID NO. 1368 2.27 SEQ ID NO. 1369 SEQ ID NO. 1370 SEQ ID NO. 1371 SEQ ID NO. 1372 2.28 SEQ ID NO. 1373 SEQ ID NO. 1374 SEQ ID NO. 1375 SEQ ID NO. 1376 2.29 SEQ ID NO. 1377 SEQ ID NO. 1378 SEQ ID NO. 1379 SEQ ID NO. 1380 2.30 SEQ ID NO. 1381 SEQ ID NO. 1382 SEQ ID NO. 1383 SEQ ID NO. 1384 2.31 SEQ ID NO. 1385 SEQ ID NO. 1386 SEQ ID NO. 1387 SEQ ID NO. 1388 2.32 SEQ ID NO. 1389 SEQ ID NO. 1390 SEQ ID NO. 1391 SEQ ID NO. 1392 2.33 SEQ ID NO. 1393 SEQ ID NO. 1394 SEQ ID NO. 1395 SEQ ID NO. 1396 2.34 SEQ ID NO. 1397 SEQ ID NO. 1398 SEQ ID NO. 1399 SEQ ID NO. 1400 2.35 SEQ ID NO. 1401 SEQ ID NO. 1402 SEQ ID NO. 1403 SEQ ID NO. 1404 2.36 SEQ ID NO. 1405 SEQ ID NO. 1406 SEQ ID NO. 1407 SEQ ID NO. 1408 2.37 SEQ ID NO. 1409 SEQ ID NO. 1410 SEQ ID NO. 1411 SEQ ID NO. 1412 2.38 SEQ ID NO. 1413 SEQ ID NO. 1414 SEQ ID NO. 1415 SEQ ID NO. 1416 2.39 SEQ ID NO. 1417 SEQ ID NO. 1418 SEQ ID NO. 1419 SEQ ID NO. 1420 2.40 SEQ ID NO. 1421 SEQ ID NO. 1422 SEQ ID NO. 1423 SEQ ID NO. 1424 2.41 SEQ ID NO. 1425 SEQ ID NO. 1426 SEQ ID NO. 1427 SEQ ID NO. 1428 2.42 SEQ ID NO. 1429 SEQ ID NO. 1430 SEQ ID NO. 1431 SEQ ID NO. 1432 2.43 SEQ ID NO. 1433 SEQ ID NO. 1434 SEQ ID NO. 1435 SEQ ID NO. 1436 2.44 SEQ ID NO. 1437 SEQ ID NO. 1438 SEQ ID NO. 1439 SEQ ID NO. 1440 2.45 SEQ ID NO. 1441 SEQ ID NO. 1442 SEQ ID NO. 1443 SEQ ID NO. 1444 2.46 SEQ ID NO. 1445 SEQ ID NO. 1446 SEQ ID NO. 1447 SEQ ID NO. 1448 2.47 SEQ ID NO. 1449 SEQ ID NO. 1450 SEQ ID NO. 1451 SEQ ID NO. 1452 2.48 SEQ ID NO. 1453 SEQ ID NO. 1454 SEQ ID NO. 1455 SEQ ID NO. 1456 2.49 SEQ ID NO. 1457 SEQ ID NO. 1458 SEQ ID NO. 1459 SEQ ID NO. 1460 2.50 SEQ ID NO. 1461 SEQ ID NO. 1462 SEQ ID NO. 1463 SEQ ID NO. 1464 2.51 SEQ ID NO. 1465 SEQ ID NO. 1466 SEQ ID NO. 1467 SEQ ID NO. 1468 2.52 SEQ ID NO. 1469 SEQ ID NO. 1470 SEQ ID NO. 1471 SEQ ID NO. 1472 2.53 SEQ ID NO. 1473 SEQ ID NO. 1474 SEQ ID NO. 1475 SEQ ID NO. 1476 2.54 SEQ ID NO. 1477 SEQ ID NO. 1478 SEQ ID NO. 1479 SEQ ID NO. 1480 2.55 SEQ ID NO. 1481 SEQ ID NO. 1482 SEQ ID NO. 1483 SEQ ID NO. 1484 2.56 SEQ ID NO. 1485 SEQ ID NO. 1486 SEQ ID NO. 1487 SEQ ID NO. 1488 2.57 SEQ ID NO. 1489 SEQ ID NO. 1490 SEQ ID NO. 1491 SEQ ID NO. 1492 2.58 SEQ ID NO. 1493 SEQ ID NO. 1494 SEQ ID NO. 1495 SEQ ID NO. 1496 2.59 SEQ ID NO. 1497 SEQ ID NO. 1498 SEQ ID NO. 1499 SEQ ID NO. 1500 2.60 SEQ ID NO. 1501 SEQ ID NO. 1502 SEQ ID NO. 1503 SEQ ID NO. 1504 2.61 SEQ ID NO. 1505 SEQ ID NO. 1506 SEQ ID NO. 1507 SEQ ID NO. 1508 2.62 SEQ ID NO. 1509 SEQ ID NO. 1510 SEQ ID NO. 1511 SEQ ID NO. 1512 2.63 SEQ ID NO. 1513 SEQ ID NO. 1514 SEQ ID NO. 1515 SEQ ID NO. 1516 2.64 SEQ ID NO. 1517 SEQ ID NO. 1518 SEQ ID NO. 1519 SEQ ID NO. 1520 2.65 SEQ ID NO. 1521 SEQ ID NO. 1522 SEQ ID NO. 1523 SEQ ID NO. 1524 2.66 SEQ ID NO. 1525 SEQ ID NO. 1526 SEQ ID NO. 1527 SEQ ID NO. 1528 2.67 SEQ ID NO. 1529 SEQ ID NO. 1530 SEQ ID NO. 1531 SEQ ID NO. 1532 2.68 SEQ ID NO. 1533 SEQ ID NO. 1534 SEQ ID NO. 1535 SEQ ID NO. 1536 2.69 SEQ ID NO. 1537 SEQ ID NO. 1538 SEQ ID NO. 1539 SEQ ID NO. 1540 2.70 SEQ ID NO. 1541 SEQ ID NO. 1542 SEQ ID NO. 1543 SEQ ID NO. 1544 2.71 SEQ ID NO. 1545 SEQ ID NO. 1546 SEQ ID NO. 1547 SEQ ID NO. 1548 2.72 SEQ ID NO. 1549 SEQ ID NO. 1550 SEQ ID NO. 1551 SEQ ID NO. 1552 2.73 SEQ ID NO. 1553 SEQ ID NO. 1554 SEQ ID NO. 1555 SEQ ID NO. 1556 2.74 SEQ ID NO. 1557 SEQ ID NO. 1558 SEQ ID NO. 1559 SEQ ID NO. 1560 2.75 SEQ ID NO. 1561 SEQ ID NO. 1562 SEQ ID NO. 1563 SEQ ID NO. 1564 2.76 SEQ ID NO. 1565 SEQ ID NO. 1566 SEQ ID NO. 1567 SEQ ID NO. 1568 2.77 SEQ ID NO. 1569 SEQ ID NO. 1570 SEQ ID NO. 1571 SEQ ID NO. 1572 2.78 SEQ ID NO. 1573 SEQ ID NO. 1574 SEQ ID NO. 1575 SEQ ID NO. 1576 2.79 SEQ ID NO. 1577 SEQ ID NO. 1578 SEQ ID NO. 1579 SEQ ID NO. 1580 2.80 SEQ ID NO. 1581 SEQ ID NO. 1582 SEQ ID NO. 1583 SEQ ID NO. 1584 2.81 SEQ ID NO. 1585 SEQ ID NO. 1586 SEQ ID NO. 1587 SEQ ID NO. 1588 2.82 SEQ ID NO. 1589 SEQ ID NO. 1590 SEQ ID NO. 1591 SEQ ID NO. 1592 2.83 SEQ ID NO. 1593 SEQ ID NO. 1594 SEQ ID NO. 1595 SEQ ID NO. 1596 2.84 SEQ ID NO. 1597 SEQ ID NO. 1598 SEQ ID NO. 1599 SEQ ID NO. 1600 2.85 SEQ ID NO. 1601 SEQ ID NO. 1602 SEQ ID NO. 1603 SEQ ID NO. 1604 2.86 SEQ ID NO. 1605 SEQ ID NO. 1606 SEQ ID NO. 1607 SEQ ID NO. 1608 2.87 SEQ ID NO. 1609 SEQ ID NO. 1610 SEQ ID NO. 1611 SEQ ID NO. 1612 2.88 SEQ ID NO. 1613 SEQ ID NO. 1614 SEQ ID NO. 1615 SEQ ID NO. 1616 2.89 SEQ ID NO. 1617 SEQ ID NO. 1618 SEQ ID NO. 1619 SEQ ID NO. 1620 2.90 SEQ ID NO. 1621 SEQ ID NO. 1622 SEQ ID NO. 1623 SEQ ID NO. 1624 2.91 SEQ ID NO. 1625 SEQ ID NO. 1626 SEQ ID NO. 1627 SEQ ID NO. 1628 2.92 SEQ ID NO. 1629 SEQ ID NO. 1630 SEQ ID NO. 1631 SEQ ID NO. 1632 2.93 SEQ ID NO. 1633 SEQ ID NO. 1634 SEQ ID NO. 1635 SEQ ID NO. 1636 2.94 SEQ ID NO. 1637 SEQ ID NO. 1638 SEQ ID NO. 1639 SEQ ID NO. 1640 2.95 SEQ ID NO. 1641 SEQ ID NO. 1642 SEQ ID NO. 1643 SEQ ID NO. 1644 2.96 SEQ ID NO. 1645 SEQ ID NO. 1646 SEQ ID NO. 1647 SEQ ID NO. 1648 2.97 SEQ ID NO. 1649 SEQ ID NO. 1650 SEQ ID NO. 1651 SEQ ID NO. 1652 2.98 SEQ ID NO. 1653 SEQ ID NO. 1654 SEQ ID NO. 1655 SEQ ID NO. 1656 2.99 SEQ ID NO. 1657 SEQ ID NO. 1658 SEQ ID NO. 1659 SEQ ID NO. 1660 2.100 SEQ ID NO. 1661 SEQ ID NO. 1662 SEQ ID NO. 1663 SEQ ID NO. 1664 2.101 SEQ ID NO. 1665 SEQ ID NO. 1666 SEQ ID NO. 1667 SEQ ID NO. 1668 2.102 SEQ ID NO. 1669 SEQ ID NO. 1670 SEQ ID NO. 1671 SEQ ID NO. 1672 2.103 SEQ ID NO. 1673 SEQ ID NO. 1674 SEQ ID NO. 1675 SEQ ID NO. 1676 2.104 SEQ ID NO. 1677 SEQ ID NO. 1678 SEQ ID NO. 1679 SEQ ID NO. 1680 2.105 SEQ ID NO. 1681 SEQ ID NO. 1682 SEQ ID NO. 1683 SEQ ID NO. 1684 2.106 SEQ ID NO. 1685 SEQ ID NO. 1686 SEQ ID NO. 1687 SEQ ID NO. 1688 2.107 SEQ ID NO. 1689 SEQ ID NO. 1690 SEQ ID NO. 1691 SEQ ID NO. 1692 2.108 SEQ ID NO. 1693 SEQ ID NO. 1694 SEQ ID NO. 1695 SEQ ID NO. 1696 2.109 SEQ ID NO. 1697 SEQ ID NO. 1698 SEQ ID NO. 1699 SEQ ID NO. 1700 2.110 SEQ ID NO. 1701 SEQ ID NO. 1702 SEQ ID NO. 1703 SEQ ID NO. 1704 2.111 SEQ ID NO. 1705 SEQ ID NO. 1706 SEQ ID NO. 1707 SEQ ID NO. 1708 2.112 SEQ ID NO. 1709 SEQ ID NO. 1710 SEQ ID NO. 1711 SEQ ID NO. 1712 2.113 SEQ ID NO. 1713 SEQ ID NO. 1714 SEQ ID NO. 1715 SEQ ID NO. 1716 2.114 SEQ ID NO. 1717 SEQ ID NO. 1718 SEQ ID NO. 1719 SEQ ID NO. 1720 2.115 SEQ ID NO. 1721 SEQ ID NO. 1722 SEQ ID NO. 1723 SEQ ID NO. 1724 2.116 SEQ ID NO. 1725 SEQ ID NO. 1726 SEQ ID NO. 1727 SEQ ID NO. 1728 2.117 SEQ ID NO. 1729 SEQ ID NO. 1730 SEQ ID NO. 1731 SEQ ID NO. 1732 2.118 SEQ ID NO. 1733 SEQ ID NO. 1734 SEQ ID NO. 1735 SEQ ID NO. 1736 2.119 SEQ ID NO. 1737 SEQ ID NO. 1738 SEQ ID NO. 1739 SEQ ID NO. 1740 2.120 SEQ ID NO. 1741 SEQ ID NO. 1742 SEQ ID NO. 1743 SEQ ID NO. 1744 2.121 SEQ ID NO. 1745 SEQ ID NO. 1746 SEQ ID NO. 1747 SEQ ID NO. 1748 2.122 SEQ ID NO. 1749 SEQ ID NO. 1750 SEQ ID NO. 1751 SEQ ID NO. 1752 2.123 SEQ ID NO. 1753 SEQ ID NO. 1754 SEQ ID NO. 1755 SEQ ID NO. 1756 2.124 SEQ ID NO. 1757 SEQ ID NO. 1758 SEQ ID NO. 1759 SEQ ID NO. 1760 2.125 SEQ ID NO. 1761 SEQ ID NO. 1762 SEQ ID NO. 1763 SEQ ID NO. 1764
[0110] In one aspect, the invention relates to a family 2 or family 2-like binding molecule comprises a human V.sub.H domain comprising a CDR3 sequence comprising SEQ ID NO. 1237 or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology to SEQ ID NO. 1237.
[0111] In one embodiment, the family 2 or family 2-like binding molecule comprises at least one immunoglobulin single domain antibody directed against IL-17RA wherein said domain is a human V.sub.H domain and wherein said V.sub.H comprises at least one antigen binding site comprising a CDR3 sequence having SEQ ID NO. 1267 or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto. In one embodiment, sequence homology is at least 90%.
[0112] In one embodiment, the CDR3 sequence is selected from one of the CDR3 sequences as shown in table 2 with reference to
[0113] In one embodiment, the family 2 or family 2-like sequence comprises at least one antigen binding site comprising hypervariable regions CDR1, CDR2 and CDR3, said CDR1 comprises or consists of the amino acid sequence SEQ ID NO. 1265 or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto, said CDR2 comprises or consists of the amino acid sequence SEQ ID NO. 1266 or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto, and said CDR3 comprises or consists of the amino acid sequence SEQ ID NO. 1267 or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto. For example, the CDR sequence may be a CDR sequence selected from those shown in
[0114] In one embodiment, said CDR1 comprises or consists of the amino acid sequence SEQ ID NO. 1265 or a sequence with at least 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto. In one embodiment, said CDR2 comprises or consists of the amino acid sequence SEQ ID NO. 1266 or a sequence with at least 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto. In one embodiment, said CDR3 comprises or consists of the amino acid sequence SEQ ID NO. 1267 or a sequence with at least 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto.
[0115] In one embodiment, CDR1 comprises or consists of one of the CDR1 amino acid sequence listed above in table 2 with reference to
[0116] In one embodiment, the binding molecule comprises a set of CDR1, CDR2 and CDR3 sequences of a V.sub.H sequence as shown for clones 2.1 to 2.125 in
[0117] Thus, in one embodiment, CDR1 is SEQ ID NO. 1269, CDR2 is SEQ ID NO. 1270 and CDR3 is SEQ ID NO. 1271. In another embodiment, CDR1 is SEQ ID NO. 1272, CDR2 is SEQ ID NO. 1273 and CDR3 is SEQ ID NO. 1274.
[0118] In one embodiment, the family 2 or family 2-like binding molecule has a V.sub.H domain that comprises or consists of SEQ ID NO. 1268 or a sequence with at least 40%, 50%, 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto. CDR sequences of such sequences are shown in
[0119] Thus, the V.sub.H domain comprises or consists of a sequence selected from SEQ ID NOs. 1268, 1272, 1276, 1280, 1284, 1288, 1292, 1296, 1300, 1304, 1308, 1312, 1316, 1320 1324, 1328, 1332, 1336, 1340, 1344, 1348, 1352, 1356, 1360, 1364, 1368, 1372, 1376 1380, 1384, 1388, 1392, 1396, 1400, 1404, 1408, 1412, 1416, 1420, 1424, 1428, 1432, 1436, 1440, 1444, 1448, 1452, 1456, 1460, 1464, 1468, 1476, 1480, 1484, 1488, 1492, 1496, 1500, 1504, 1508, 1512, 1516, 1520, 1524, 1528, 1532, 1536, 1540, 1544, 1548, 1552, 1556, 1560, 1564, 1568, 1572, 1576, 1580, 1584, 1588, 1592, 1596, 1600, 1604, 1608, 1612, 1616, 1620, 1624, 1628, 1632, 1636, 1640, 1644, 1648, 1652, 1656, 1660, 1664, 1668, 1672, 1676, 1680, 1684, 1688, 1692, 1696, 1700, 1704, 1708, 1712, 1716 1720, 1724, 1728, 1732, 1736, 1740, 1744, 1748, 1752, 1756, 1760 or 1764.
[0120] In another embodiment, the V.sub.H domain comprises a sequence selected from one of the sequences in the forgoing but comprises 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid substitutions. In one embodiment, these are in the framework region. In another embodiment, these are in the CDRs. In one embodiment, the amino acid substitutions are in the framework and CDR sequences. In one embodiment, the V.sub.H domain comprises or consists of SEQ ID NO. 1268 or a sequence which comprises one or more amino acid substitutions, for example 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid substitutions. For example, V.sub.H domain comprises or consists of a sequence selected from SEQ ID NO. 1268 or 1272.
[0121] In one embodiment, the family 2 or family 2-like binding molecule has a V.sub.H domain that comprises or consists of SEQ ID NO. 1268 or 1272, or a sequence with at least 40%, 50%, 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 96%, 97%, 98%, 99% homology thereto.
[0122] In another aspect, the invention relates to a binding molecule comprising or consisting of a V.sub.H domain as shown in SEQ ID NO. 1268 or a variant thereof comprising amino acid substitutions compared to SEQ ID NO. 1268 as follows residue 31 is T, residue 43 is R, 54 is G, E, K, A, D, residue 55 is S, residue 57 is D, Y, N and/or residue 100 is I.
[0123] The family 2 or family 2-like binding molecules have KD, Koff, KA, Kd and IC.sub.50 values as further described herein and as shown in the examples.
[0124] In one aspect, the invention relates to an isolated binding molecule capable of binding human IL-17RA comprising a human heavy chain variable immunoglobulin domain (V.sub.H) wherein said V.sub.H domain comprises a family 3 or family 3-like sequence.
[0125] In one embodiment, the binding molecule comprises or consists of at least one immunoglobulin single domain antibody directed against IL-17RA, preferably human IL-17RA, wherein said domain is a human V.sub.H domain and wherein said VH domain comprises a family 3 or family 3-like sequence. These include the V.sub.H sequence of the parent clone (clone 3.1) or a part thereof, for example a CDR3 sequence, and V.sub.H sequences of clones or that are derived from the parent clone 3.1 through a process of optimization, for example as shown in
TABLE-US-00004 TABLE 3 This shows SEQ ID NOs of family 3-like CDR sequences and of family full length V.sub.H sequences that are within the scope of the invention. Corresponding sequences are shown in FIG. 3. FULL LENGTH Clone CDR1 Seq ID No CDR2 Seq ID No CDR3 Seq ID No Seq ID No 3.1 Seq ID No 1765 Seq ID No 1766 Seq ID No 1767 Seq ID No 1768 3.2 Seq ID No 1769 Seq ID No 1770 Seq ID No 1771 Seq ID No 1772 3.3 Seq ID No 1773 Seq ID No 1774 Seq ID No 1775 Seq ID No 1776 3.4 Seq ID No 1777 Seq ID No 1778 Seq ID No 1779 Seq ID No 1780 3.5 Seq ID No 1781 Seq ID No 1782 Seq ID No 1783 Seq ID No 1784 3.6 Seq ID No 1785 Seq ID No 1786 Seq ID No 1787 Seq ID No 1788 3.7 Seq ID No 1789 Seq ID No 1790 Seq ID No 1791 Seq ID No 1792 3.8 Seq ID No 1793 Seq ID No 1794 Seq ID No 1795 Seq ID No 1796 3.9 Seq ID No 1797 Seq ID No 1798 Seq ID No 1799 Seq ID No 1800 3.10 Seq ID No 1801 Seq ID No 1802 Seq ID No 1803 Seq ID No 1804 3.11 Seq ID No 1805 Seq ID No 1806 Seq ID No 1807 Seq ID No 1808 3.12 Seq ID No 1809 Seq ID No 1810 Seq ID No 1811 Seq ID No 1812 3.13 Seq ID No 1813 Seq ID No 1814 Seq ID No 1815 Seq ID No 1816 3.14 Seq ID No 1817 Seq ID No 1818 Seq ID No 1819 Seq ID No 1820 3.15 Seq ID No 1821 Seq ID No 1822 Seq ID No 1823 Seq ID No 1824 3.16 Seq ID No 1825 Seq ID No 1826 Seq ID No 1827 Seq ID No 1828 3.17 Seq ID No 1829 Seq ID No 1830 Seq ID No 1831 Seq ID No 1832 3.18 Seq ID No 1833 Seq ID No 1834 Seq ID No 1835 Seq ID No 1836 3.19 Seq ID No 1837 Seq ID No 1838 Seq ID No 1839 Seq ID No 1840 3.20 Seq ID No 1841 Seq ID No 1842 Seq ID No 1843 Seq ID No 1844 3.21 Seq ID No 1845 Seq ID No 1846 Seq ID No 1847 Seq ID No 1848 3.22 Seq ID No 1849 Seq ID No 1850 Seq ID No 1851 Seq ID No 1852 3.23 Seq ID No 1853 Seq ID No 1854 Seq ID No 1855 Seq ID No 1856 3.24 Seq ID No 1857 Seq ID No 1858 Seq ID No 1859 Seq ID No 1860 3.25 Seq ID No 1861 Seq ID No 1862 Seq ID No 1863 Seq ID No 1864 3.26 Seq ID No 1865 Seq ID No 1866 Seq ID No 1867 Seq ID No 1868 3.27 Seq ID No 1869 Seq ID No 1870 Seq ID No 1871 Seq ID No 1872 3.28 Seq ID No 1873 Seq ID No 1874 Seq ID No 1875 Seq ID No 1876 3.29 Seq ID No 1877 Seq ID No 1878 Seq ID No 1879 Seq ID No 1880 3.30 Seq ID No 1881 Seq ID No 1882 Seq ID No 1883 Seq ID No 1884 3.31 Seq ID No 1885 Seq ID No 1886 Seq ID No 1887 Seq ID No 1888 3.32 Seq ID No 1889 Seq ID No 1890 Seq ID No 1891 Seq ID No 1892 3.33 Seq ID No 1893 Seq ID No 1894 Seq ID No 1895 Seq ID No 1896 3.34 Seq ID No 1897 Seq ID No 1898 Seq ID No 1899 Seq ID No 1900 3.35 Seq ID No 1901 Seq ID No 1902 Seq ID No 1903 Seq ID No 1904 3.36 Seq ID No 1905 Seq ID No 1906 Seq ID No 1907 Seq ID No 1908 3.37 Seq ID No 1909 Seq ID No 1910 Seq ID No 1911 Seq ID No 1912 3.38 Seq ID No 1913 Seq ID No 1914 Seq ID No 1915 Seq ID No 1916 3.39 Seq ID No 1917 Seq ID No 1918 Seq ID No 1919 Seq ID No 1920 3.40 Seq ID No 1921 Seq ID No 1922 Seq ID No 1923 Seq ID No 1924 3.41 Seq ID No 1925 Seq ID No 1926 Seq ID No 1927 Seq ID No 1928 3.42 Seq ID No 1929 Seq ID No 1930 Seq ID No 1931 Seq ID No 1932 3.43 Seq ID No 1933 Seq ID No 1934 Seq ID No 1935 Seq ID No 1936 3.44 Seq ID No 1937 Seq ID No 1938 Seq ID No 1939 Seq ID No 1940 3.45 Seq ID No 1941 Seq ID No 1942 Seq ID No 1943 Seq ID No 1944 3.46 Seq ID No 1945 Seq ID No 1946 Seq ID No 1947 Seq ID No 1948 3.47 Seq ID No 1949 Seq ID No 1950 Seq ID No 1951 Seq ID No 1952 3.48 Seq ID No 1953 Seq ID No 1954 Seq ID No 1955 Seq ID No 1956 3.49 Seq ID No 1957 Seq ID No 1958 Seq ID No 1959 Seq ID No 1960 3.50 Seq ID No 1961 Seq ID No 1962 Seq ID No 1963 Seq ID No 1964 3.51 Seq ID No 1965 Seq ID No 1966 Seq ID No 1967 Seq ID No 1968 3.52 Seq ID No 1969 Seq ID No 1970 Seq ID No 1971 Seq ID No 1972 3.53 Seq ID No 1973 Seq ID No 1974 Seq ID No 1975 Seq ID No 1976 3.54 Seq ID No 1977 Seq ID No 1978 Seq ID No 1979 Seq ID No 1980 3.55 Seq ID No 1981 Seq ID No 1982 Seq ID No 1983 Seq ID No 1984 3.56 Seq ID No 1985 Seq ID No 1986 Seq ID No 1987 Seq ID No 1988 3.57 Seq ID No 1989 Seq ID No 1990 Seq ID No 1991 Seq ID No 1992 3.58 Seq ID No 1993 Seq ID No 1994 Seq ID No 1995 Seq ID No 1996 3.59 Seq ID No 1997 Seq ID No 1998 Seq ID No 1999 Seq ID No 2000 3.60 Seq ID No 2001 Seq ID No 2002 Seq ID No 2003 Seq ID No 2004 3.61 Seq ID No 2005 Seq ID No 2006 Seq ID No 2007 Seq ID No 2008 3.62 Seq ID No 2009 Seq ID No 2010 Seq ID No 2011 Seq ID No 2012 3.63 Seq ID No 2013 Seq ID No 2014 Seq ID No 2015 Seq ID No 2016 3.64 Seq ID No 2017 Seq ID No 2018 Seq ID No 2019 Seq ID No 2020 3.65 Seq ID No 2021 Seq ID No 2022 Seq ID No 2023 Seq ID No 2024 3.66 Seq ID No 2025 Seq ID No 2026 Seq ID No 2027 Seq ID No 2028 3.67 Seq ID No 2029 Seq ID No 2030 Seq ID No 2031 Seq ID No 2032 3.68 Seq ID No 2033 Seq ID No 2034 Seq ID No 2035 Seq ID No 2036 3.69 Seq ID No 2037 Seq ID No 2038 Seq ID No 2039 Seq ID No 2040 3.70 Seq ID No 2041 Seq ID No 2042 Seq ID No 2043 Seq ID No 2044 3.71 Seq ID No 2045 Seq ID No 2046 Seq ID No 2047 Seq ID No 2048 3.72 Seq ID No 2049 Seq ID No 2050 Seq ID No 2051 Seq ID No 2052 3.73 Seq ID No 2053 Seq ID No 2054 Seq ID No 2055 Seq ID No 2056 3.74 Seq ID No 2057 Seq ID No 2058 Seq ID No 2059 Seq ID No 2060 3.75 Seq ID No 2061 Seq ID No 2062 Seq ID No 2063 Seq ID No 2064 3.76 Seq ID No 2065 Seq ID No 2066 Seq ID No 2067 Seq ID No 2068 3.77 Seq ID No 2069 Seq ID No 2070 Seq ID No 2071 Seq ID No 2072 3.78 Seq ID No 2073 Seq ID No 2074 Seq ID No 2075 Seq ID No 2076 3.79 Seq ID No 2077 Seq ID No 2078 Seq ID No 2079 Seq ID No 2080 3.80 Seq ID No 2081 Seq ID No 2082 Seq ID No 2083 Seq ID No 2084 3.81 Seq ID No 2085 Seq ID No 2086 Seq ID No 2087 Seq ID No 2088 3.82 Seq ID No 2089 Seq ID No 2090 Seq ID No 2091 Seq ID No 2092 3.83 Seq ID No 2093 Seq ID No 2094 Seq ID No 2095 Seq ID No 2096 3.84 Seq ID No 2097 Seq ID No 2098 Seq ID No 2099 Seq ID No 2100 3.85 Seq ID No 2101 Seq ID No 2102 Seq ID No 2103 Seq ID No 2104 3.86 Seq ID No 2105 Seq ID No 2106 Seq ID No 2107 Seq ID No 2108 3.87 Seq ID No 2109 Seq ID No 2110 Seq ID No 2111 Seq ID No 2112 3.88 Seq ID No 2113 Seq ID No 2114 Seq ID No 2115 Seq ID No 2116 3.89 Seq ID No 2117 Seq ID No 2118 Seq ID No 2119 Seq ID No 2120 3.90 Seq ID No 2121 Seq ID No 2122 Seq ID No 2123 Seq ID No 2124 3.91 Seq ID No 2125 Seq ID No 2126 Seq ID No 2127 Seq ID No 2128
[0126] In one aspect, the invention relates to a family 3-like binding molecule comprises a human V.sub.H domain comprising a CDR3 sequence comprising SEQ ID NO. 1767 or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto.
[0127] In one embodiment, the family 3 or family 3-like binding molecule comprises at least one immunoglobulin single domain antibody directed against IL-17RA wherein said domain is a human V.sub.H domain and wherein said V.sub.H comprises at least one antigen binding site comprising a CDR3 sequence having SEQ ID NO. 1767 or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto. In one embodiment, sequence homology is at least 90%.
[0128] In one embodiment, the CDR3 sequence is selected from one of the CDR3 sequences as shown in table 3 with reference to
[0129] In one embodiment, the family 3-like sequence comprises at least one antigen binding site comprising hypervariable regions CDR1, CDR2 and CDR3, said CDR1 comprises or consists of the amino acid sequence SEQ ID NO. 1765 or a sequence with at least at least 70%, at least 80%, at least 90%, at least 95% homology thereto, said CDR2 comprises or consists of the amino acid sequence SEQ ID NO. 1766 or a sequence with at least 70%, at least 80%, at least 90%, at least 95% homology thereto, and said CDR3 comprises or consists of the amino acid sequence SEQ ID NO. 1767 or a sequence with at least 70%, at least 80%, at least 90%, at least 95% homology thereto. For example, the CDR sequence may be a sequence selected from those shown in
[0130] In one embodiment, said CDR1 comprises or consists of the amino acid sequence as shown in SEQ ID NO. 1765 or a sequence with at least 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto. In one embodiment, said CDR2 comprises or consists of the amino acid sequence as shown in SEQ ID NO. 1766 or a sequence with at least 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto. In one embodiment, said CDR3 comprises or consists of the amino acid sequence as shown in SEQ ID NO. 1767 or a sequence with at least 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto.
[0131] In one embodiment, CDR1 comprises or consists of one of the CDR1 amino acid sequence listed above in table 3 with reference to
[0132] In one embodiment, the binding molecule comprises a set of CDR1, CDR2 and CDR3 sequences of a V.sub.H sequence as shown for clones 3.1 to 3.91 in
[0133] In one embodiment, CDR1 is SEQ ID NO. 1765, CDR2 is SEQ ID No. 1766 and CDR3 is SEQ ID NO. 1767.
[0134] In one embodiment, the family 3 or family 3-like binding molecule has a V.sub.H domain that comprises or consists of SEQ ID NO. 1768 or a sequence with at least 40%, 50%, 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto. CDR sequences of such sequences are shown in
[0135] In another embodiment, the V.sub.H domain comprises a sequence selected from one of the sequences in the forgoing but comprises 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid substitutions. In one embodiment, these are in the framework region. In another embodiment, these are in the CDRs. In one embodiment, the amino acid substitutions are in the framework and CDR sequences. In one embodiment, the V.sub.H domain comprises or consists of SEQ ID NO. 1767 or a sequence which comprises one or more amino acid substitutions, for example 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid substitutions.
[0136] In another aspect, the invention relates to a binding molecule comprising or consisting of a V.sub.H domain as shown in SEQ ID NO. 1768 or a variant thereof comprising amino acid substitutions compared to SEQ ID NO. 1768 as follows: residue 1 is Q, residue 31 is S, residue 36 is S, T, residue 51 is M, residue 52 is K, residue 53 is H, E, residue 59 is Q, N, residue 99 is A, residue 100 is W, residue 101 is S, residue 102 is G and/or residue 106 is D.
[0137] The family 3 or family 3-like binding molecules have KD, Koff, KA, Kd and IC.sub.50 values as further described herein and as shown in the examples.
[0138] In one aspect, the invention relates to a binding molecule capable of binding human IL-17RA comprising a human V.sub.H domain wherein said V.sub.H domain comprises a family 4 or family 4-like sequence.
[0139] In one embodiment, the binding molecule comprises or consists of at least one immunoglobulin single domain antibody directed against IL-17RA, preferably human IL-17RA, wherein said domain is a human V.sub.H domain and wherein said V.sub.H domain comprises a family 4 or family 4-like sequence. These include the V.sub.H sequence of the parent clone (clone 4.1; Seq ID No 2132) or a part thereof, for example a CDR3 sequence, and V.sub.H sequences of clones or parts thereof that are derived from the parent clone 4.1 through a process of optimization, for example as shown in
TABLE-US-00005 TABLE 4 Family 4 CDR sequences and V.sub.H sequences that are within the scope of the invention. Corresponding sequences are shown in FIG. 4. CLONE CDR1 CDR2 CDR3 FULL LENGTH 4.1 Seq ID No 2129 Seq ID No 2130 Seq ID No 2131 Seq ID No 2132 4.2 Seq ID No 2133 Seq ID No 2134 Seq ID No 2135 Seq ID No 2136 4.3 Seq ID No 2137 Seq ID No 2138 Seq ID No 2139 Seq ID No 2140 4.4 Seq ID No 2141 Seq ID No 2142 Seq ID No 2143 Seq ID No 2144 4.5 Seq ID No 2145 Seq ID No 2146 Seq ID No 2147 Seq ID No 2148 4.6 Seq ID No 2149 Seq ID No 2150 Seq ID No 2151 Seq ID No 2152 4.7 Seq ID No 2153 Seq ID No 2154 Seq ID No 2155 Seq ID No 2156 4.8 Seq ID No 2157 Seq ID No 2158 Seq ID No 2159 Seq ID No 2160 4.9 Seq ID No 2161 Seq ID No 2162 Seq ID No 2163 Seq ID No 2164 4.10 Seq ID No 2165 Seq ID No 2166 Seq ID No 2167 Seq ID No 2168 4.11 Seq ID No 2169 Seq ID No 2170 Seq ID No 2171 Seq ID No 2172 4.12 Seq ID No 2173 Seq ID No 2174 Seq ID No 2175 Seq ID No 2176 4.13 Seq ID No 2177 Seq ID No 2178 Seq ID No 2179 Seq ID No 2180 4.14 Seq ID No 2181 Seq ID No 2182 Seq ID No 2183 Seq ID No 2184 4.15 Seq ID No 2185 Seq ID No 2186 Seq ID No 2187 Seq ID No 2188 4.16 Seq ID No 2189 Seq ID No 2190 Seq ID No 2191 Seq ID No 2192 4.17 Seq ID No 2193 Seq ID No 2194 Seq ID No 2195 Seq ID No 2196 4.18 Seq ID No 2197 Seq ID No 2198 Seq ID No 2199 Seq ID No 2200 4.19 Seq ID No 2201 Seq ID No 2202 Seq ID No 2203 Seq ID No 2204 4.20 Seq ID No 2205 Seq ID No 2206 Seq ID No 2207 Seq ID No 2208 4.21 Seq ID No 2209 Seq ID No 2210 Seq ID No 2211 Seq ID No 2212 4.22 Seq ID No 2213 Seq ID No 2214 Seq ID No 2215 Seq ID No 2216 4.23 Seq ID No 2217 Seq ID No 2218 Seq ID No 2219 Seq ID No 2220 4.24 Seq ID No 2221 Seq ID No 2222 Seq ID No 2223 Seq ID No 2224 4.25 Seq ID No 2225 Seq ID No 2226 Seq ID No 2227 Seq ID No 2228 4.26 Seq ID No 2229 Seq ID No 2230 Seq ID No 2231 Seq ID No 2232 4.27 Seq ID No 2233 Seq ID No 2234 Seq ID No 2235 Seq ID No 2236 4.28 Seq ID No 2237 Seq ID No 2238 Seq ID No 2239 Seq ID No 2240 4.29 Seq ID No 2241 Seq ID No 2242 Seq ID No 2243 Seq ID No 2244 4.30 Seq ID No 2245 Seq ID No 2246 Seq ID No 2247 Seq ID No 2248 4.31 Seq ID No 2249 Seq ID No 2250 Seq ID No 2251 Seq ID No 2252 4.32 Seq ID No 2253 Seq ID No 2254 Seq ID No 2255 Seq ID No 2256 4.33 Seq ID No 2257 Seq ID No 2258 Seq ID No 2259 Seq ID No 2260 4.34 Seq ID No 2261 Seq ID No 2262 Seq ID No 2263 Seq ID No 2264 4.35 Seq ID No 2265 Seq ID No 2266 Seq ID No 2267 Seq ID No 2268 4.36 Seq ID No 2269 Seq ID No 2270 Seq ID No 2271 Seq ID No 2272 4.37 Seq ID No 2273 Seq ID No 2274 Seq ID No 2275 Seq ID No 2276 4.38 Seq ID No 2277 Seq ID No 2278 Seq ID No 2279 Seq ID No 2280 4.39 Seq ID No 2281 Seq ID No 2282 Seq ID No 2283 Seq ID No 2284 4.40 Seq ID No 2285 Seq ID No 2286 Seq ID No 2287 Seq ID No 2288 4.41 Seq ID No 2289 Seq ID No 2290 Seq ID No 2291 Seq ID No 2292 4.42 Seq ID No 2293 Seq ID No 2294 Seq ID No 2295 Seq ID No 2296 4.43 Seq ID No 2297 Seq ID No 2298 Seq ID No 2299 Seq ID No 2300 4.44 Seq ID No 2301 Seq ID No 2302 Seq ID No 2303 Seq ID No 2304 4.45 Seq ID No 2305 Seq ID No 2306 Seq ID No 2307 Seq ID No 2308 4.46 Seq ID No 2309 Seq ID No 2310 Seq ID No 2311 Seq ID No 2312 4.47 Seq ID No 2313 Seq ID No 2314 Seq ID No 2315 Seq ID No 2316 4.48 Seq ID No 2317 Seq ID No 2318 Seq ID No 2319 Seq ID No 2320 4.49 Seq ID No 2321 Seq ID No 2322 Seq ID No 2323 Seq ID No 2324 4.50 Seq ID No 2325 Seq ID No 2326 Seq ID No 2327 Seq ID No 2328 4.51 Seq ID No 2329 Seq ID No 2330 Seq ID No 2331 Seq ID No 2332 4.52 Seq ID No 2333 Seq ID No 2334 Seq ID No 2335 Seq ID No 2336 4.53 Seq ID No 2337 Seq ID No 2338 Seq ID No 2339 Seq ID No 2340 4.54 Seq ID No 2341 Seq ID No 2342 Seq ID No 2343 Seq ID No 2344 4.55 Seq ID No 2345 Seq ID No 2346 Seq ID No 2347 Seq ID No 2348 4.56 Seq ID No 2349 Seq ID No 2350 Seq ID No 2351 Seq ID No 2352 4.57 Seq ID No 2353 Seq ID No 2354 Seq ID No 2355 Seq ID No 2356 4.58 Seq ID No 2357 Seq ID No 2358 Seq ID No 2359 Seq ID No 2360 4.59 Seq ID No 2361 Seq ID No 2362 Seq ID No 2363 Seq ID No 2364 4.60 Seq ID No 2365 Seq ID No 2366 Seq ID No 2367 Seq ID No 2368 4.61 Seq ID No 2369 Seq ID No 2370 Seq ID No 2371 Seq ID No 2372 4.62 Seq ID No 2373 Seq ID No 2374 Seq ID No 2375 Seq ID No 2376 4.63 Seq ID No 2377 Seq ID No 2378 Seq ID No 2379 Seq ID No 2380 4.64 Seq ID No 2381 Seq ID No 2382 Seq ID No 2383 Seq ID No 2384 4.65 Seq ID No 2385 Seq ID No 2386 Seq ID No 2387 Seq ID No 2388 4.66 Seq ID No 2389 Seq ID No 2390 Seq ID No 2391 Seq ID No 2392 4.67 Seq ID No 2393 Seq ID No 2394 Seq ID No 2395 Seq ID No 2396 4.68 Seq ID No 2397 Seq ID No 2398 Seq ID No 2399 Seq ID No 2400 4.69 Seq ID No 2401 Seq ID No 2402 Seq ID No 2403 Seq ID No 2404 4.70 Seq ID No 2405 Seq ID No 2406 Seq ID No 2407 Seq ID No 2408 4.71 Seq ID No 2409 Seq ID No 2410 Seq ID No 2411 Seq ID No 2412 4.72 Seq ID No 2413 Seq ID No 2414 Seq ID No 2415 Seq ID No 2416 4.73 Seq ID No 2417 Seq ID No 2418 Seq ID No 2419 Seq ID No 2420 4.74 Seq ID No 2421 Seq ID No 2422 Seq ID No 2423 Seq ID No 2424 4.75 Seq ID No 2425 Seq ID No 2426 Seq ID No 2427 Seq ID No 2428 4.76 Seq ID No 2429 Seq ID No 2430 Seq ID No 2431 Seq ID No 2432 4.77 Seq ID No 2433 Seq ID No 2434 Seq ID No 2435 Seq ID No 2436 4.78 Seq ID No 2437 Seq ID No 2438 Seq ID No 2439 Seq ID No 2440 4.79 Seq ID No 2441 Seq ID No 2442 Seq ID No 2443 Seq ID No 2444 4.80 Seq ID No 2445 Seq ID No 2446 Seq ID No 2447 Seq ID No 2448 4.81 Seq ID No 2449 Seq ID No 2450 Seq ID No 2451 Seq ID No 2452 4.82 Seq ID No 2453 Seq ID No 2454 Seq ID No 2455 Seq ID No 2456 4.83 Seq ID No 2457 Seq ID No 2458 Seq ID No 2459 Seq ID No 2460 4.84 Seq ID No 2461 Seq ID No 2462 Seq ID No 2463 Seq ID No 2464 4.85 Seq ID No 2465 Seq ID No 2466 Seq ID No 2467 Seq ID No 2468 4.86 Seq ID No 2469 Seq ID No 2470 Seq ID No 2471 Seq ID No 2472 4.87 Seq ID No 2473 Seq ID No 2474 Seq ID No 2475 Seq ID No 2476 4.88 Seq ID No 2477 Seq ID No 2478 Seq ID No 2479 Seq ID No 2480 4.89 Seq ID No 2481 Seq ID No 2482 Seq ID No 2483 Seq ID No 2484 4.90 Seq ID No 2485 Seq ID No 2486 Seq ID No 2487 Seq ID No 2488 4.91 Seq ID No 2489 Seq ID No 2490 Seq ID No 2491 Seq ID No 2492 4.92 Seq ID No 2493 Seq ID No 2494 Seq ID No 2495 Seq ID No 2496 4.93 Seq ID No 2497 Seq ID No 2498 Seq ID No 2499 Seq ID No 2500 4.94 Seq ID No 2501 Seq ID No 2502 Seq ID No 2503 Seq ID No 2504 4.95 Seq ID No 2505 Seq ID No 2506 Seq ID No 2507 Seq ID No 2508 4.96 Seq ID No 2509 Seq ID No 2510 Seq ID No 2511 Seq ID No 2512 4.97 Seq ID No 2513 Seq ID No 2514 Seq ID No 2515 Seq ID No 2516 4.98 Seq ID No 2517 Seq ID No 2518 Seq ID No 2519 Seq ID No 2520 4.99 Seq ID No 2521 Seq ID No 2522 Seq ID No 2523 Seq ID No 2524 4.100 Seq ID No 2525 Seq ID No 2526 Seq ID No 2527 Seq ID No 2528 4.101 Seq ID No 2529 Seq ID No 2530 Seq ID No 2531 Seq ID No 2532 4.102 Seq ID No 2533 Seq ID No 2534 Seq ID No 2535 Seq ID No 2536 4.103 Seq ID No 2537 Seq ID No 2538 Seq ID No 2539 Seq ID No 2540 4.104 Seq ID No 2541 Seq ID No 2542 Seq ID No 2543 Seq ID No 2544 4.105 Seq ID No 2545 Seq ID No 2546 Seq ID No 2547 Seq ID No 2548 4.106 Seq ID No 2549 Seq ID No 2550 Seq ID No 2551 Seq ID No 2552 4.107 Seq ID No 2553 Seq ID No 2554 Seq ID No 2555 Seq ID No 2556
[0140] In one aspect of the invention, the family 4 or family 4-like binding molecule comprises a human V.sub.H domain comprising a hypervariable region CDR3 said CDR3 having the amino acid sequence SEQ ID NO. 2131, or a sequence having at least 70%, at least 80%, at least 90%, or at least 95% homology to SEQ ID NO. 2131.
[0141] In one embodiment, the family 4 or family 4-like binding molecule comprises a binding molecule comprising or consisting of at least one immunoglobulin single domain antibody directed against IL-17R wherein said domain is a human V.sub.H domain and wherein said V.sub.H domain comprises hypervariable region CDR3 said CDR3 having the amino acid sequence SEQ ID NO. 2131, or a sequence having at least 70%, at least 80%, at least 90%, or at least 95% homology thereto. In one embodiment, sequence homology is at least 90%.
[0142] In one embodiment, the CDR3 region is selected from one of the CDR3 sequence as shown in table 4 with reference to
[0143] In one embodiment, the family 4 or family 4-like binding molecule comprises at least one antigen binding site comprising hypervariable regions CDR1, CDR2 and CDR3, said CDR1 comprises or consists of the amino acid sequence SEQ ID NO. 2129 or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto, said CDR2 comprises or consists of the amino acid sequence SEQ ID NO. 2130 or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto, and said CDR3 comprises or consists of the amino acid sequence SEQ ID NO. 2131, or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto. For example, the CDR sequence may be a CDR sequence selected form those shown in
[0144] In one embodiment, said CDR1 comprises or consists of the amino acid sequence as shown in SEQ ID NO. 2129 or a sequence with at least 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto. In one embodiment, said CDR2 comprises or consists of the amino acid sequence as shown in SEQ ID NO. 2130 or a sequence with at least 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto. In one embodiment, said CDR3 comprises or consists of the amino acid sequence as shown in SEQ ID NO. 2131 or a sequence with at least 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto.
[0145] In one embodiment, CDR1 comprises or consists of one of the CDR1 amino acid sequence listed above in table 4 with reference to
[0146] In one embodiment, the family 4 or family 4-like binding molecule has a V.sub.H domain that comprises or consists of SEQ ID NO. 2132 or a sequence with at least 50%, 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 96%, 97%, 98%, 99% homology thereto. CDR sequences of such V.sub.H sequences are shown in
[0147] In another embodiment, the V.sub.H domain comprises a sequence selected from one of the sequences in the forgoing, but comprises 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid substitutions. In one embodiment, these are in the framework region. In another embodiment, these are in the CDR. In one embodiment, the amino acid substitutions are in the framework and CDR sequences. In one embodiment, the V.sub.H domain comprises or consists of SEQ ID NO. 2132 or a sequence which comprises one or more amino acid substitutions, for example 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid substitutions.
[0148] In another aspect, the invention relates to a binding molecule comprising or consisting of a V.sub.H domain as shown in SEQ ID NO. 2132 or a variant thereof comprising amino acid substitutions compared to SEQ ID NO. 2132 as follows residue 5 is Q, residue 10 is G, residue 28 is T, residue 31 is S, G, residue 32 is H, residue 33 is I, G, V, residue 37 is V, M, residue 51 is I, residue 54 is N, K, E, residue 55 is N, residue 61 is S, T, residue 66 is D, residue 100 is D, residue 101 is S, F, residue 102 is G, residue 103 is S and/or residue 106 is Q, T.
[0149] The family 4 or family 4-like binding molecules have KD, Koff, KA, Kd and IC.sub.50 values as further described herein and as shown in the examples.
[0150] In one aspect, the invention relates to a binding molecule capable of binding human IL-17RA comprising a human V.sub.H domain wherein said V.sub.H domain comprises a family 5 or family 5-like sequence.
[0151] In one embodiment, the binding molecule comprises or consists of at least one immunoglobulin single domain antibody directed against IL-17RA, preferably human IL-17RA, wherein said domain is a human V.sub.H domain and wherein said V.sub.H domain comprises a family 5 or family 5-like sequence. These include the V.sub.H sequence of the parent clone (clone 5.1; SEQ ID NO. 2560) or a part thereof, for example a CDR3 sequence, and V.sub.H sequences of clones that are derived from the parent clone 5.1 through a process of optimization, for example as shown in
[0152] CDR sequences and full length sequences of clones in family 5 are numbered according to table 5 as shown below.
TABLE-US-00006 TABLE 5 Family 5 CDR sequences and V.sub.H sequences that are within the scope of the invention. Corresponding sequences are shown in FIG. 5. Clone Full length VH name CDR1 SEQ ID NO. CDR2 SEQ ID NO. CDR3 SEQ ID NO. sequence SEQ ID NO. 5.1 SEQ ID NO. 2557 SEQ ID NO. 2558 SEQ ID NO. 2559 SEQ ID NO. 2560 5.2 SEQ ID NO. 2561 SEQ ID NO. 2562 SEQ ID NO. 2563 SEQ ID NO. 2564 5.3 SEQ ID NO. 2565 SEQ ID NO. 2566 SEQ ID NO. 2567 SEQ ID NO. 2568 5.4 SEQ ID NO. 2569 SEQ ID NO. 2570 SEQ ID NO. 2571 SEQ ID NO. 2572
[0153] In one aspect of the invention, the family 5 or family 5-like binding molecule comprises a human V.sub.H domain comprising a CDR3 sequence comprising amino acid sequence SEQ ID NO. 2559, or a sequence having at least 70%, at least 80%, at least 90%, or at least 95% homology thereto.
[0154] In one embodiment, the family 5 or family 5-like binding molecule comprises at least one immunoglobulin single domain antibody directed against IL-17R wherein said domain is a human V.sub.H domain and wherein said V.sub.H comprises at least one antigen binding site comprising hypervariable region CDR3 said CDR3 having the amino acid sequence SEQ ID NO. 2559, or a sequence having at least 70%, at least 80%, at least 90%, or at least 95% homology thereto.
[0155] In one embodiment, the homology is at least 90%.
[0156] In one embodiment, the CDR3 sequence is selected from one of the CDR3 sequences as shown in table 5 with reference to
[0157] In one embodiment, the family 5 or family 5-like sequence comprises a binding molecule comprising hypervariable regions CDR1, CDR2 and CDR3, said CDR1 comprises or consists of the amino acid sequence SEQ ID NO. 2557 or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto, said CDR2 comprises or consists of the amino acid sequence SEQ ID NO. 2558 or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto, and said CDR3 comprises or consists of the amino acid sequence SEQ ID NO. 2559, or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto. For example, the CDR sequence may be a CDR sequence selected from those shown in
[0158] In one embodiment, said CDR1 comprises or consists of the amino acid sequence as shown in SEQ ID NO. 2557 or a sequence with at least 70%, 80%, 81%, 82%, 83%, 84%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 96%, 97%, 98%, 99% homology thereto. In one embodiment, said CDR2 comprises or consists of the amino acid sequence as shown in SEQ ID NO. 2558 or a sequence with at least 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto. In one embodiment, said CDR3 comprises or consists of the amino acid sequence as shown in SEQ ID NO. 2559 or a sequence with at least 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto.
[0159] In one embodiment, CDR1 comprises or consists of one of the CDR1 amino acid sequence listed above in table 5 with reference to
[0160] In one embodiment, the family 5 or family 5-like binding molecule has a V.sub.H domain that comprises or consists of SEQ ID NO. 2560 or a sequence with at least 40%, 50%, 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto. Thus, the V.sub.H comprises or consist of a V.sub.H selected form SEQ ID Nos. 2560, 2564, 2568 or 2572. In another embodiment, the V.sub.H domain comprises a sequence selected from one of the sequences in the forgoing but comprises 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid substitutions. In one embodiment, these are in the framework region. In another embodiment, these are in the CDRs. In one embodiment, the amino acid substitutions are in the framework and CDR sequences. In one embodiment, the V.sub.H domain comprises or consists of SEQ ID NO. 2560 or a sequence which comprises one or more amino acid substitutions, for example 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid substitutions.
[0161] In another aspect, the invention relates to a binding molecule comprising or consisting of a V.sub.H domain as shown in SEQ ID NO. 2132 or a variant thereof comprising amino acid substitutions compared to SEQ ID NO. 2132 as follows residue 1 is Q, residue 32 is Y, residue 33 is Y, residue 52 is G, residue 53 is G, residue 56 is D, residue 57 is V, residue 103 is H, residue 104 is D and/or residue 106 is K.
[0162] The family 5 or family 5-like binding molecules have KD, Koff, KA, Kd and IC.sub.50 values as further described herein and as shown in the examples.
[0163] In another aspect, the invention relates to a binding molecule capable of binding human IL-17RA comprising a human V.sub.H domain wherein said V.sub.H domain comprises a family 6 or family 6-like sequence.
[0164] In one embodiment, the binding molecule comprises or consists of at least one immunoglobulin single domain antibody directed against IL-17RA, preferably human IL-17RA, wherein said domain is a human v domain and wherein said V.sub.H domain comprises a family 6 or family 6-like sequence. These include the V.sub.H sequence of the parent clone (clone 6.1; SEQ ID NO. 2576) or a part thereof, for example a CDR3 sequence, and V.sub.H sequences of clones or that are derived from the parent clone 6.1 through a process of optimization, for example as shown in
TABLE-US-00007 TABLE 6 Family 6 CDR sequences and V.sub.H sequences that are within the scope of the invention. Corresponding sequences are shown in FIG. 6. Clone Full length name CDR1 CDR2 CDR3 sequence 6.1 SEQ ID NO. SEQ ID NO. SEQ ID NO. SEQ ID NO. 2573 2574 2575 2576
[0165] In one aspect, the invention relates to a family 6 or family 6-like binding molecule comprises a human V.sub.H domain comprising a CDR3 sequence CDR3 comprising the amino acid sequence SEQ ID NO. 2575, or a sequence having at least 70%, at least 80%, at least 90%, or at least 95% homology thereto.
[0166] In one embodiment, the family 6 or family 6-like binding molecule comprises at least one immunoglobulin single domain antibody directed against IL-17R comprising at least one antigen binding site comprising hypervariable region CDR3 said CDR3 having the amino acid sequence SEQ ID NO. 2575, or a sequence having at least 70%, at least 80%, at least 90%, or at least 95% homology thereto. In one embodiment, the homology is at least 90%.
[0167] In one embodiment, the family 6 or family 6-like binding molecule comprises hypervariable regions CDR1, CDR2 and CDR3, said CDR1 comprises or consists of the amino acid sequence SEQ ID NO. 2573 or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto, said CDR2 comprises or consists of the amino acid sequence SEQ ID NO. 2574 or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto, and said CDR3 comprises or consists of the amino acid sequence SEQ ID NO. 2575, or a sequence with at least 80%, at least 90%, or at least 95% homology thereto.
[0168] In one embodiment, said CDR1 comprises or consists of the amino acid sequence SEQ ID NO. 2573 or a sequence with at least 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto. In one embodiment, said CDR2 comprises or consists of the amino acid sequence SEQ ID NO. 2574 or a sequence with at least 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homology thereto. In one embodiment, said CDR3 comprises or consists of the amino acid sequence SEQ ID NO. 2575 or a sequence with at least 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homology thereto.
[0169] In one embodiment, the family 6 or family 6-like binding molecule has a V.sub.H domain that comprises or consists of SEQ ID NO. 2576 or a sequence with at least 40%, 50%, 60%, 70%, 80%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98% or 99% homology thereto.
[0170] In another embodiment, the V.sub.H domain comprises SEQ ID NO. 2576, but comprises 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid substitutions. In one embodiment, these are in the framework region. In another embodiment, these are in the CDRs. In one embodiment, the amino acid substitutions are in the framework and CDR sequences.
[0171] The family 6 or family 6-like binding molecules have KD, Koff, KA, Kd and IC.sub.50 values as further described herein and as shown in the examples.
[0172] In another aspect, the invention relates to a binding molecule capable of binding human IL-17RA comprising a human V.sub.H domain wherein said V.sub.H domain comprises a family 7 or family 7-like sequence.
[0173] In one embodiment, the binding molecule comprises or consists of at least one immunoglobulin single domain antibody directed against IL-17RA, preferably human IL-17RA, wherein said domain is a human V.sub.H domain and wherein said V.sub.H domain comprises a family 7 or family 7-like sequence. These include the V.sub.H sequence of the parent clone (clone 7.1; SEQ ID NO. 2580) or a part thereof, for example a CDR3 sequence, and V.sub.H sequences of clones or parts thereof that are derived from the parent clone 7.1 through a process of optimization, for example as shown in
TABLE-US-00008 TABLE 7 Family 7 CDR sequences and V.sub.H sequences that are within the scope of the invention. Corresponding sequences are shown in FIG. 7. Clone Full length name CDR1 CDR2 CDR3 sequence 7.1 SEQ ID NO. SEQ ID NO. SEQ ID NO. SEQ ID NO. 2577 2578 2579 2580
[0174] In one aspect, the invention relates to a family 7 or family 7-like binding molecule comprises a human V.sub.H domain comprising a CDR3 sequence CDR3 comprising the amino acid sequence SEQ ID NO. 2579, or a sequence having at least 70%, at least 80%, at least 90%, or at least 95% homology thereto.
[0175] In one embodiment, the family 7 or family 7-like binding molecule comprises at least one immunoglobulin single domain antibody directed against IL-17R comprising a human V.sub.H domain comprising at least one antigen binding site comprising CDR1, CDR2 and CDR3, said CDR1 comprises or consists of the amino acid sequence SEQ ID NO. 2577 or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto, said CDR2 comprises or consists of the amino acid sequence SEQ ID NO. 2578 or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto, and said CDR3 comprises or consists of the amino acid sequence SEQ ID NO. 2579, or a sequence with at least 70%, at least 80%, at least 90%, or at least 95% homology thereto.
[0176] In one embodiment, said CDR1 comprises or consists of the amino acid sequence SEQ ID NO. 2577 or a sequence with at least 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homology thereto. In one embodiment, said CDR2 comprises or consists of the amino acid sequence SEQ ID NO. 2578 or a sequence with at least 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homology thereto. In one embodiment, said CDR3 comprises or consists of the amino acid sequence SEQ ID NO. 2579 or a sequence with at least 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homology thereto.
[0177] In one embodiment, the family 7 or family 7-like V.sub.H has a V.sub.H domain that comprises or consists of SEQ ID NO. 2580 or a sequence with at least 40%, 50%, 60%, 70%, 80%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homology thereto.
[0178] In another embodiment, the V.sub.H domain comprises SEQ ID NO. 2580, but comprises 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid substitutions. In one embodiment, these are in the framework region. In another embodiment, these are in the CDRs. In one embodiment, the amino acid substitutions are in the framework and CDR sequences.
[0179] The family 7 or family 7-like binding molecules have KD, Koff, KA, Kd and IC.sub.50 values as further described herein and as shown in the examples.
[0180] In one aspect, the binding molecule according to the invention comprises a CDR3 sequence selected from a family 1 or family 1-like, family 2 or family 2-like, family 3 or family 3-like, family 4 or family 4-like, family 5 or family 5-like, family 6 or family 6-like or family 7 or family 7-like CDR3 sequence combined with a CDR1 and CDR2 sequence from another family listed herein.
[0181] For example, the binding molecule according to the invention comprises a family 1 or family 1-like CDR3 sequence combined with a CDR1 and/or a CDR2 sequence from one or two other families as shown in Table 2, 3, 4, 5, 6 or 7.
[0182] In another aspect, the binding molecule according to the invention comprises a family 2 or family 2-like CDR3 sequence combined with a CDR1 and/or a CDR2 sequence from one or two other families as shown in Table 1, 3, 4, 5, 6 or 7. Various combinations are possible as would be appreciated by a skilled person.
[0183] In another aspect, the binding molecule according to the invention comprises a family 3 or family 3-like CDR3 sequence combined with a CDR1 and/or a CDR2 sequence from one or two other families as shown in Table 1, 2, 4, 5, 6 or 7. Various combinations are possible as would be appreciated by a skilled person.
[0184] In another aspect, the binding molecule according to the invention comprises a family 4 or family 4-like CDR3 sequence combined with a CDR1 and/or a CDR2 sequence from one or two other families as shown in Table 1, 2, 3, 5, 6 or 7. Various combinations are possible as would be appreciated by a skilled person.
[0185] In another aspect, the binding molecule according to the invention comprises a family 5 or family 5-like CDR3 sequence combined with a CDR1 and/or a CDR2 sequence from one or two other families as shown in Table 1, 2, 3, 4, 6 or 7. Various combinations are possible as would be appreciated by a skilled person.
[0186] In another aspect, the binding molecule according to the invention comprises a family 6 or family 6-like CDR3 sequence combined with a CDR1 and/or a CDR2 sequence from one or two other families as shown in Table 1, 2, 3, 5 or 7. Various combinations are possible as would be appreciated by a skilled person.
[0187] In another aspect, the binding molecule according to the invention comprises a family 7 or family 7-like CDR3 sequence combined with a CDR1 and/or a CDR2 sequence from one or two other families as shown in Table 1, 2, 3, 5 or 6. Various combinations are possible as would be appreciated by a skilled person.
[0188] As mentioned above, also within the scope of the invention are V.sub.H domains that comprise additional C or N terminal residues, for example linker residues introduced from the expression vector used (e.g., LEGGGS from phagemid vector or AA) and/or His tags, e.g. hexa-His (HHHHHH, SEQ ID NO: 2605).
[0189] A binding molecule described herein may be provided as a fusion protein with one or more additional protein moiety. For example, the binding molecule described herein may be provided as a fusion with a second moiety.
[0190] The second moiety may comprise a V.sub.H domain that is also specific for human IL-17RA thus providing a bivalent binding molecule. In one embodiment, the binding molecule is biparatopic. Biparatopic binding molecules bind to different epitopes. Biparatopic binding molecules of the present invention can be constructed using methods known art.
[0191] For example, a family 1 binding molecule may be linked to a family 2, 3, 4, 5, 6 or 7 or family 2, 3, 4, 5, 6 or 7-like binding molecule.
[0192] In another embodiment, the second moiety comprises a V.sub.H domain or another antibody fragment that is specific for a different antigen to provide a bispecific binding molecule. As used herein, the term bispecific binding molecule thus refers to a polypeptide that comprises a binding molecule as described herein which has a binding site that has binding specificity for IL17-RA, and a second polypeptide domain which has a binding site that has binding specificity for a second target, i.e., the agent has specificity for two targets. The first target and the second target are not the same, i.e. are different targets e.g., proteins, but are both present on a cell. Accordingly, a bispecific binding molecule as described herein can selectively and specifically bind to a cell that expresses (or displays on its cell surface) the first target and the second target. In another embodiment, the binding molecule comprises more than two moieties.
[0193] In another embodiment, more than two moieties are joined together providing a multispecific binding molecule. A multispecific polypeptide agent as described herein can in addition bind one or more additional targets, i.e., a multispecific polypeptide can bind at least two, at least three, at least four, at least five, at least six, or more targets, wherein the multispecific polypeptide agent has at least two, at least, at least three, at least four, at least five, at least six, or more target binding sites respectively.
[0194] As used herein, the term target refers to a biological molecule (e.g., peptide, polypeptide, protein, lipid, carbohydrate) to which a polypeptide domain which has a binding site can selectively bind. The target can be, for example, an intracellular target (e.g. an intracellular protein target) or a cell surface target (e.g., a membrane protein, a receptor protein). Preferably, a target is a cell surface target, such as a cell surface protein. Preferably, the first cell surface target and second cell surface target are both present on a cell.
[0195] Multispecific antibodies of the present invention can be constructed using methods known art.
[0196] In biparatopic or multispecific binding molecules, the moieties are joined by a linker, for example a polypeptide linker. Suitable linkers, for example comprising linker including GS residues such as (Gly.sub.4Ser).sub.n, where n=from 1 to 10, e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 are known in the art.
[0197] If desired, bispecific or multispecific binding molecules can be linked to an antibody Fc region or a fragment thereof, comprising one or both of C.sub.H2 and C.sub.H3 domains, and optionally a hinge region. For example, vectors encoding bispecific or multispecific binding molecules linked as a single nucleotide sequence to an Fc region or a fragment thereof can be used to prepare such polypeptides.
[0198] Exemplary second antigen targets include leukocyte receptors, e.g., MHC, CD2, CD3, CD4, CD7, CD8, CD25, CD28, CD4, CD45, CD58, CD80, CD86 or their ligands; TNF, IL-1 IL-15, IL-23, IL-6 or CD20. This list is not limited to the agents mentioned.
[0199] In one embodiment, the second moiety may serve to prolong the half-life of the binding molecule. The second moiety or third may comprise a protein that binds a serum albumin, e.g., human serum albumin (HSA). The second moiety may comprise a V.sub.H domain that binds serum albumin, e.g. human serum albumin (HSA). The second moiety may comprise a serum albumin, e.g. a human serum albumin (HSA) or a variant thereof such as C34S. Further provided is binding molecule as described herein comprising a V.sub.H domain and an Fc domain or a fragment thereof, e.g., wherein the V.sub.H domain is fused to an Fc domain or a fragment thereof. Further provided is a binding molecule that comprises a second variable domain that specifically binds a second antigen, where the second antigen is an antigen other than human IL-17R. The second antigen may be a cluster of differentiation (CD) molecule or a Major Histocompatibility Complex (MHC) Class II molecule.
[0200] The present invention further provides an isolated nucleic acid encoding a binding member of the present invention. Nucleic acid may include DNA and/or RNA. In one aspect, the present invention provides a nucleic acid that codes for a CDR, for example a CDR3, or set of CDRs, a V.sub.H domain or binding molecule as defined above. In one aspect, the invention also relates to nucleic acid sequences encoding V.sub.H domains of family 1, 2, 3, 4, 5, 6 or 7 as shown herein. Examples of such sequences encoding V.sub.H sequences of specific clones are shown below.
TABLE-US-00009 1.1 SEQIDNO.2581 CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGCAG GTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTGATGATT ATGCCATGCACTGGGTCCGGCAAGCTCCAGGGAAGGGCCTGGAGTGG GTCTCAGGTATTAGTTGGAATAGTGGTAGGATGGACTATGCGGACTC TGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAAGTCCC TGTATCTGCAAATGAACAGTCTGAGAGCTGAGGACACGGCCATGTAT TACTGTGCAAAAGAGAAGGGCCTAGGATTTTGTCGTGGTGGTAGCTG TTCCTACTTTGACTATAGGGGCCAGGGAACCCTGGTCACCGTCTCCT CA 1.2 SEQIDNO.2582 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGCAG GTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTGATGATT ATGCCATGCACTGGGTCCGACAAGCTCCAGGAAAGGGCCTGGAGTGG GTCTCAGGTATTAGTTGGAATAGTGGTAGGATGGACTATGCGGACTC TGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCCC TGTATCTGCAAATGAACAGTCTGAGAGCTGAGGACACGGCCTTATAT TACTGTGCAAAGGAGAAGGGCCTAGGATATTGTCGTGGTGGTAGCTG TTCCTACTTTGACTACAGGGGCCAGGGAACCCTGGTCACCGTCTCCT CA 1.3 SEQIDNO.2583 CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGCAG GTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTGCTGATT ATGCCTTGCACTGGGTCCGGCAAGCTCCAGGGAAGGGCCTGGAGTGG GTCTCAGGTATTAGTTGGAATAGTGGTAGGAAGGACTATGCGGACAC TGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAAGTCCC TGTATCTGCAAATGAACAGTCTGAGAGCTGAGGACACGGCCATGTAT TACTGTGCAAAAGAGAAGGGCCTAGGATTTTGTCGTGGTGGTAGCTG TTCCTACTTTGACTATAGGGGCCAGGGAACCCTGGTCACCGTCTCCT CA 1.4 SEQIDNO.2584 CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGCAG GTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTGCTGATT ATGCCTTGCACTGGGTCCGGCAAGCTCCAGGGAAGGGCCTGGAGTGG GTCTCAGGTATTAGTTGGAATGCCGGTAGGAAGGACTATGCGGACAC TGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAAGTCCC TGTATCTGCAAATGAACAGTCTGAGAGCTGAGGACACGGCCATGTAT TACTGTGCAAAAGAGAAGGGCCTAGGATTTTGTCGTGGTGGTAGCTG TTCCTACTTTGACTATAGGGGCCAGGGAACCCTGGTCACCGTCTCCT CA 1.5 SEQIDNO.2585 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGCAG GTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTGCTGATT ATGCCTTGCACTGGGTCCGACAAGCTCCAGGAAAGGGCCTGGAGTGG GTCTCAGGTATTAGTTGGAATAGTGGTAGGAAGGACTATGCGGACAC TGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCCC TGTATCTGCAAATGAACAGTCTGAGAGCTGAGGACACGGCCTTATAT TACTGTGCAAAGGAGAAGGGCCTAGGATATTGTCGTGGTGGTAGCTG TTCCTACTTTGACTACAGGGGCCAGGGAACCCTGGTCACCGTCTCCT CA 1.6 SEQIDNO.2586 GAAGTGCAGCTGGTTGAGAGCGGTGGTGGTCTGGTTCAGCCGGGTCG CAGCCTGCGCCTGAGCTGCGCGGCTAGCGGCTTTACCTTCGCAGATT ACGCCCTGCATTGGGTTCGTCAAGCACCGGGTAAAGGCCTGGAGTGG GTGTCCGGCATCTCTTGGAACGCGGGTCGTAAGGATTATGCGGACAC GGTCAAGGGTCGCTTCACCATTAGCCGTGACAATGCGAAAAATAGCC TGTATTTGCAGATGAACAGCCTGCGTGCGGAAGATACCGCGCTGTAT TACTGCGCGAAAGAAAAGGGCTTGGGCTATTGTCGTGGTGGCAGCTG TTCGTACTTTGACTACCGTGGTCAGGGTACGCTGGTGACGGTCTCGA GC 2.1 SEQIDNO.2587 CAGGTCCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGC CTCAGTGAAGGTCTCCTGCAAGGCTTCTGGATACCCCTTCACCAGTT ATGATATCAATTGGGTGCGACAGGCCACAGGACAAAGCCTTGAGTGG ATGGGATGGATGAACCCTAACAGTGGTGACACAGTCTATGCACAGAA ATTCCAGGGCAGAGTCACCATGACCAGGAATACCTCCATAAGCACAG CCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTAT TTTTGTGCGAGAGGCAGAAGGGATGACTGGAAGAACAATTATTGGGG CCAGGGAACCCTGGTCACTGTCTCCTCA 2.2 SEQIDNO.2588 CAGGTCCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGC CTCAGTGAAGGTCTCCTGCAAGGCTTCTGGATACCCCTTCACCAGTT ATGATATCAATTGGGTGCGACAGGCCACAGGACGAAGCCTTGAGTGG ATGGGATGGATGAACCCTACCAATGGTAACACAGTCTATGCACAGAA ATTCCAGGACAGAGTCACCATGACCAGGAATACCTCCATAAGCACAG CCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTAT TTTTGTGCGAGAGGCAGAAGGGATGACTGGAAGAACAATTATTGGGG CCAGGGAACCCTGGTCACTGTCTCCTCA 2.3 SEQIDNO.2589 CAGGTCCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGC CTCAGTGAAGGTCTCCTGCAAGGCTTCTGGATACCCCTTCACCAGTT ATGATATCAATTGGGTGCGACAGGCCACAGGACGAAGCCTTGAGTGG ATGGGATGGATGAACCCTACAAGTGGTGACACAGTCTATGCACAGAA ATTCCAGGACAGAGTCACCATGACCAGGAATACCTCCATAAGCACAG CCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTAT TTTTGTGCGAGAGGCAGAAGGGATAACTGGAAGAACAATTATTGGGG CCAGGGAACCCTGGTCACTGTCTCCTCA 3.1 SEQIDNO.2590 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTCCAGCCTGGGGG GTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTTCCCTTTAGTACCT ATTGGATGAGGTGGCTCCGCCAGGCTCCAGGGAAGGGCCTGGAGTGG GTGGCCAACATAAACCAAGATGGAAGTGAGAAATACTATGTGGACTC TGTGAAGGGCCGATTCACCATTTCCAGAGACAACGCCAAGAGTTCAC TGTTTCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCTGTATAT TACTGTGCGAGAGGGTGGGAGTCGGGGTGGTTCGAACCCTGGGGCCA GGGAACCCTGGTCACCGTCTCCTCA 4.1 SEQIDNO.2591 CAGGTTCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGC CTCAGTGAAGGTCTCCTGCAAGGCTTCTGGATACCCCTTCACCAATT ATGATATCAGCTGGATACGACAGGCCACTGGACAAAGTCTTGAGTGG ATGGGATGGATGAACCCTGACAGTGGTAACACAGGCTATGCACAGAA GTTCCAGGGCAGAGTCACCATGACCAGGAACACCTCCATAAGCACAG CCTACATGGAACTGAGTGGCCTGAGATCTGAGGACACGGCCGTATAT TTCTGTGCGAGAGGGGGTTACAATGCCTGGAGAACGGACTACTGGGG CCAGGGCACCCTGGTCACCGTCTCCTCA 5.1 SEQIDNO.2592 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTCAAGCCTGGAGG GTCCCTGAGACTCTCCTGTGAAGCCTCTGGATTCACCTTCAGTGACT TCGACATGAGCTGGATCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGG GTTGCATACATTAGTAGTAGTGATAGTACCATATATTATAGAGACTC TGTGAAGGGCCGATTCACCATTTCCAGGGACAACGCCAAGAACTCAC TGTATCTGCAAATGAACAGCCTGAGAGCCGAAGACACGGCCGTGTAT TACTGTTCGAGAAACGGGGCCCGGTATAACTGGAACTACGGGGACTT CCAGCACTGGGGCCAGGGCACCCTGGTCACTGTCTCCTCA 6.1 SEQIDNO.2593 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTCAAGCCTGGAGG GTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTGACG ACTACATGAGCTGGCTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGG GTTTCATACATTAGTAGTAGTGGTAGTACCATATACTACGCAGACTC TGTGAAGGGCCGATTCACCATCTCCAGGGACAACGCCAAGAACTCAC TGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACTCGGCCGTGTAT TACTGTGCGAGAAAAGATATAACGAATATAGCAGTGGGCTCCCTCGG CTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA 7.1 SEQIDNO.2594 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTCCAGCCTGGGGG GTCCCTGAGACTCTCCTGTGCAGCCTCAGGATTCACCTTTAGTAACT ATTGGATGAGCTGGGTCCGCCAGGCTCGAGGGAAGGGGCTGGAGTGG GTGGCCAACATAAGACCAGATGGAAGTGAGCGATACTATGTGGACTC TGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCAT TGTATCTGCAGATGAGCAGCCTGAGAGCCGAGGACACGGCTGTGTAT TACTGTGCGAGATCGAGAGATTGGGGATCTCGGGCTTTTGATATCTG GGGCCAAGGGACAATGGTCACCGTCTCCTCA
[0201] Nucleic acid according to the present invention may comprise DNA or RNA and may be wholly or partially synthetic or recombinantly produced. Reference to a nucleotide sequence as set out herein encompasses a DNA molecule with the specified sequence, and encompasses a RNA molecule with the specified sequence in which U is substituted for T, unless context requires otherwise.
[0202] Furthermore, the invention relates to a nucleic acid construct comprising at least one nucleic acid defined above. The construct may be in the form of plasmids, vectors, transcription or expression cassettes.
[0203] The invention also relates to an isolated recombinant host cell comprising one or more nucleic acid constructs as above.
[0204] The invention also relates to a binding agent capable of binding to IL-17RA that competes for binding to IL-17RA with a binding molecule of the invention as described above in a competitive assay.
[0205] The invention also relates to an isolated V.sub.H domain comprising an amino acid product of or derived from a human V.sub.H germline sequence, for example a human V.sub.H 3-09, V.sub.H1 -08, V.sub.H 3-07 or V.sub.H 3-11 germline sequence.
[0206] The binding molecules of the invention have certain functional properties as described below and set out in the examples.
[0207] In particular, the binding molecules of the invention block the effects of IL-17RA on its target cells and are thus indicated for use in the treatment of IL-17RA-mediated diseases and disorders, for example as described herein.
[0208] These and other pharmacological activities of the binding molecules of the invention may be demonstrated in standard test methods for example as described in the art, e.g., Neutralization of IL-17R dependent production of interleukin-6 by primary human fibroblasts: The production of IL-6 in primary human (dermal) fibroblasts is dependent on IL-17 (Hwang S Y et al., (2004) Arthritis Res Ther; 6:R120-128)) and in the examples herein. Thus, as described in more detail in the examples, binding members according to the invention neutralize IL-17RA with high potency. The term neutralizing thus refers to neutralization of a biological activity of IL-17R when a binding protein specifically binds IL-17R. Inhibition of a biological activity of IL-17R by a neutralizing binding protein can be assessed by measuring one or more indicators of IL-17R biological activity well known in the art as described in the examples.
[0209] For example, neutralisation of IL-17R binding to its receptor may be measured as cellular release of a biological molecule, e.g., MMP13, PGE2 or a cytokine such as IL-6 or IL-8, in a biological assay, since IL-17RA binding to its receptor induces cellular release of these molecules, which can be determined using appropriate assays, e.g. in HT1080 cells, chondrocytes or other suitable cell or tissue types.
[0210] Inhibition of biological activity may be partial or total. In specific embodiments, binding members are provided that inhibit IL-17R biological activity by at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 60%, or at least 50% of the activity in absence of the binding member. The degree to which a binding member neutralises IL-17RA is referred to as its neutralising potency. Potency may be determined or measured using one or more assays known to the skilled person and/or as described or referred to herein. For example, potency may be assayed in: [0211] HTRF(R) (Homogeneous Time-Resolved Fluorescence) receptor-ligand binding assay [0212] HT1080 IL-6 release assayHT1080 cell assay using synergised IL-6 release in response to IL-17 and TNF [0213] Chondrocyte IL-6/IL-8/MMP13/PGE2-release assay IL-6 release assay in cartilage explants [0214] IL-6 release assay in synovial fibroblasts (e.g. from RA or OA patients), e.g. using synergised IL-6 response to IL-17 and TNF.
[0215] Assays methods are described in detail in the examples.
[0216] Neutralising potency of a binding member as calculated in an assay using IL-17 from a first species (e.g. human) may be compared with neutralising potency of the binding member in the same assay using IL-17RA from a second species (e.g., cynomolgus), in order to assess the extent of cross-reactivity of the binding member for IL-17RA of the two species.
[0217] Potency is normally expressed as an IC.sub.50 value, in nM unless otherwise stated. In functional assays, IC.sub.50 is the concentration of a binding member that reduces a biological response by 50% of its maximum. IC.sub.50 may be calculated by plotting % of maximal biological response as a function of the log of the binding member concentration, and using a software program to fit a sigmoidal function to the data to generate IC.sub.50 values.
[0218] In another aspect, the invention thus relates to a binding molecule comprising at least one V.sub.H domain directed against human IL-17A, or comprising or consisting of at least one immunoglobulin single V.sub.H domain antibody directed against IL-17RA, preferably human IL-17RA, wherein said domain is a human V.sub.H domain and has an IC.sub.50 for inhibition of IL-6 production of about 0.2 to about 500 nM or more, for example 0.2 to 400, 0.2 to 300, 0.2 to 200, 0.2 to 100, 0.2 to 50, 0.2 to 40, 0.2 to 30, 0.2 to 20, 0.2 to 10, 0.2 to 9, 0.2 to 8, 0.2 to 7, 0.2 to 6, 0.2 to 5, 0.2 to 4.0, 0.2 to, 0.2 to 2 or 0.2 to 1 when tested as described in the examples, i.e. by measuring the ability of IL-17RA binding V.sub.H to inhibit IL-17RA induced IL-6 release from the cell line HT1080. The binding molecules of the invention may have an IC.sub.50 for inhibition of IL-6 production of less than about 500 nM, preferably less than about 100 nM assessed by measuring the ability of IL-17RA binding V.sub.H to inhibit IL-17RA induced IL-6 release from the cell line HT1080. This assay measures IL-6 release, a detailed method is given in the examples. The binding molecule, for example a V.sub.H domain, having these binding characteristics may be selected from one of the sequences disclosed herein. In another embodiment, the V.sub.H domain comprises a CDR3 sequence or V.sub.H sequence as described herein.
[0219] In one embodiment, said IL-17RA binding molecule comprises a family 1 or family 1-like V.sub.H sequence or part thereof, for example a CDR3 sequence, as described above. In one embodiment, said IL-17RA binding molecule comprises a family 2 or family 2-like V.sub.H sequence or part thereof, for example a CDR3 sequence, as described above. In one embodiment, said IL-17RA binding molecule comprises a family 3 or family 3-like V.sub.H sequence or part thereof, for example a CDR3 sequence, as described above. In one embodiment, said IL-17RA binding molecule comprises a family 4 or family 4-like V.sub.H sequence or part thereof, for example a CDR3 sequence, as described above. In one embodiment, said IL-17RA binding molecule comprises a family 5 or family 5-like V.sub.H sequence or part thereof, for example a CDR3 sequence, as described above. In one embodiment, said IL-17RA binding molecule comprises a family 6 or family 6-like V.sub.H sequence or part thereof, for example a CDR3 sequence, as described above. In one embodiment, said IL-17RA binding molecule comprises a family 7 or family 7-like V.sub.H sequence or part thereof, for example a CDR3 sequence, as described above. Various embodiments of these sequences are detailed above.
[0220] Additionally, binding kinetics and affinity (expressed as the equilibrium dissociation constant, KD) of IL-17RA binding molecules of the invention for binding IL-17RA may be determined, e.g. using surface plasmon resonance such as BIAcore, or KD may be estimated from pA2 analysis.
[0221] In another aspect, the invention relates to a binding molecule that has a KD (M) value of in the range of from about 1E-07 (110.sup.7) to about 6E-11 (610.sup.11), wherein said KD is calculated using BIAcore. The term KD refers to the equilibrium dissociation constant and refers to the value obtained in a titration measurement at equilibrium, or by dividing the dissociation rate constant (Koff) by the association rate constant (Kon). In one embodiment, the KD may be as shown in the examples.
[0222] In one embodiment, said IL-17RA binding molecule comprises a family 1 or family 1-like V.sub.H sequence or part thereof, for example a CDR3 sequence, as described above. In one embodiment, said IL-17RA binding molecule comprises a family 21 or family 2-like V.sub.H sequence or part thereof, for example a CDR3 sequence, as described above. In one embodiment, said IL-17RA binding molecule comprises a family 3 or family 3-like V.sub.H sequence or part thereof, for example a CDR3 sequence, as described above. In one embodiment, said IL-17RA binding molecule comprises a family 4 or family 4-like V.sub.H sequence or part thereof, for example a CDR3 sequence, as described above. In one embodiment, said IL-17RA binding molecule comprises a family 5 or family 5-like V.sub.H sequence or part thereof, for example a CDR3 sequence, as described above. In one embodiment, said IL-17RA binding molecule comprises a family 6 or family 6-like V.sub.H sequence or part thereof, for example a CDR3 sequence, as described above. In one embodiment, said IL-17RA binding molecule comprises a family 7 or family 7-like V.sub.H sequence or part thereof, for example a CDR3 sequence, as described above. Various embodiments of these sequences are detailed above.
[0223] In one embodiment, the binding molecule has a KD as defined above and an IC.sub.50 for inhibition of IL-6 production as defined above.
[0224] A skilled person will know that there are different ways to identify and obtain the antigen binding molecules as described herein, including in vitro and in vivo expression libraries. This is further described in the examples. Optimisation techniques known in the art, such as display techniques (e.g., ribosome display and/or phage display) and/or mutagenesis techniques (e.g., error prone mutagenesis) can be used.
[0225] Methods for preparing or generating the polypeptides, nucleic acids, host cells, products and compositions described herein using in vitro expression libraries can comprise the steps of: [0226] a) providing a set, collection or library of nucleic acid sequences encoding amino acid sequences; and [0227] b) screening said set, collection or library of amino acid sequences for amino acid sequences that can bind to/have affinity for IL-17RA and [0228] c) isolating the amino acid sequence(s) that can bind to/have affinity for IL-17RA.
[0229] In the above methods, the set, collection or library of sequences may be displayed on a phage, phagemid, ribosome or suitable micro-organism (such as yeast), such as to facilitate screening. Suitable methods, techniques and host organisms for displaying and screening (a set, collection or library of) sequences will be clear to the person skilled in the art (see for example Phage Display of Peptides and Proteins: A Laboratory Manual, Academic Press; 1st edition (Oct. 28, 1996) Brian K. Kay, Jill Winter, John McCafferty).
[0230] The binding molecules described herein comprising V.sub.H domains, can be expressed in a transgenic rodent. The transgenic rodent, for example a mouse, has a reduced capacity to express endogenous antibody genes. Thus, in one embodiment, the rodent has a reduced capacity to express endogenous light and/or heavy chain antibody genes. The rodent may therefore comprise additional modifications to disrupt expression of endogenous light and/or heavy chain antibody genes so that no functional light and/or heavy chains are produced.
[0231] In one embodiment, the rodent is a mouse. The mouse may comprise a non-functional lambda light chain locus. Thus, the mouse does not make a functional endogenous lambda light chain. In one embodiment, the lambda light chain locus is deleted in part or completely or rendered non-functional through insertion, inversion, a recombination event, gene editing or gene silencing. For example, at least the constant region genes C1, C2 and C3 may be deleted or rendered non-functional through insertion. In one embodiment, the locus is functionally silenced so that mouse does not make a functional endogenous lambda light chain.
[0232] Furthermore, the mouse may comprise a non-functional kappa light chain locus. Thus, the mouse does not make a functional endogenous kappa light chain. In one embodiment, the kappa light chain locus is deleted in part or completely or rendered non-functional through insertion, inversion, a recombination event, gene editing or gene silencing. In one embodiment, the locus is functionally silenced so that the mouse does not make a functional endogenous kappa light chain.
[0233] The mouse having functionally silenced endogenous lambda and kappa L-chain loci may, for example, be made as disclosed in WO 2003/000737, which is hereby incorporated by reference in its entirety.
[0234] Furthermore, the mouse may comprise a non-functional heavy chain locus. Thus, the mouse does not make a functional endogenous heavy chain. In one embodiment, the heavy chain locus is deleted in part or completely or rendered non-functional through insertion, inversion, a recombination event, gene editing or gene silencing. In one embodiment, the locus is functionally silenced so that the mouse does not make a functional endogenous heavy chain. In one embodiment, the locus is functionally silenced so that mouse does not make a functional endogenous heavy chain.
[0235] For example, as described in WO 2004/076618 (hereby incorporated by reference in its entirety), all 8 endogenous heavy chain constant region immunoglobulin genes (, , 3, 1, 2a, 2b, and ) are absent in the mouse, or partially absent to the extent that they are non-functional, or genes , 3, 1, 2a, 2b and are absent and the flanking genes and a are partially absent to the extent that they are rendered non-functional, or genes , , 3, 1, 2a, 2b and are absent and a is partially absent to the extent that it is rendered non-functional, or , 3, 1, 2a, 2b, and are absent and is partially absent to the extent that it is rendered non-functional. By deletion in part is meant that the endogenous locus gene sequence has been deleted or disrupted, for example by an insertion, to the extent that no functional endogenous gene product is encoded by the locus, i.e. that no functional product is expressed from the locus. In another embodiment, the locus is functionally silenced.
[0236] In one embodiment, the mouse comprises a non-functional endogenous heavy chain locus, a non-functional endogenous lambda light chain locus and a non-functional endogenous kappa light chain locus. The mouse therefore does not produce any functional endogenous light or heavy chains. Thus, the mouse is a triple knockout (TKO) mouse.
[0237] The transgenic mouse may comprise a vector, for example a Yeast Artificial Chromosome (YAC) for expressing a heterologous heavy chain locus. YACs are vectors that can be employed for the cloning of very large DNA inserts in yeast. As well as comprising all three cis-acting structural elements essential for behaving like natural yeast chromosomes (an autonomously replicating sequence (ARS), a centromere (CEN) and two telomeres (TEL)), their capacity to accept large DNA inserts enables them to reach the minimum size (150 kb) required for chromosome-like stability and for fidelity of transmission in yeast cells. The construction and use of YACs is well known in the art (e.g. Bruschi, C. V. and Gjuracic, K. Yeast Artificial Chromosomes, ENCYCLOPEDIA OF LIFE SCIENCES 2002 Macmillan Publishers Ltd, Nature Publishing Group/www.els.net).
[0238] For example, the YAC may comprise a plethora of human V.sub.H, D and J genes in combination with mouse immunoglobulin constant region genes lacking C.sub.H1 domains, mouse enhancer and regulatory regions. An example of such a YAC is provided in the example section.
[0239] Alternative methods known in the art may be used for deletion or inactivation of endogenous mouse or rat immunoglobulin genes and introduction of human V.sub.H, D and J genes in combination with mouse immunoglobulin constant region genes lacking C.sub.H1 domains, mouse enhancer and regulatory regions
[0240] Transgenic mice can be created according to standard techniques as illustrated in the examples. The two most characterised routes for creating transgenic mice are via pronuclear microinjection of genetic material into freshly fertilised oocytes or via the introduction of stably transfected embryonic stem cells into morula or blastocyst stage embryos. Regardless of how the genetic material is introduced, the manipulated embryos are transferred to pseudo-pregnant female recipients where pregnancy continues and candidate transgenic pups are born.
[0241] The main differences between these broad methods are that ES clones can be screened extensively before their use to create a transgenic animal. In contrast, pronuclear microinjection relies on the genetic material integrating to the host genome after its introduction and, generally speaking, the successful incorporation of the transgene cannot be confirmed until after pups are born.
[0242] There are many methods known in the art to both assist with and determine whether successful integration of transgenes occurs. Transgenic animals can be generated by multiple means including random integration of the construct into the genome, site-specific integration, or homologous recombination. There are various tools and techniques that can be used to both drive and select for transgene integration and subsequent modification including the use of drug resistance markers (positive selection), recombinases, recombination-mediated cassette exchange, negative selection techniques, and nucleases to improve the efficiency of recombination. Most of these methods are commonly used in the modification of ES cells. However, some of the techniques may have utility for enhancing transgenesis mediated via pronuclear injection.
[0243] Further refinements can be used to give more efficient generation of the transgenic line within the desired background. As described above, in preferred embodiments, the endogenous mouse immunoglobulin expression is silenced to permit sole use of the introduced transgene for the expression of the heavy-chain only repertoire that can be exploited for drug discovery. Genetically-manipulated mice, for example TKO mice that are silenced for all endogenous immunoglobulin loci (mouse heavy chain, mouse kappa chain and mouse lambda chain) can be used as described above. The transfer of any introduced transgene to this TKO background can be achieved via breeding, (either conventional or with the inclusion of an IVF step to give efficient scaling of the process). However, it is also possible to include the TKO background during the transgenesis procedure. For example, for microinjection, the oocytes may be derived from TKO donors. Similarly, ES cells from TKO embryos can be derived for use in transgenesis.
[0244] The invention also relates to a method for producing a binding molecule comprising at least one immunoglobulin single domain antibody directed against IL-17RA wherein said domain is a human V.sub.H domain said method comprising [0245] a) immunising a transgenic mouse that expresses a nucleic acid construct comprising human heavy chain V genes and that is not capable of making functional endogenous light or heavy chains with an IL-17RA antigen, [0246] b) generating a library from said mouse and [0247] c) isolating V.sub.H domains from said libraries.
[0248] Additional steps to optimize the sequences can be included.
[0249] The invention also relates to a binding molecule capable of binding human IL-17RA comprising a V.sub.H domain obtained or obtainable from a mouse that is not capable of making functional endogenous light or heavy chains, for example through the method described above.
[0250] The binding molecule of the invention may be conjugated to another moiety. This can be selected from a toxin, enzyme, radioisotope, other detectable label, peptide, protein and chemical moiety of interest.
[0251] For example, the binding molecule of the invention may be labelled with a detectable or functional label. A label can be any molecule that produces or can be induced to produce a signal, including but not limited to fluorescers, radiolabels, enzymes, chemiluminescers or photosensitizers. Thus, binding may be detected and/or measured by detecting fluorescence or luminescence, radioactivity, enzyme activity or light absorbance.
[0252] Half-life of the binding molecule of the invention can be increased by a chemical modification, especially by PEGylation, or by incorporation in a liposome or linking to another molecule, e.g. serum albumin or an anti-HSA binding molecule.
[0253] In one embodiment, a binding molecule of the invention is covalently modified. The term covalently modified/covalent modification includes modifications of a binding molecule according to the present invention, e.g. of a specified sequence; with an organic proteinaceous or non-proteinaceous derivatizing agent, fusions to heterologous polypeptide sequences, and post-translational modifications. Covalent modified polypeptides, e.g., of a specified sequence, still have the functional properties described herein, for example the ability to bind the human IL-17 or e.g. neutralize IL-6 production of IL-17 induced human dermal fibroblasts by crosslinking. Covalent modifications are generally introduced by reacting targeted amino acid residues with an organic derivatizing agent that is capable of reacting with selected sides or terminal residues, or by harnessing mechanisms of post-translational modifications that function in selected recombinant host cells. Certain post-translational modifications are the result of the action of recombinant host cells on the expressed polypeptide. Glutaminyl and asparaginyl residues are frequently post-translationally deamidated to the corresponding glutamyl and aspartyl residues. Alternatively, these residues are deaminated under mildly acidic conditions. Other post-translational modifications include hydroxylation of proline and lysine, phosphorylation of hydroxyl groups of seryl, tyrosine or threonyl residues, methylation of the [alpha]-amino groups of lysine, arginine, and histidine side chains. Covalent modifications e.g. include fusion proteins comprising a binding molecule according to the present invention, e.g. of a specified sequence and their amino acid sequence variants, such as immunoadhesins, and N-terminal fusions to heterologous signal sequences.
[0254] In another aspect of the present invention, there is provided a pharmaceutical composition comprising an IL-17RA binding molecule according to the present invention and a pharmaceutically acceptable carrier. The binding molecule of the present invention or a composition thereof can be administered by any convenient route and examples of the administration form of the binding molecule or composition of the present invention include without limitation topical, in particular dermal, parenteral, and intranasal. Parenteral administration includes subcutaneous injections, intravenous, intramuscular, intrasternal injection or infusion techniques. Compositions can take the form of one or more dosage units.
[0255] The composition of the invention can be in the form of a liquid, e. g. a solution, emulsion or suspension. The liquid can be useful for delivery by dermal, topical or injection routes. The liquid compositions of the invention, whether they are solutions, suspensions or other like form, can also include one or more of the following: sterile diluents such as water, saline solution, preferably physiological saline, Ringer's solution, isotonic sodium chloride, fixed oils such as synthetic mono or digylcerides, polyethylene glycols, glycerin, or other solvents; antibacterial agents such as benzyl alcohol or methyl paraben; and agents for the adjustment of tonicity such as sodium chloride or dextrose. A composition can be enclosed in an ampoule, a disposable syringe or a multiple-dose vial made of glass, plastic or other material.
[0256] In specific embodiments, it can be desirable to administer a binding molecule of the present invention or composition thereof locally to the area in need of treatment.
[0257] Thus, in a preferred embodiment of all aspects of the invention, administration of the composition or binding molecule of the invention is by topical administration to healthy or diseased skin. The binding molecule is capable of penetrating at least the outer layer of the skin and can therefore be delivered dermally or transdermally. Accordingly, in one embodiment of the various aspects of the invention, topical delivery of the the composition or binding molecule of the invention to the skin is direct delivery into the skin for local non-systemic exposure. In another embodiment, topical delivery of the composition or binding molecule of the invention to the skin is direct delivery to the skin to provide systemic exposure as the .sub.H domain penetrates through all layers of the skin.
[0258] The skin that is treated may be diseased or healthy skin. In a preferred embodiment, the skin disease is psoriasis or atopic dermatitis.
[0259] Preferably, the surface area to which it is applied is 1%-30% of the body surface area, for example 1%-10% or 1-20%. Administration may thus be to 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29% or 30% of body surface area. In one embodiment, the disease state is mild. In another embodiment, the disease state is moderate. In another embodiment, the disease state is severe. For the treatment of psoriasis, administration is to areas affected, typically one or more affected area selected from elbows, knees, palms of hands, scalp, soles of feet, genitals, upper thighs, groin, buttocks, face and torso. For the treatment of atopic dermatitis administration is to areas affected, typically one or more affected area selected from face, forearms and wrists.
[0260] Thus, the binding molecule can be applied directly to diseased or healthy skin in the form of cream, lotion, sprays, solution, gel, ointment, paste, plaster, patch, bioadhesive, suspension or the like, and/or may be prepared so as to contain liposomes, micelles, and/or microspheres. In one embodiment, the binding molecule is applied directly to diseased skin in the form of a liquid (e.g. a spray), plaster, patch or bioadhesive. In one embodiment, the binding molecule is applied directly to diseased skin in the form of a microemulsion.
[0261] Microemulsions are generally defined as having a droplet diameter within the range of 2-500 nm thus allowing effective delivery of actives into the skin. Microemulsions have been proposed for use in enhancing transdermal delivery of a range of compounds. This is described in US2007/0243132 incorporated herein in its entirety.
[0262] Specifically, as used herein, the term microemulsion refers to a formulation that comprises an oil phase, a water phase and a surfactant, wherein the microemulsion is suitable for transdermal delivery of a binding molecule, for example comprising a human V.sub.H domain as described herein. Preferably, the microemulsion of the invention has a droplet diameter within the range of 2-500 nm. In one embodiment, a microemulsion may further comprise a co-surfactant, a co-solvent, or a combination thereof.
[0263] The microemulsion of the present invention may be oil-in-water microemulsion, wherein the surfactant is preferentially soluble in water; water-in-oil microemulsion, wherein the surfactant is mainly in the oil phase; a three-phase microemulsion wherein a surfactant-rich middle phase coexists with water and oil phases; a bicontinuous monophase; a single phase micellar solution that forms upon addition of a sufficient quantity of amphiphile (surfactant plus alcohol); or a swollen micellar solution.
[0264] The microemulsion of the present invention may be produced by methods known in the art. In general, microemulsions are produced by emulsifying components under conditions including typically sufficient force or the required temperature to generate the required dispersion level, conductivity, viscosity, percolativity or other dispersion characteristics.
[0265] Microemulsion formation can be assessed using scattering and spectroscopic techniques such as neutron scattering, time-average scattering, quasi-electric light scattering i.e., high-resolution ultrasonic spectroscopy or photon correlation spectroscopy. The partition coefficients of microemulsions may also be measured chromatographically. The selection of particular formulations is based on a number of different paradigms depending upon the desired application. Illustrative paradigms include the hydrophilic-lipophilic balance, the phase-inversion temperature, or the cohesive-energy ratio. Microemulsions may be formulated using a wide range of immiscible liquids and other additional agents.
[0266] A microemulsion of the present invention may comprise an oil phase in the range of from 50 and 99% by weight, most preferably from 50 and 90% by weight; a water phase in the range of from 2 to 50% by weight, most preferably between 1 and 50% by weight; and surfactant in the range of from 0.1 to 90% by weight, preferably in the range of from 1 to 90% by weight surfactant. The microemulsion may further comprise from 0.1 to 90% by weight cosurfactant or cosolvent; preferably from 1 to 90% by weight cosurfactant or cosolvent.
[0267] The oil phase may comprise natural oils derived from plants or animals, such as vegetable oils, sunflower oils, coconut oils, almond oils; purified synthetic or natural di or triglycerides (such as Crodamol GTC and Capmul MC); phospholipids and their derivatives (such as lecithin or lysolecithin); fatty acid esters (such as isopropyl myristate, isopropyl palmitate, ethyl oleate, oleic acid ethyl ester); hydrocarbons (such as hexane, the n-decane through n-octadecane series); and/or glycerolysed fats and oils (such as glyceryl monooleate, glyceryl monocaprylate, glycerol monocaprate, propylene glycol monocaprylate, propyleme glycol monolaurate).
[0268] Other oil phase ingredients include, but are not limited to, Labrafil M 1944 CS, benzene, tetrahydrofuran, and n-methyl pyrrolidone, or halogenated hydrocarbons, such as methylene chloride, or chloroform. In a particular embodiment, the oil phase comprises Crodamol GTCC and Capmul MCM, at 3:1 ratio. The oil component is either used alone or in combination with another oil component or components. Each oil or unique mixture of oils may require a different surfactant or mixture of surfactants or surfactants and co-surfactants to form a microemulsion with the water phase, as can routinely be determined by those of skill in the art. Water phase ingredients may comprise water and any water-soluble components in water, including one or more pharmaceutical agent.
[0269] The microemulsion of the present invention may further comprise solvents or other agents to enhance emulsion formation or stability. Other agents may be introduced to provide functions such as pH, ionic content, polymerisation, taste, smell, sterility, colour, viscosity, etc.
[0270] The microemulsions of the present invention may also be generated using any suitable synthetic plastic or polymeric, monomeric or hybrid colloidal material.
[0271] According to the methods and uses set out above, the binding molecule can be administered together with one or more chemical skin penetration enhancer. Examples of skin penetration enhancers are set out below.
[0272] In another embodiment, the binding molecule is administered using occlusion. In one embodiment, the binding molecule is administered to healthy or diseased skin together with a chemical skin penetration enhancer and using occlusion. In one embodiment, the binding molecule is administered to healthy or diseased skin as a microemulsion and using occlusion.
[0273] In another embodiment of the various aspects of the invention, administration may be improved using non-chemical skin penetration enhancers, for example phonophoresis, sonophoresis, electroporation or using the microneedle technique. This uses small needles (10-200 m height and 10-50 m width) which are connected with the drug reservoir. The microneedle delivery device is applied to the skin surface without reaching the nerve endings of the upper dermis.
[0274] The binding molecule administered as set out above is capable of penetrating at least the outer layer of the skin and thus delivers an effective therapeutic amount of the binding molecule to treat the disease. The binding molecule administered as set out herein penetrates the skin in preferably 6 hours or less, for example 1 hour or less.
[0275] In one aspect, the invention relates to a pharmaceutical composition comprising a binding molecule of the invention and a skin penetration enhancer that facilitates or improves skin penetration. Unless otherwise specified, the term skin penetration enhancer as used herein refers to a chemical skin penetration enhancer. Numerous chemical penetration enhancers are known in the art and can be used in the composition of the invention. These include, but are not limited to: water, alcohols, preferably alcohols with up to six carbon atoms, for example ethanol, glycols, for example alcohol diethylene glycol (Transcutol), alkyl-N,N-disubstituted aminoacetates, for example dodecyl-N,N-dimethyl-aminoacetate, esters, for example ethylacetate, Azone and derivatives, surfactants, for example sodium dodecyl sulphate, terpenes and terpenoids, for example d-Limonene, fatty acids, for example oleic acid, urea and derivatives, for example 1,3-Diphenyl-urea, pyrrolidones, for example N-Methyl-2-pyrrolidone, and 2-pyrrolidone-5-carboxylic acid, cyclodextrins, for example beta-cyclodextrin, sulphoxides, for example dimethylsulphoxide. Other skin penetration enhancers are known to the skilled person. In one embodiment, the enhancer is not water. In one embodiment, the skin penetration enhancers are selected from one or more of Propylene Glycol, Isopropyl Myristate and Azone. Preferred penetration enhancers are DMSO, azone, Transcuto, isopropyl myristate, oleic acid or combinations thereof, for example as set out in table 6 and in the examples.
[0276] In one embodiment, the penetration enhancer is not one or more of water, ethanol, polyethylene glycol derivatives, polyoxyethylene derivatives such as polysorbate, a fatty alcohol such as cetyl alcohol, stearyl alcohol, or cerostearyl alcohol, glycerol and propylene glycol.
[0277] The amount of the binding molecule of the present invention that is effective/active in the treatment of a particular disease will depend on the nature of the disease, and can be determined by standard clinical techniques. In addition, in vitro or in vivo assays can optionally be employed to help identify optimal dosage ranges. The precise dose to be employed in the compositions will also depend on the route of administration, and the seriousness of the disease, and should be decided according to the judgment of the practitioner and each patient's circumstances.
[0278] Compositions of the invention comprise an effective amount of a binding molecule of the present invention such that a prophylactically- or therapeutically-effective dosage will be obtained. The correct dosage of the compounds will vary according to the particular formulation, the mode of application, and its particular site, and the disease being treated. Other factors like age, body weight, sex, diet, time of administration, rate of excretion, drug combinations, reaction sensitivities and severity of the disease shall be taken into account. Administration can be carried out continuously or periodically within the maximum tolerated dose.
[0279] Typically, this amount is at least about 0.01% of a binding molecule of the present invention by weight of the composition.
[0280] Preferred compositions of the present invention are prepared so that a parenteral dosage unit contains from about 0.01% to about 2% by weight of the binding molecule of the present invention.
[0281] For intravenous administration, the composition can comprise from about typically about 0.1 mg/kg to about 250 mg/kg of the animal's body weight, preferably, between about 0.1 mg/kg and about 20 mg/kg of the animal's body weight, and more preferably about 1 mg/kg to about 10 mg/kg of the animal's body weight.
[0282] The present compositions can take the form of suitable carriers, such aerosols, sprays, suspensions, or any other form suitable for use. Other examples of suitable pharmaceutical carriers are described in Remington's Pharmaceutical Sciences by E. W. Martin.
[0283] Liposomes and micelles can also be used according to the invention.
[0284] Liposomes are microscopic vesicles having a lipid wall comprising a lipid bilayer, and, in the present context, encapsulate heavy chain only antibody or composition of the invention. Liposomal preparations herein include cationic (positively charged), anionic (negatively charged), and neutral preparations. Cationic liposomes are readily available. For example, N[1-2,3-dioleyloxy)propyl]-N,N,N-triethyl-ammonium (DOTMA) liposomes are available under the tradename Lipofectin (GIBCO BRL, Grand Island, N.Y.). Similarly, anionic and neutral liposomes are readily available as well or can be easily prepared using readily available materials. Such materials include phosphatidyl choline, cholesterol, phosphatidyl ethanolamine, dioleoylphosphatidyl choline (DOPC), dioleoylphosphatidyl glycerol (DOPG), and dioleoylphoshatidyl ethanolamine (DOPE), among others. These materials can also be mixed with DOTMA in appropriate ratios. Methods for making liposomes using these materials are well known in the art.
[0285] Micelles are known in the art as comprised of surfactant molecules arranged so that their polar headgroups form an outer spherical shell, while the hydrophobic, hydrocarbon chains are oriented towards the center of the sphere, forming a core. Micelles form in an aqueous solution containing surfactant at a high enough concentration so that micelles naturally result. Surfactants useful for forming micelles include, but are not limited to, potassium laurate, sodium octane sulfonate, sodium decane sulfonate, sodium dodecane sulfonate, sodium lauryl sulfate, docusate sodium, decyltrimethylammonium bromide, dodecyltrimethylammonium bromide, tetradecyltrimethylammonium bromide, tetradecyltrimethyl-ammonium chloride, dodecylammonium chloride, polyoxyl-8 dodecyl ether, polyoxyl-12 dodecyl ether, nonoxynol 10, and nonoxynol 30.
[0286] Microspheres, similarly, may be incorporated into the present formulations. Like liposomes and micelles, microspheres essentially encapsulate one or more components of the present formulations. They are generally although not necessarily formed from lipids, preferably charged lipids such as phospholipids. Preparation of lipidic microspheres is well known in the art and described in the pertinent texts and literature.
[0287] The pharmaceutical compositions can be prepared using methodology well known in the pharmaceutical art. For example, a composition can be prepared by combining a binding molecule of the present invention with water so as to form a solution. A surfactant can be added to facilitate the formation of a homogeneous solution or suspension.
[0288] The invention furthermore relates to a method for the prevention and/or treatment of a disease, said method comprising administering, to a subject in need thereof, a pharmaceutically active amount of a binding molecule of the invention, and/or of a pharmaceutical composition of the invention. More in particular, the invention relates to a method for the prevention and/or treatment of a disease selected from the non-limiting group consisting of the diseases listed herein, said method comprising administering, to a subject in need thereof, a pharmaceutically active amount of a binding molecule of the invention, and/or of a pharmaceutical composition of the invention. Examples of the immune related diseases that can be treated according to the invention will be clear to the skilled person based on the disclosure herein, and for example include autoimmune diseases, inflammatory conditions, allergies and allergic conditions, hypersensitivity reactions, severe infections, and organ or tissue transplant rejection.
[0289] The invention also relates to a binding molecule or pharmaceutical composition of the invention for use in the treatment of disease. In another aspect, the invention relates to a binding molecule of the invention for use in the treatment of a disease, for example autoimmune diseases, inflammatory conditions, allergies and allergic conditions, hypersensitivity reactions, severe infections, and organ or tissue transplant rejection.
[0290] In another aspect, the invention relates to the use of a binding molecule of the invention in the manufacture of a medicament for the treatment of a disease, for example autoimmune diseases, inflammatory conditions, allergies and allergic conditions, hypersensitivity reactions, severe infections, and organ or tissue transplant rejection.
[0291] The disease according to the aspects set out above may be selected from the following non-limiting list: psoriasis, systemic lupus erythematosis, rheumatoid arthritis, osteoarthritis, juvenile chronic arthritis, spondyloarthropathies, systemic sclerosis, idiopathic inflammatory myopathies, Sjogren's syndrome, systemic vasculitis, sarcoidosis, autoimmune hemolytic anemia, autoimmune thrombocytopenia, thyroiditis, diabetes mellitus, immune-mediated renal disease, demyelinating diseases of the central and peripheral nervous systems such as multiple sclerosis, idiopathic demyelinating polyneuropathy or Guillain Barre syndrome, and chronic inflammatory demyelinating polyneuropathy, hepatobiliary diseases such as infectious, autoimmune chronic active hepatitis, primary biliary cirrhosis, granulomatous hepatitis, and sclerosing cholangitis, inflammatory bowel disease, gluten-sensitive enteropathy, and Whipple's disease, autoimmune or immune-mediated skin diseases including bullous skin diseases, erythema multiforme and contact dermatitis, allergic diseases such as asthma, allergic rhinitis, atopic dermatitis, food hypersensitivity and urticaria, immunologic diseases of the lung such as eosinophilic pneumonia, idiopathic pulmonary fibrosis and hypersensitivity pneumonitis, autoimmune haematological disorders (including e.g. hemolytic anaemia, aplastic anaemia, pure red cell anaemia and idiopathic thrombocytopenia), autoimmune inflammatory bowel disease (including e.g. ulcerative colitis, Crohn's disease and Irritable Bowel Syndrome), transplantation associated diseases including graft rejection and graft-versus-host-disease.
[0292] In a preferred embodiment, the disease is selected from psoriasis, spondyloarthropathies, uveitis and atopic dermatitis. In another embodiment, the disease is asthma.
[0293] Binding molecules of the invention are also useful for the treatment, prevention, or amelioration of asthma, bronchitis, pneumoconiosis, pulmonary emphysema, and other obstructive or inflammatory diseases of the airways. Binding molecules of the invention are useful for treating undesirable acute and hyperacute inflammatory reactions which are mediated by IL-17RA, or involve IL-17RA production, or the promotion of TNF release by IL-17RA, e.g. acute infections, for example septic shock (e.g., endotoxic shock and adult respiratory distress syndrome), meningitis, pneumonia; and severe burns; and for the treatment of cachexia or wasting syndrome associated with morbid TNF release, consequent to infection, cancer, or organ dysfunction, especially AIDS-related cachexia, e.g., associated with or consequential to HTV infection.
[0294] Binding molecules of the invention are particularly useful for treating diseases of bone metabolism including osteoarthritis, osteoporosis and other inflammatory arthritis, and bone loss in general, including age-related bone loss, and in particular periodontal disease.
[0295] Binding molecules of the invention may be administered as the sole active ingredient or in combination with one or more other drug, e.g., immunosuppressive or immunomodulating agents or other anti-inflammatory agents, e.g., for the treatment or prevention of diseases mentioned above. For example, the binding molecule of the invention maybe used in combination with immunosuppressive monoclonal antibodies, e.g., monoclonal antibodies to leukocyte receptors, e.g., MHC, CD2, CD3, CD4, CD7, CD8, CD25, CD28, CD40. CD45, CD58, CD80, CD86 or their ligands; other immunomodulatory compounds, e.g. a recombinant binding molecule having at least a portion of the extracellular domain of CTLA4 or a mutant thereof, e.g., an at least extracellular portion of CTLA4 or a mutant thereof joined to a non-CTLA4 protein sequence, e.g. CTLA4Ig (e.g., designated ATCC 68629) or a mutant thereof, e.g., LEA29Y; adhesion molecule inhibitors, e.g., LFA-I antagonists, ICAM-I or -3 antagonists, VCAM-4 antagonists or VLA-4 antagonists; or a chemotherapeutic agent, e.g., paclitaxel, gemcitabine, cisplatinum, doxorubicin or 5-fluorouracil; anti-TNF agents, e.g., monoclonal antibodies to TNF, e.g., infliximab, adalimumab, CDP870, or receptor constructs to TNF-RI or TNF-RII, e.g., Etanercept, PEG-TNF-RI; blockers of proinflammatory cytokines, IL-I blockers, e.g., Anakinra or IL-1 trap, AAL160, ACZ 885, IL-6 blockers; chemokines blockers, e.g., inhibitors or activators of proteases, e.g. metalloproteases, anti-IL-15 antibodies, anti-IL-6 antibodies, anti-CD20 antibodies, NSAIDs, such as aspirin or an anti-infectious agent. This list is not limited to the agents mentioned.
[0296] The binding molecule of pharmaceutical composition of the invention may administered at the same time or at a different time as the other drug. Administration may be simultaneously, sequentially or separately.
[0297] The invention also relates to methods for diagnosing a disease. Exemplary diseases are listed above. In one embodiment, the disease is psoriasis. The method comprises determining the level of IL-17RA expression by detecting binding of a binding molecule described herein in a sample and comparing the level of expression of IL-17RA in the test sample with the level of expression in a control sample from a non-psoriatic subject or with a standard value or standard value range for a non-psoriatic subject. An elevation in IL-17RA expression in the test sample relative to the control or standard indicates presence of the disease.
[0298] In another aspect, the invention provides a kit comprising a binding molecule of the invention useful for the treatment of a disease described above and optionally instructions for use.
[0299] The invention also relates to detection methods using the binding molecule of the invention. Given their ability to bind to human IL-17RA, the human-IL-17RA-binding molecules disclosed herein can be used to detect IL-17RA (e.g., in a biological sample, such as serum or plasma), using a conventional immunoassay, such as an enzyme linked immunosorbent assays (ELISA), a radioimmunoassay (RIA) or tissue immunohistochemistry. A method for detecting IL-17RA in a biological sample is provided comprising contacting a biological sample with a binding molecule disclosed herein and detecting either the binding molecule bound to IL-17RA or unbound binding molecule, to thereby detect IL-17RA in the biological sample. The binding molecule can be directly or indirectly labeled with a detectable substance to facilitate detection of the bound or unbound molecule. Suitable detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials and radioactive materials.
[0300] Alternative to labeling the binding molecule, human IL-17RA can be assayed in biological fluids by a competition immunoassay utilizing IL-17RA standards labeled with a detectable substance and an unlabeled human IL-17RA binding molecule. In this assay, the biological sample, the labeled IL-17RA standards and the human IL-17RA binding molecule are combined and the amount of labeled IL-17RA standard bound to the unlabeled binding molecule is determined. The amount of human IL-17RA in the biological sample is inversely proportional to the amount of labeled IL-17RA standard bound to the IL-17RA binding molecule. Similarly, human IL-17RA can also be assayed in biological fluids by a competition immunoassay utilizing IL-17RA standards labeled with a detectable substance and an unlabeled human IL-17RA binding molecule.
[0301] As explained herein, binding molecules of the invention are capable of neutralizing IL-17RA activity, e.g., human IL-17RA activity, both in vitro and in vivo.
[0302] Accordingly, such binding molecules disclosed herein can be used to inhibit IL-17RA activity, e.g., in a cell culture containing IL-17RA, in human subjects or in other mammalian subjects having IL-17RA with which a binding molecule disclosed herein cross-reacts. In one embodiment, a method for inhibiting or increasing IL-17RA activity is provided comprising contacting IL-17RA with a binding molecule disclosed herein such that IL-17RA activity is inhibited or increased. For example, in a sample containing, or suspected of containing IL-17RA, a binding molecule disclosed herein can be added to the culture medium to inhibit IL-17RA activity in the sample.
[0303] Unless otherwise defined herein, scientific and technical terms used in connection with the present disclosure shall have the meanings that are commonly understood by those of ordinary skill in the art. While the foregoing disclosure provides a general description of the subject matter encompassed within the scope of the present invention, including methods, as well as the best mode thereof, of making and using this invention, the following examples are provided to further enable those skilled in the art to practice this invention and to provide a complete written description thereof. However, those skilled in the art will appreciate that the specifics of these examples should not be read as limiting on the invention, the scope of which should be apprehended from the claims and equivalents thereof appended to this disclosure. Various further aspects and embodiments of the present invention will be apparent to those skilled in the art in view of the present disclosure.
[0304] All documents mentioned in this specification are incorporated herein by reference in their entirety, including references to gene accession numbers.
[0305] and/or where used herein is to be taken as specific disclosure of each of the two specified features or components with or without the other. For example A and/or B is to be taken as specific disclosure of each of (i) A, (ii) B and (iii) A and B, just as if each is set out individually herein. Unless context dictates otherwise, the descriptions and definitions of the features set out above are not limited to any particular aspect or embodiment of the invention and apply equally to all aspects and embodiments which are described.
[0306] The invention is further described in the non-limiting examples.
EXAMPLES
Example 1. Construction of Tg/TKO Mice
[0307] Mice carrying a heavy-chain antibody transgenic locus in germline configuration within a background that is silenced for endogenous heavy and light chain antibody expression (triple knock-out, or TKO) were created as previously described (WO2004/076618 and WO2003/000737, Ren et al. Genomics, 84, 686, 2004; Zou et al., J. Immunol., 170, 1354, 2003). Briefly, transgenic mice were derived following pronuclear microinjection of freshly fertilised oocytes with a yeast artificial chromosome (YAC) comprising a plethora of human V.sub.H, D and J genes in combination with mouse immunoglobulin constant region genes lacking C.sub.H1 domains, mouse enhancer and regulatory regions. Yeast artificial chromosomes (YACs) are vectors that can be employed for the cloning of very large DNA inserts in yeast. As well as comprising all three cis-acting structural elements essential for behaving like natural yeast chromosomes (an autonomously replicating sequence (ARS), a centromere (CEN) and two telomeres (TEL)), their capacity to accept large DNA inserts enables them to reach the minimum size (150 kb) required for chromosome-like stability and for fidelity of transmission in yeast cells. The construction and use of YACs is well known in the art (e.g., Bruschi, C. V. and Gjuracic, K. Yeast Artificial Chromosomes, ENCYCLOPEDIA OF LIFE SCIENCES 2002 Macmillan Publishers Ltd, Nature Publishing Group/www.els.net).
[0308] The YAC used was about 340 kb comprises 10 human heavy chain V genes in their natural configuration, human heavy chain D and J genes, a murine C1 gene and a murine 3 enhancer gene. It lacks the C.sub.H1 exon. Specifically, the YAC comprised (from 5 to 3): telomere-yeast TRP1 marker gene-Centromere-10 human V genes-human D genes-human J genes-mouse p enhancer and switch-mouse C1 (C.sub.H1) gene-mouse 3 enhancer-Hygromycin resistant gene-yeast marker gene HIS3-telomere.
[0309] The transgenic founder mice were back-crossed with animals that lacked endogenous immunoglobulin expression to create the Tg/TKO lines used in the immunisation studies described.
Example 2. Antigen for Immunisation
[0310] The immunisations used recombinant purified protein. Recombinant human IL-17RA was purchased from R&D systems (177-IR-100).
Example 3. Immunisation Protocol
[0311] In the present case, recombinant protein was administered to the Tg/TKO. Briefly, mice aged 8-12 weeks of age each received a total of 10 ug of recombinant protein, emulsified in Complete Freund's Adjuvant and delivered subcutaneously, followed by boosts of 1-10 ug of recombinant protein, emulsified in Incomplete Freund's Adjuvant, also administered subcutaneously, given at various intervals following the initial priming. A final dose of antigen was administered intraperitoneally, in phosphate buffered saline, in the absence of adjuvant.
[0312] Alternative immunisation routes and procedures can also be employed. For example, different adjuvants or immune potentiating procedures may be used instead of Freund's adjuvant. DNA immunisations are often delivered intramuscularly or via a Genegun. Transfected cells or membrane preparations from such cells are often, although not exclusively, administered intraperitoneally.
Example 4. Serum ELISA
[0313] During and following immunisation, serum was collected from mice and checked for the presence of heavy-chain antibody responses to the immunogen by ELISA. Nunc Maxisorp plates (Nunc Cat. No. 443404) were coated overnight at 4 C. with 50 ul/well of a 5 ug recombinant antigen/ml of PBS solution. Following decanting of the antigen solution, plates were washed using PBS (prepared from PBS tablets, Oxoid cat no. BR0014G) supplemented with 0.05% Tween20 (sigma P1379), followed by washes with PBS without added Tween. To block non-specific protein interactions, a solution of 3% skimmed milk powder (Marvel) in PBS was added to the wells and the plate was incubated for at least one hour at room temperature. Dilutions of serum in 3% Marvel/PBS were prepared in polypropylene tubes or plates and incubated for at least one hour at room temperature prior to transfer to the blocked ELISA plate where a further incubation of at least one hour took place. Unbound protein was then washed away using repetitive washes with PBS/Tween followed by PBS. A solution of biotin-conjugated, goat anti mouse IgG, Fcgamma subclass 1 specific antibody (Jackson 115-065-205), prepared in PBS/3% Marvel was then added to each well and a further incubation at room temperature for at least one hour took place. Unbound detection antibody was removed by repeated washing using PBS/Tween and PBS. Neutravidin-HRP solution (Pierce 31030) in 3% Marvel/PBS was then added to the ELISA plates and allowed to bind for at least 30 minutes. Following further washing, the ELISA was developed using TMB substrate (Sigma cat. no. T0440) and the reaction was stopped after 10 minutes by the addition of 0.5M H.sub.2SO.sub.4 solution (Sigma cat. no. 320501). Absorbances were determined by reading at 450 nm. Examples of Serum ELISA data are shown in
Example 5. Generation of Libraries from Immunised Mice
[0314] a. Processing Tissues, RNA Extraction and cDNA Manufacture
[0315] Spleen, inguinal and brachial lymph nodes were collected into RNAlater from each immunised animal. For each animal, of the spleen and 4 lymph nodes were processed separately. Initially, the tissues were homogenised; following transfer of tissues to Lysing matrix D bead tubes (MP Bio cat#116913100), 600 ul of RLT buffer containing -mercaptoethanol (from Qiagen RNeasy kit cat#74104) was added before homogenisation in a MP Bio Fastprep homogeniser (cat #116004500) using 6 m/s 40 seconds cycles. The tubes containing the homogenised tissues were transferred to ice and debris was pelleted by microcentrifugation at 10 g for 5 minutes. 400 ul of the supernatant was removed and used for RT-PCR.
[0316] Initially, RNA was extracted using Qiagen RNeasy kit cat#74104 following the manufacturer's protocol. Each RNA sample was then used to make cDNA using Superscript III RT-PCR high-fidelity kit (Invitrogen cat #12574-035). For each spleen and LN RNA sample, 5 RT-PCR reactions were performed, each with VH_J/F (long) primer in combination with a primer for V.sub.H1, V.sub.H2, V.sub.H3, V.sub.H4 or V.sub.H6 family. Details of the primers are below in Table 8.
TABLE-US-00010 TABLE8 Primers V1a/pelB GCCGCTGGATTGTTATTACTCGCGGCCCAGCCGG (long) CCATGGCCCAGGTBCAGCTGGTGCAGTCTGGGGC TGAGGSEQIDNO2595 V2/pelB GCCGCTGGATTGTTATTACTCGCGGCCCAGCCGG (long) CCATGGCCCAGATCACCTTGAAGGAGTCTGG SEQIDNO2596 V3/pelB GCCGCTGGATTGTTATTACTCGCGGCCCAGCCGG (long) CCATGGCCSAGGTGCAGCTGGTGGAGTCTGGGGG AGGSEQIDNO2597 V4- GCCGCTGGATTGTTATTACTCGCGGCCCAGCCGG 4/pelB CCATGGCCCAGGTGCAGCTGCAGGAGTCGGG (long) SEQIDNO2598 V6/pelB GCCGCTGGATTGTTATTACTCGCGGCCCAGCCGG (long) CCATGGCCCAGGTACAGCTGCAGCAGTCAGG SEQIDNO2599 VH_J/F CCGTGGTGATGGTGGTGATGGCTACCGCCACCCT (long) CGAGTGARGAGACRGTGACC SEQIDNO2600 Residues in bold have homology with pUCG3
[0317] Mastermixes were prepared for the RT-PCR reactions, based on the following tube reaction components.
TABLE-US-00011 12.5 l 2x reaction mix 0.5 l forward primer (10 uM) 0.5 l reverse primer (10 uM) 0.5 l enzyme mix 500 ng-1 g RNA Up to 25 l with water
[0318] The RT-PCR reactions were carried out in a thermal cycler using the following conditions;
TABLE-US-00012 50 C. 20 min 94 C. 2 min 35 cycles of 94 C. 15 sec 58 C. 30 sec 68 C. 30 sec 68 C. 5 min Hold at 4 C.
[0319] Products in the range of 370 bp were confirmed by gel electrophoresis.
[0320] For each mouse, the V.sub.H products amplified for a given family from the spleen and each of the 4 lymph nodes were then pooled for purification using Thermo/Fermentas GeneJet PCR purification kit (cat #K0702) which was used according to the Manufacturer's instructions, with the products eluted in 50 ul of water.
[0321] b. Cloning into Phagemid Vector
[0322] The phagemid vector, pUCG3, was employed in these studies. As indicated, V.sub.H may be cloned into pUCG3, using conventional methods involving restriction enzyme digestions with NcoI and XhoI, ligation and transformation. Alternatively, a PCR-based method may be used to construct the V.sub.H phagemid libraries. Both of these procedures were used to generate libraries from the amplified V.sub.H sequences. The former method is widely used in the art. For the PCR-based method, the following procedure was used:
[0323] A linearised version of pUCG3 was created using PCR; with the following primers:
TABLE-US-00013 pUCG3-F3 SEQIDNO.2601 CTCGAGGGTGGCGGTAGCCATCACCACCATC pUCG3-R3 SEQIDNO.2602 TCCATGGCCATCGCCGGCTGGGCCGCGAG
[0324] Phusion High fidelity PCR master mix with GC buffer (cat # F532L, NEB) was used for the PCR reactions which comprised the following reagents;
TABLE-US-00014 Phusion GC 2x mix 25 ul pUCG3 5-10 ng Primers (10 uM) 1.25 l of each DMSO 1.5 l Nuclease-free H.sub.2O to final volume of 50 ul
[0325] The cycling conditions used were
TABLE-US-00015 98 C. 30 seconds 10 cycles of 98 C. 10 seconds 58 C. 20 seconds 68 C. 2 minutes, 30 seconds 20 cycles of 98 C. 10 seconds 58 C. 20 seconds 68 C. 3 minutes 68 C. 5 minutes 4 C. hold
[0326] The PCR product (3152 bp) was gel purified using Fermentas GeneJet Gel purification kit (cat # K0691), according to the manufacturer's instructions, with final elution in 40 ul of elution buffer.
[0327] The purified V.sub.H RT-PCR products were employed as megaprimers with the linearised pUCG3 to give phagemid products for transformation and library creation, based on the following reactions;
TABLE-US-00016 Phusion GC 2x mix 25 l Linearised pUCG3 700 ng V.sub.H PCR product 250 ng DMSO 1.5 l Nuclease-free H.sub.2O to 50 l final volume PCR was performed as follows; 98 C. 30 sec 98 C. 10 sec 58 C. 20 sec {close oversize brace} 10 cycles 72 C. 2 min 72 C. 5 min Hold at 10 C.
[0328] The products of PCR were analysed on a 1% agarose gel.
[0329] The various family V.sub.H/phagemid products were purified using Ferment as PCR purification kit (cat #K0702) according to the manufacturer's instructions with the final elution being in 25 ul H.sub.2O and used for transformations of TG1 E. coli (Lucigen, Cat: 60502-2) by electroporation using BioRad 101 mm cuvettes (BioRad cat #165-2089, a Eppendorf Eporator and pre-warmed recovery medium (Lucigen, proprietary mix). 2 ul of the purified products were added to 25 ul of cells for the electroporation, with up to 10 electroporations being performed for each V.sub.H/phagemid product at 1800v. Electroporated cells were pooled and recovered in 50 ml Falcon tubes incubated for 1 hour at 37 C. with shaking at 150 rpm. A 10-fold dilution series of an aliquot of the transformations was performed and plated in petri dishes containing 2TY agar supplemented with 2% (w/v) glucose and 100 ug/ml ampicillin. Resulting colonies on these dishes were used to estimate the library size. The remainder of the transformation was plated on large format Bioassay dishes containing 2TY agar supplemented with 2% (w/v) glucose and 100 ug/ml ampicillin. All agar plates were incubated overnight at 30 C. 10 ml of 2TY broth was added to the large format bioassay dishes and colonies were scraped and OD600 measured (OD of 1.0=510.sup.8 cells/ml). Aliquots were stored at 80 C. in cryovials after addition of 50% v/v glycerol solution (50%) or used directly in a phage selection process.
[0330] In some instances, clones were picked directly and sequence was determined to give an estimate of the diversity of the library. Typically, for each mouse a phage display library with greater than 1e8 recombinants was constructed to fully capture the V.sub.H diversity in that mouse.
Example 6. Selection Strategies for Isolation of IL-17RA-Binding V.SUB.H
[0331] Preparation of library phage stocks and phage display selections were performed according to published methods (Antibody Engineering, Edited by Benny Lo, chapter 8, p 161-176, 2004). In most cases, phage display combined with a panning approach was used to isolate binding V.sub.H domains. However, a variety of different selection methods may be employed, including (a) soluble selections; (b) selections performed under stress, where phage are heated at 70 C. for 2 hours prior to selection; and (c) competitive selections, where excess antigen or antigen-reactive V.sub.H domains are added as competition to encourage the recovery of high affinity V.sub.H domains or to skew selections away from a particular epitope.
[0332] The IL-17RA antigen was expressed as a fusion with the Fc domain of human IgG1. Therefore, to minimise the isolation of unwanted antibodies to the Fc region of the fusion protein, human IgG1 was added to the phage display selections at 100 ug/ml (approx 650 nM) to compete or deselect for Fc binding V.sub.H. For panning, antigen was immobilised onto maxisorb plates (Nunc 443404) in 50 ul volumes at 0.1-10 ug/ml in PBS. For the libraries from immunised mice, one round of selection was carried out.
Example 7. Assays for Target Binding
[0333] V.sub.H from the different selections were screened in one or more of the following assays to identify specific V.sub.H with neutralising properties.
[0334] a) Binding ELISA
[0335] Following selections of the libraries, specific V.sub.H antibodies were identified by phage ELISA following published methods (Antibody Engineering, Edited by Benny Lo, chapter 8, p 161-176, 2004). Phage ELISAs were performed against target protein and an unrelated antigen as control. In some cases, purified or crude extracts of V.sub.H domains were assayed by ELISA instead of using a phage ELISA. In these cases, bacterial periplasmic extracts or purified V.sub.H were used.
[0336] Small-scale bacterial periplasmic extracts were prepared from 1 ml cultures, grown in deep well plates. Starter cultures were used to inoculate 96-well deep well plates (Fisher, cat# MPA-600-030X) containing 2TY broth (Melford, M2130), supplemented with 0.1% (w/v) glucose+100 ug/ml ampicillin at 37 C. with 250 rpm shaking. When OD600 had achieved 0.6-1, V.sub.H production was induced by adding 100 ul of 2TY, supplemented with IPTG (final concentration 1 mM) and ampicillin and the cultures were grown overnight at 30 C. with shaking at 250 rpm. E. coli were pelleted by centrifugation at 3200 rpm for 10 mins and supernatants discarded. Cell pellets were resuspended in 30-100 ul of ice cold extraction buffer (20% (w/v) sucrose, 1 mM EDTA & 50 mM Tris-HCl pH8.0) by gently pipetting. Cells were incubated on ice for 30 minutes and then centrifuged at 4500 rpm for 15 mins at 4 C. Supernatants were transferred to polypropylene plates and used, following incubation in Marvel/PBS blocking solution, in the ELISA.
[0337] The purified V.sub.H were obtained by using the V.sub.H C-terminal 6HIS tag for nickel-agarose affinity chromatographic purification of the periplasmic extracts. A starter culture of each V.sub.H was grown overnight in 5 ml 2TY broth (Melford, M2103) supplemented with 2% (w/v) glucose+100 ug/ml ampicillin at 30 C. with 250 rpm shaking. 50 ul of this overnight culture was then used to inoculate 50 ml 2TY supplemented with 2% (w/v) glucose+100 ug/ml ampicillin and incubated at 37 C. with 250 rpm shaking for approximately 6-8 hours (until OD600=0.6-1.0). Cultures were then centrifuged at 3200 rpm for 10 mins and the cell pellets resuspended in 50 ml fresh 2TY broth containing 100 ug/ml ampicillin+1 mM IPTG. Shake flasks were then incubated overnight at 30 C. and 250 rpm. Cultures were again centrifuged at 3200 rpm for 10 mins and supernatants discarded. Cell pellets were resuspended in 1 ml ice cold extraction buffer (20% (w/v) sucrose, 1 mM EDTA & 50 mM Tris-HCl pH8.0) by gently pipetting and then a further 1.5 ml of 1:5 diluted ice cold extraction buffer added. Cells were incubated on ice for 30 minutes and then centrifuged at 4500 rpm for 15 mins at 4 C. Supernatants were transferred to 50 ml Falcon tubes containing imidazole (Sigma, 12399final concentration 10 mM) and 0.5 ml of nickel agarose beads (Qiagen, Ni-NTA 50% soln, 30210) pre-equilibrated with PBS buffer. V.sub.H binding to the nickel agarose beads was allowed to proceed for 2 hours at 4 C. with gentle shaking. The nickel agarose beads were then transferred to a polyprep column (BioRad, 731-1550) and the supernatant discarded by gravity flow. The columns were then washed 3 times with 5 ml of PBS+0.05% Tween followed by 3 washes with 5 ml of PBS containing imidazole at a concentration of 20 mM. V.sub.H were then eluted from the columns by the addition of 250 ul of PBS containing imidazole at a concentration of 250 mM. Imidazole was then removed from the purified V.sub.H preparations by buffer exchange with NAP-5 columns (GE Healthcare, 17-0853-01) and then eluting with 1 ml of PBS. Yields of purified V.sub.H were estimated spectrophotemetrically and purity was assessed using SDS PAGE.
[0338] The binding ELISA for crude or purified V.sub.H was similar to the serum ELISA and phage ELISA, previously described, mostly differing in the final detection steps. Briefly, antigen was immobilised on maxisorb plates (Nunc 443404) by adding 50 ul volumes at 0.1-1 ug/ml in PBS and incubating at 4 C. overnight. Following coating, the antigen solution was aspirated and the plates were washed using PBS (prepared from PBS tablets, Oxoid cat no. BR0014G) supplemented with 0.05% Tween 20 (sigma P1379), followed by washes with PBS without added Tween. To block non-specific protein interactions, a solution of 3% skimmed milk powder (Marvel) in PBS was added to the wells and the plate was incubated for at least one hour at room temperature. Dilutions of periplasmic extract or purified V.sub.H in 3% Marvel/PBS were prepared in polypropylene tubes or plates and incubated for at least one hour at room temperature prior to transfer to the blocked ELISA plate where a further incubation of at least one hour took place. Unbound protein was then washed away using repetitive washes with PBS/Tween followed by PBS. A solution of HRP-conjugated anti-His Ab (Miltenyi Biotec, 130-092-785), prepared at 1:1000 dilution in PBS/3% Marvel was then added to each well and a further incubation at room temperature for at least one hour took place. Unbound detection antibody was removed by repeated washing using PBS/Tween and PBS. The ELISA was then developed using TMB substrate (Sigma cat. no. T0440) and the reaction was stopped after 10 minutes by the addition of 0.5M H.sub.2SO.sub.4 solution (Sigma cat. no. 320501). Absorbances were determined by reading at 450 nm. Example ELISA data is shown in
[0339] b) R/L Biochemical Inhibition Assay
[0340] V.sub.H, both purified and crude periplasmic extracts, were also tested for their ability to inhibit the interaction of IL-17A with recombinant IL-17RA-Fc. Maxisorb 96F well mictrotitre plates were incubated with 50 ul solution of 2 nM IL-17-RA (R & D systems, cat #177-IR-100) and incubated overnight at 4 C. Following washing of excess coating antigen, as described above, the wells of the plate were incubated with 3% Marvel/PBS to block non-specific protein interactions. V.sub.H preparations, crude periplasmic extracts or purified V.sub.H, or suitable controls, were prepared with 1 nM recombinant IL-17A (Peprotech, cat# AF-200-17) in 3% skimmed milk powder/PBS solution in polypropylene plates or tubes. The mixture was then transferred to the assay plate and incubated for 1 hour at room temperature. Excess protein was removed by washing and bound IL-17A was detected by incubation with biotinylated anti-IL-17A Mab (R & D Systems, cat BAF317) followed by the addition of neutravidin-HRP (Pierce, cat#31030) and TMB substrate (Sigma, cat# T0440). The TMB reaction was stopped by addition of 0.5M H.sub.2SO.sub.4 and absorbances were measured at 450 nm in a plate reader.
[0341] Where appropriate, curve fitting in PRISM was used to determine the EC.sub.50 of inhibiting V.sub.H. Example data illustrating inhibition of IL-17A responses in the biochemical assay are shown in
[0342] c) R/L Cell Based Inhibition Assay
[0343] An assay was developed to measure the ability of IL-17RA-binding V.sub.H to inhibit IL-17A-induced IL6 release from the cell line, HT1080 (ECACC cat #85111505). The cell line was maintained in exponential growth in MEM with Earles's salts, supplemented with non-essential amino acids, 10% FBS, 2 mM L-Glutamine and penicillin/streptomycin and incubated in a humidified incubator at 37 C., 5% CO.sub.2. For the assay, 50,000 cells/well were seeded into a 96 flat bottomed tissue culture plate and cultured overnight. Serial dilution of purified V.sub.H were prepared and incubated at 37 C. for 1 hour with culture medium/PBS supplemented with 10 ng/ml IL-17A (Peprotech cat# AF200-17). Following incubation, the V.sub.H/IL-17A mixture (or suitable controls) were transferred to the HT1080 cells (from which culture medium had been aspirated) and incubated for a further 5 hours in the CO.sub.2 incubator. The cell culture supernatant was collected and assayed for IL6 using the IL-6 Duoset (R & D Systems, cat# DY206), following manufacturer's instructions. Example data illustrating inhibition of IL-17A responses in the cell based assay are shown in
[0344] d) Biacore.
[0345] Binding kinetics of anti-IL-17RA V.sub.H antibodies were measured on a BIAcore T200 instrument. For IL-17RA, first a protein G chip was prepared by diluting protein G to 20 ug/ml in acetate buffer, pH 4 (BIAcore, cat# BR-100-49) and then coupled 1200 RU to a CM5 Series S chip using amine coupling chemistry. This surface was then used to capture IL-17RA Fc fusion protein from solution: IL-17RA at 10 ug/ml in HBS injected for 10 seconds at 30 ul/min flow rate would capture approximately 100-150 RU of IL-17RA onto the protein G surface.
[0346] Binding kinetics of anti-IL-17RA V.sub.H antibodies were determined by single-cycle kinetics. V.sub.H antibodies were prepared in dilution series (typically 1:3 dilution series starting with 100 nM V.sub.H at the highest concentration), and then injected over the antigen coated surfaces and also a blank surface, starting with the lowest concentration of V.sub.H and then working progressively up to the highest concentration. V.sub.H binding kinetics were then determined from the (blank subtracted) sensorgram traces using 1:1 binding models and BIAevaluation software. Example BIAcore binding traces are shown in
[0347] Following the above screening cascade, a number of V.sub.H to IL-17R were identified that demonstrated inhibitory properties. These are summarised below in table 9. The clones are the parent clones for optimisation.
TABLE-US-00017 TABLE9 Cell Biochem assay BIAcore Clone IC50 IC50 (Affinity) name CDR3sequence (nM) (nM) KD(M) IL- Immunised 2.1 GRRDDWKNNY 3.7 280 7.0E-09 17RA mouse SEQIDNO1267 1.1 EKGLGFCRGGSCSY nd 4.7 6.3E-11 FDY SEQIDNO3 5.1 NGARYNWNYGDFQH 80 73 4.1E-08 SEQIDNO2559 4.1 GGYNAWRTDY nd 282 4.5E-09 SEQIDNO2131 3.1 GWESGWFEP 11 Weak 9.6E-09 SEQIDNO1767 6.1 KDITNIAVGSLGY nd 233 3.1E-08 SEQIDNO2575 7.1 SRDWGSRAFDI nd 1840 3.7E-07 SEQIDNO2579
Example 8. Optimisation of V.SUB.H
[0348] a. Optimisation of V.sub.H Isolated from Immunised Mice
[0349] Where appropriate, a novel optimisation strategy was used to increase binding affinities of V.sub.H isolated from immunised mice. Lead VH were aligned with other members of the same lineage to identify somatic hypermutation hot-spots targeted during the immune response (
[0350] As an example for IL-17RA, clone 2.1 was isolated directly from immunised TKO mouse. This V.sub.H was shown to bind IL-17RA with high affinity Alignment of clone 2.1 with other members of the same lineage identified a number of amino acid positions that had been mutated during the immune response, and both V.sub.H-CDRs and V.sub.H-framework regions were affected. This information was then utilised to design a new clone 2.1 recombination library with the aim of identifying a higher affinity variant of clone 2.1. Following construction and phage display selection of a recombination library a new variant was isolated (2.2) that was improved in affinity by 10-fold.
[0351] Phusion High fidelity PCR master mix with HF buffer (cat # F531L, NEB) was used for the PCR reactions which were set up for each primer pairing as follows:
TABLE-US-00018 Phusion HF 2x mix 25 l Primers (10 uM) 1.25 l each (pairings as in table) 53F9 plasmid DNA (34 ng/ul) 0.5 l Nuclease-free H.sub.2O to 50 ul final volume PCR was performed as follows; 98 C. 30 sec 98 C. 10 sec 58 C. 20 sec {close oversize brace} 31 cycles 72 C. 20 sec 72 C. 10 min Hold at 10 C.
[0352] The products of each PCR were analysed on a 1% agarose gel. Each product was then purified using Fermentas PCR purification kit (K0701) into 40 ul elution buffer. Assembly PCRs were then set up to rebuild the full V.sub.H sequence:
TABLE-US-00019 Phusion HF 2x mix 25 l Purified PCR product 1 5 l Purified PCR product 2 5 l Purified PCR product 3 5 l Purified PCR product 4 5 l Purified PCR product 5 5 l PCR was performed as follows; 98 C. 30 sec 98 C. 10 sec 58 C. 20 sec {close oversize brace} 5 cycles 72 C. 20 sec
[0353] Added 0.5 ul of primers V3/pelB (long) and VH_J/F (long) (both 10 uM) to the reaction and then continued for a further 10 PCR cycles at the above conditions. The PCR product was analysed on a 1% agarose gel and purified using Fermentas PCR purification kit into 40 ul elution buffer. The PCR product was then used as a megaprimer for library construction as described above in Example 5, part b. Phage display selections and V.sub.H screening was then performed as described in examples 7 and 8, following which several new variants of clone 2.1 were isolated with up to 10-fold improved affinities.
[0354] Following the lead optimisation steps, the potencies of improved V.sub.H were as follows:
TABLE-US-00020 TABLE10 a)V.sub.Hproducedfollowingoptimisation ofanti-IL-17RAV.sub.Hfamily2 Cell Biochem assay VH IC50 IC50 BIAcore(Affinity) name CDR3sequence (nM) (nM) ka(1/Ms) kd(1/s) KD(M) 2.1 GRRDDWKNNY 3.7 280 3.68E+05 2.63E-03 7.0E-09 SEQIDNO1267 2.3 GRRDNWKNNY 1.3 118 5.55E+05 0.001368 2.50E-09 SEQIDNO1275 2.2 GRRDDWKNNY 1.4 61 5.79E+05 7.99E-04 1.40E-09 SEQIDNO1271
[0355] Optimised V.sub.H show improved affinities to IL-17R and improved potencies in the IL-17R cell based assay due to slower off-rates (
Example 9Characterisation of V.SUB.H
[0356] a. Specificity of Anti-IL-17A
[0357] The specificity of individual V.sub.H for target antigen was confirmed by ELISA, following the methods described in Example 8(a). V.sub.H were tested for binding to IL-17RA and shown not to cross-react with close relatives such as IL-17RB, IL-17RC and IL-17RD. (
[0358] b. Epitope Mapping
[0359] VH were shown to bind to unique epitopes of IL-17RA using a BIAcore T200 instrument. Manual sensorgrams were initiated at 30 ul/min in HBS buffer and V.sub.H injected as appropriate over the IL-17RA coupled CM5 chip coupled CM5 chip, plus a blank surface for reference subtraction (
[0360] For IL-17RA, IL-17RA-Fc fusion protein was first captured on a protein G chip by injecting IL-17RA-Fc at 10 ug/ml in HBS buffer for 10 seconds. This surface was then used to measure binding and competition between different anti-IL-17RA V.sub.H following the method described above. Epitope competition data is presented for 1.1 and 2.2 (
[0361] c. HPLC Size Exclusion Chromatography
[0362] Purified V.sub.H (clones 1.1, 1.2, 2.1) were subjected to size exclusion chromatography. Briefly, purified V.sub.H were analysed using a Water 2795 Separation Module with a Waters 2487 Dual #absorbance Detector(Detected at 280 nM) and a TSKgel G2000SWXL (TOSOH) column. Samples were injected in 10-50 ul volumes and run in mobile phases of either 10% isopropanol/90% PBS or 100 mM Phosphate buffer, pH 6.8, 150 mM NaCl at a flow rate of 0.5 ml/min-0.7 ml/min. Data were collected for up to 35 minutes and the size of the V.sub.H fraction compared with known standards (see