Formulation for antibody and drug conjugate thereof
12115227 ยท 2024-10-15
Assignee
Inventors
- Lene Schantz HARLOW (Frederiksberg, DK)
- Timothy Warren PAUL (Bloomington, IN, US)
- Brendan M. MAYHUGH (Bloomington, IN, US)
- Kelly Ann ROBY (Bloomington, IN, US)
- Gregory Allan SACHA (Bargersville, IN, US)
- Xiaona JING (Riehen, CH)
- Andrew HAGARMAN (Durham, NC, US)
- Cale HALBLEIB (Apex, NC, US)
Cpc classification
C07K16/2863
CHEMISTRY; METALLURGY
A61K47/6811
HUMAN NECESSITIES
A61K47/6921
HUMAN NECESSITIES
A61K47/26
HUMAN NECESSITIES
C07K2317/73
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
A61K9/19
HUMAN NECESSITIES
A61K9/0019
HUMAN NECESSITIES
A61K47/6803
HUMAN NECESSITIES
C07K2317/34
CHEMISTRY; METALLURGY
A61K47/6849
HUMAN NECESSITIES
International classification
A61K39/395
HUMAN NECESSITIES
A61K47/18
HUMAN NECESSITIES
A61K47/26
HUMAN NECESSITIES
A61K47/68
HUMAN NECESSITIES
A61K47/69
HUMAN NECESSITIES
A61K9/00
HUMAN NECESSITIES
A61K9/19
HUMAN NECESSITIES
Abstract
Disclosed herein are surfactant free antibody and antibody-drug-conjugate (ADC) formulations for anti-AXL antibodies and ADCs, including aqueous formulations, lyophilized formulations, and reconstituted formulations, as well as related processes and uses. The formulations are particularly suitable for an anti-AXL ADC based on an auristatin or DM1 derivative or other similarly hydrophobic drugs. Some formulations comprise histidine and mannitol.
Claims
1. A lyophilized formulation of an anti-AXL antibody-drug conjugate (AXL-ADC), the lyophilized formulation obtainable or obtained by lyophilizing an aqueous formulation comprising the AXL-ADC and one or more excipients, wherein the aqueous formulation is free of any surfactant, wherein the drug moiety of the AXL-ADC is a cytotoxic agent, and wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region and a VL region selected from the group consisting of: (a) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 36, 37, and 38, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 39, the sequence GAS, and SEQ ID No: 40, respectively; (b) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 49, the sequence AAS, and SEQ ID No: 50, respectively; (c) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 117, the sequence DAS, and SEQ ID No: 118, respectively; (d) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 53, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 55, the sequence GAS, and SEQ ID No: 56, respectively; (e) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 54, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 55, the sequence GAS, and SEQ ID No: 56, respectively; (f) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 60, the sequence GAS, and SEQ ID No: 61, respectively; (g) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 62, 63, and 64, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 65, the sequence GAS, and SEQ ID No: 66, respectively; (h) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 67, 68, and 69, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 70, the sequence GAS, and SEQ ID No: 71, respectively; (i) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 73, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 76, the sequence ATS, and SEQ ID No: 77, respectively; (j) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 76, the sequence ATS, and SEQ ID No: 77, respectively; (k) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 78, 79, and 80, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 81, the sequence AAS, and SEQ ID No: 82, respectively; (l) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 83, 84, and 85, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 86, the sequence GAS, and SEQ ID No: 87, respectively; (m) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 88, 89, and 90, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 91, the sequence GAS, and SEQ ID No: 92, respectively; (n) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 94, and 95, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 96, the sequence GAS, and SEQ ID No: 97, respectively; (o) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 98, 99, and 100, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 101, the sequence DAS, and SEQ ID No: 102, respectively; (p) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 103, 104, and 105, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 106, the sequence GAS, and SEQ ID No: 107, respectively; (q) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 110, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 112, the sequence AAS, and SEQ ID No: 113, respectively; (r) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 112, the sequence AAS, and SEQ ID No: 113, respectively; and (s) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 41, 42, and 43, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 44, the sequence AAS, and SEQ ID No: 45, respectively.
2. The lyophilized formulation of claim 1, wherein the aqueous formulation comprises: (a) a buffer providing for a pH of between about 5 and about 7 in the aqueous formulation; (b) at least one bulking agent; and (c) at least one non-reducing sugar which forms an amorphous phase with the AXL-ADC in solid state.
3. The lyophilized formulation of claim 1, wherein the aqueous formulation comprises a buffer selected from the group consisting of histidine, citrate, 2-(N-morpholino) ethanesulfonic acid (MES), succinate, glycolate, carbonic acid and phosphate, and a combination of any thereof; wherein the pH of the aqueous formulation is in a range from about 5 to about 7; and wherein the aqueous formulation comprises a buffer at a concentration of about 5 mM to about 100 mM.
4. The lyophilized formulation of claim 1, comprising a bulking agent selected from the group consisting of mannitol, glycine, and a combination thereof.
5. The lyophilized formulation of claim 1, wherein the aqueous formulation comprises a bulking agent at a concentration of about 1% (w/v) to about 5% (w/v), or at a concentration of about 50 mM to about 300 mM.
6. The lyophilized formulation of claim 1, comprising a non-reducing sugar selected from the group consisting of sucrose, trehalose, and a combination thereof.
7. The lyophilized formulation of claim 1, wherein the aqueous formulation comprises a non-reducing sugar at a concentration of about 0.5% (w/v) to about 7% (w/v), or a concentration of about 15 mM to about 200 mM.
8. The lyophilized formulation of claim 1, wherein the AXL-ADC concentration in the aqueous formulation is from about 5 mg/mL to about 30 mg/mL.
9. The lyophilized formulation of claim 1, wherein the pH of the aqueous formulation is in a range from about 5.5 to about 6.5.
10. A lyophilized formulation obtainable or obtained by lyophilizing an aqueous formulation having a pH of about 5 to about 7 and comprising (a) about 5 mg/mL to about 30 mg/mL of an anti-AXL antibody-drug conjugate (AXL-ADC); (b) about 10 mM to about 50 mM histidine; (c) about 15 mM to about 120 mM sucrose or trehalose; and (d) about 150 mM to about 180 mM mannitol or glycine, wherein the drug moiety of the AXL-ADC is a cytotoxic agent, and the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region and a VL region selected from the group consisting of: (a) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 36, 37, and 38, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 39, the sequence GAS, and SEQ ID No: 40, respectively; (b) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 49, the sequence AAS, and SEQ ID No: 50, respectively; (c) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 117, the sequence DAS, and SEQ ID No: 118, respectively; (d) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 53, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 55, the sequence GAS, and SEQ ID No: 56, respectively; (e) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 54, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 55, the sequence GAS, and SEQ ID No: 56, respectively; (f) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 60, the sequence GAS, and SEQ ID No: 61, respectively; (g) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 62, 63, and 64, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 65, the sequence GAS, and SEQ ID No: 66, respectively; (h) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 67, 68, and 69, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 70, the sequence GAS, and SEQ ID No: 71, respectively; (i) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 73, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 76, the sequence ATS, and SEQ ID No: 77, respectively; (j) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 76, the sequence ATS, and SEQ ID No: 77, respectively; (k) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 78, 79, and 80, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 81, the sequence AAS, and SEQ ID No: 82, respectively; (l) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 83, 84, and 85, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 86, the sequence GAS, and SEQ ID No: 87, respectively; (m) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 88, 89, and 90, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 91, the sequence GAS, and SEQ ID No: 92, respectively; (n) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 94, and 95, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 96, the sequence GAS, and SEQ ID No: 97, respectively; (o) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 98, 99, and 100, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 101, the sequence DAS, and SEQ ID No: 102, respectively; (p) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 103, 104, and 105, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 106, the sequence GAS, and SEQ ID No: 107, respectively; (q) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 110, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 112, the sequence AAS, and SEQ ID No: 113, respectively; (r) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 112, the sequence AAS, and SEQ ID No: 113, respectively; and (s) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 41, 42, and 43, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 44, the sequence AAS, and SEQ ID No: 45, respectively.
11. A pharmaceutical formulation having a pH of about 5 to about 7 and comprising, in aqueous solution: (a) about 5 mg/mL to about 30 mg/mL of an anti-AXL antibody-drug conjugate (AXL-ADC); (b) about 10 mM to about 50 mM histidine; (c) about 15 mM to about 120 mM sucrose or trehalose; and (d) about 50 mM to about 300 mM mannitol or glycine, wherein the drug moiety of the AXL-ADC is a cytotoxic agent, and the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region and a VL region selected from the group consisting of: (a) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 36, 37, and 38, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 39, the sequence GAS, and SEQ ID No: 40, respectively; (b) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 49, the sequence AAS, and SEQ ID No: 50, respectively; (c) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 117, the sequence DAS, and SEQ ID No: 118, respectively; (d) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 53, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 55, the sequence GAS, and SEQ ID No: 56, respectively; (c) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 54, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 55, the sequence GAS, and SEQ ID No: 56, respectively; (f) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 60, the sequence GAS, and SEQ ID No: 61, respectively; (g) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 62, 63, and 64, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 65, the sequence GAS, and SEQ ID No: 66, respectively; (h) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 67, 68, and 69, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 70, the sequence GAS, and SEQ ID No: 71, respectively; (i) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 73, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 76, the sequence ATS, and SEQ ID No: 77, respectively; (j) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 76, the sequence ATS, and SEQ ID No: 77, respectively; (k) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 78, 79, and 80, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 81, the sequence AAS, and SEQ ID No: 82, respectively; (l) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 83, 84, and 85, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 86, the sequence GAS, and SEQ ID No: 87, respectively; (m) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 88, 89, and 90, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 91, the sequence GAS, and SEQ ID No: 92, respectively; (n) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 94, and 95, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 96, the sequence GAS, and SEQ ID No: 97, respectively; (o) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 98, 99, and 100, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 101, the sequence DAS, and SEQ ID No: 102, respectively; (p) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 103, 104, and 105, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 106, the sequence GAS, and SEQ ID No: 107, respectively; (q) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 110, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 112, the sequence AAS, and SEQ ID No: 113, respectively; (r) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 112, the sequence AAS, and SEQ ID No: 113, respectively; and (s) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 41, 42, and 43, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 44, the sequence AAS, and SEQ ID No: 45, respectively.
12. The pharmaceutical formulation of claim 11, having a pH in the range of about 5.5 to about 6.5 and comprising: (a) about 9 mg/mL to about 11 mg/mL AXL-ADC; (b) about 20 mM to about 40 mM histidine; (c) about 80 mM to about 100 mM sucrose; and (d) about 150 mM to about 180 mM mannitol; wherein the formulation is free of any surfactant.
13. An aqueous formulation of an anti-AXL antibody, comprising one or more pharmaceutically acceptable excipients, wherein the aqueous formulation is free of any surfactant, and wherein the anti-AXL antibody comprises a VH region and a VL region selected from the group consisting of: (a) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 36, 37, and 38, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 39, the sequence GAS, and SEQ ID No: 40, respectively; (b) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 49, the sequence AAS, and SEQ ID No: 50, respectively; (c) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 117, the sequence DAS, and SEQ ID No: 118, respectively; (d) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 53, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 55, the sequence GAS, and SEQ ID No: 56, respectively; (c) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 54, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 55, the sequence GAS, and SEQ ID No: 56, respectively; (f) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 60, the sequence GAS, and SEQ ID No: 61, respectively; (g) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 62, 63, and 64, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 65, the sequence GAS, and SEQ ID No: 66, respectively; (h) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 67, 68, and 69, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 70, the sequence GAS, and SEQ ID No: 71, respectively; (i) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 73, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 76, the sequence ATS, and SEQ ID No: 77, respectively; (j) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 76, the sequence ATS, and SEQ ID No: 77, respectively; (k) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 78, 79, and 80, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 81, the sequence AAS, and SEQ ID No: 82, respectively; (l) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 83, 84, and 85, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 86, the sequence GAS, and SEQ ID No: 87, respectively; (m) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 88, 89, and 90, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 91, the sequence GAS, and SEQ ID No: 92, respectively; (n) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 94, and 95, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 96, the sequence GAS, and SEQ ID No: 97, respectively; (o) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 98, 99, and 100, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 101, the sequence DAS, and SEQ ID No: 102, respectively; (p) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 103, 104, and 105, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 106, the sequence GAS, and SEQ ID No: 107, respectively; (q) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 110, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 112, the sequence AAS, and SEQ ID No: 113, respectively; (r) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 112, the sequence AAS, and SEQ ID No: 113, respectively; and (s) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 41, 42, and 43, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 44, the sequence AAS, and SEQ ID No: 45, respectively.
14. The aqueous formulation of claim 13, wherein the formulation comprises a buffer and at least one stabilizer, wherein the pH of the aqueous formulation is between about 5 and about 7.
15. The aqueous formulation of claim 13, comprising a buffer selected from the group consisting of histidine, citrate, MES, phosphate, carbonic acid, succinate, glycolate, and a combination of any thereof, wherein the buffer is at a concentration of about 10 mM to about 50 mM, and the pH of the aqueous formulation is in a range of about 5.5 to about 6.5.
16. The aqueous formulation of claim 13, comprising a stabilizer selected from the group consisting of mannitol, sucrose and trehalose, wherein the stabilizer is present at a concentration of about 20 mM to about 400 mM, or a concentration of about 0.4% (w/v) to about 7% (w/v).
17. The aqueous formulation of claim 13, which is free of any one or more of arginine, glycine, glutamic acid, sorbitol, trehalose, sucrose and sodium chloride.
18. The aqueous formulation of claim 13, wherein the antibody concentration is from about 5 mg/mL to about 40 mg/mL.
19. The aqueous formulation of claim 14, wherein the formulation comprises (a) about 5 mg/mL to about 40 mg/mL of an anti-AXL antibody; (b) about 10 mM to about 50 mM histidine; and (c) about 50 mM to about 300 mM mannitol.
20. A frozen aqueous formulation of an anti-AXL antibody, obtained or obtainable by freezing the aqueous formulation of claim 13.
21. A lyophilized formulation of an anti-AXL antibody-drug conjugate (AXL-ADC), the lyophilized formulation obtainable or obtained by lyophilizing an aqueous formulation comprising the AXL-ADC and one or more excipients, wherein the aqueous formulation is free of any surfactant, wherein the AXL-ADC binds to an epitope on AXL which is recognized by any of the antibodies defined in claim 13.
22. The lyophilized formulation of claim 1, wherein the AXL-ADC binds to an epitope within the Ig1-like domain of AXL, the epitope comprising one or more amino acids corresponding to positions L121 to Q129 or T112 to Q124 of human AXL; an epitope within the Ig2-like domain of AXL, the epitope comprising the amino acids corresponding to position D170 or the combination of D179 and one or more amino acids corresponding to positions T182 to R190 of human AXL; or an epitope within the FN1-like domain of human AXL, the epitope comprising one or more amino acids corresponding to positions Q272 to A287 and G297 to P301 of human AXL.
23. The lyophilized formulation of claim 1, wherein the antibody moiety of the AXL-ADC comprises a heavy chain of an isotype selected from the group consisting of IgG1, IgG2, IgG3, and IgG4.
24. The lyophilized formulation of claim 1, wherein the antibody moiety of the AXL-ADC is a full-length monoclonal antibody.
25. A lyophilized formulation obtainable or obtained by lyophilizing an aqueous formulation comprising about 9 mg/mL to about 11 mg/mL of an anti-AXL antibody-drug conjugate (AXL-ADC), and pharmaceutically acceptable excipients comprising: about 30 mM histidine buffer providing for a pH from about 5 to about 7; about 88 mM sucrose; and about 165 mM mannitol; wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region and a VL region selected from the group consisting of: (a) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 36, 37, and 38, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 39, the sequence GAS, and SEQ ID No: 40, respectively; (b) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 46, 47, and 48, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 49, the sequence AAS, and SEQ ID No: 50, respectively; (c) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 114, 115, and 116, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 117, the sequence DAS, and SEQ ID No: 118, respectively; (d) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 51, 52, and 53, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 55, the sequence GAS, and SEQ ID No: 56, respectively; (e) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 51, 52, and 54, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 55, the sequence GAS, and SEQ ID No: 56, respectively; (f) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 57, 58, and 59, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 60, the sequence GAS, and SEQ ID No: 61, respectively; (g) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 62, 63, and 64, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 65, the sequence GAS, and SEQ ID No: 66, respectively; (h) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 67, 68, and 69, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 70, the sequence GAS, and SEQ ID No: 71, respectively; (i) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 72, 73, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 76, the sequence ATS, and SEQ ID No: 77, respectively; (j) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 72, 74, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 76, the sequence ATS, and SEQ ID No: 77, respectively; (k) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 78, 79, and 80, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 81, the sequence AAS, and SEQ ID No: 82, respectively; (l) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 83, 84, and 85, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 86, the sequence GAS, and SEQ ID No: 87, respectively; (m) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 88, 89, and 90, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 91, the sequence GAS, and SEQ ID No: 92, respectively; (n) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 93, 94, and 95, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 96, the sequence GAS, and SEQ ID No: 97, respectively; (o) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 98, 99, and 100, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 101, the sequence DAS, and SEQ ID No: 102, respectively; (p) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 103, 104, and 105, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 106, the sequence GAS, and SEQ ID No: 107, respectively; (q) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 108, 109, and 110, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 112, the sequence AAS, and SEQ ID No: 113, respectively; (r) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 108, 109, and 111, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 112, the sequence AAS, and SEQ ID No: 113, respectively; and (s) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 41, 42, and 43, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 44, the sequence AAS, and SEQ ID No: 45, respectively; wherein the AXL-ADC comprises a mc-vc-PAB linker and MMAE.
26. An aqueous formulation suitable for preparing a lyophilized formulation of an anti-AXL antibody-drug conjugate (AXL-ADC) and having a pH of about 5 to about 7, comprising (a) about 7 mg/mL to about 20 mg/mL of an AXL-ADC; (b) about 5 mM to about 100 mM histidine; (c) about 15 mM to about 120 mM sucrose; and (d) about 150 mM to about 180 mM mannitol, wherein the drug moiety of the AXL-ADC is a cytotoxic agent, and the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region and a VL region selected from the group consisting of: (a) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 36, 37, and 38, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 39, the sequence GAS, and SEQ ID No: 40, respectively; (b) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 49, the sequence AAS, and SEQ ID No: 50, respectively; (c) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 117, the sequence DAS, and SEQ ID No: 118, respectively; (d) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 53, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 55, the sequence GAS, and SEQ ID No: 56, respectively; (c) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 54, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 55, the sequence GAS, and SEQ ID No: 56, respectively; (f) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 60, the sequence GAS, and SEQ ID No: 61, respectively; (g) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 62, 63, and 64, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 65, the sequence GAS, and SEQ ID No: 66, respectively; (h) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 67, 68, and 69, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 70, the sequence GAS, and SEQ ID No: 71, respectively; (i) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 73, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 76, the sequence ATS, and SEQ ID No: 77, respectively; (j) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 76, the sequence ATS, and SEQ ID No: 77, respectively; (k) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 78, 79, and 80, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 81, the sequence AAS, and SEQ ID No: 82, respectively; (l) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 83, 84, and 85, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 86, the sequence GAS, and SEQ ID No: 87, respectively; (m) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 88, 89, and 90, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 91, the sequence GAS, and SEQ ID No: 92, respectively; (n) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 94, and 95, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 96, the sequence GAS, and SEQ ID No: 97, respectively; (o) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 98, 99, and 100, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 101, the sequence DAS, and SEQ ID No: 102, respectively; (p) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 103, 104, and 105, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 106, the sequence GAS, and SEQ ID No: 107, respectively; (q) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 110, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 112, the sequence AAS, and SEQ ID No: 113, respectively; (r) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 112, the sequence AAS, and SEQ ID No: 113, respectively; and (s) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 41, 42, and 43, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 44, the sequence AAS, and SEQ ID No: 45, respectively.
27. The aqueous formulation of claim 26, wherein the antibody moiety of the AXL-ADC comprises a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 36, 37, and 38, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 39, the sequence GAS, and SEQ ID No: 40, respectively.
28. The aqueous formulation of claim 26, wherein the AXL-ADC comprises a mc-vc-PAB linker and MMAE.
29. A pharmaceutically acceptable liquid formulation obtained by reconstituting the lyophilized formulation of claim 25 in a sterile aqueous diluent.
30. The liquid formulation of claim 29, having a pH of about 5 to about 7, and comprising about 5 mg/mL to about 30 mg/mL of the AXL-ADC; about 10 mM to about 50 mM histidine; about 15 mM to about 120 mM sucrose; and about 50 mM to about 300 mM mannitol or glycine, wherein the weight ratio of mannitol to sucrose is at least about 1.
31. The lyophilized formulation of claim 1, wherein the AXL-ADC comprises a cleavable linker selected from the group consisting of: N-succinimydyl 4-(2-pyridyldithio)-pentanoate (SSP), maleimidocaproyl-valine-citrulline-p-aminobenzyloxycarbonyl (mc-vc-PAB), and AV-1 K-lock valine-citrulline.
32. The lyophilized formulation of claim 1, wherein the cytotoxic agent is monomethylauristatin E (MMAE) or monomethylauristatin F (MMAF).
33. The lyophilized formulation of claim 1, wherein the AXL-ADC comprises a VH region and a VL region selected from the group consisting of: (a) a VH region comprising SEQ ID No: 1 and a VL region comprising SEQ ID No: 2; (b) a VH region comprising SEQ ID No: 5 and a VL region comprising SEQ ID No: 6; (c) a VH region comprising SEQ ID No: 34 and a VL region comprising SEQ ID No: 35; (d) a VH region comprising SEQ ID No: 7 and a VL region comprising SEQ ID No: 9; (e) a VH region comprising SEQ ID No: 10 and a VL region comprising SEQ ID No: 11; (f) a VH region comprising SEQ ID No: 16 and a VL region comprising SEQ ID No: 18; (g) a VH region comprising SEQ ID No: 25 and a VL region comprising SEQ ID No: 26; (h) a VH region comprising SEQ ID No: 31 and a VL region comprising SEQ ID No: 33; (i) a VH region comprising SEQ ID No: 3 and a VL region comprising SEQ ID No: 4; (j) a VH region comprising SEQ ID No:8 and a VL region comprising SEQ ID No:9; (k) a VH region comprising SEQ ID No: 12 and a VL region comprising SEQ ID No:13; (l) a VH region comprising SEQ ID No: 14 and a VL region comprising SEQ ID No: 15; (m) a VH region comprising SEQ ID No: 17 and a VL region comprising SEQ ID No:18; (n) a VH region comprising SEQ ID No: 19 and a VL region comprising SEQ ID No:20; (o) a VH region comprising SEQ ID No:21 and a VL region comprising SEQ ID No:22; (p) a VH region comprising SEQ ID No:23 and a VL region comprising SEQ ID No:24; (q) a VH region comprising SEQ ID No:27 and a VL region comprising SEQ ID No:28; (r) a VH region comprising SEQ ID No:29 and a VL region comprising SEQ ID No:30; and (s) a VH region comprising SEQ ID No:32 and a VL region comprising SEQ ID No: 33.
34. The lyophilized formulation of claim 1, wherein the cytotoxic agent is an auristatin.
35. The lyophilized formulation of claim 10, wherein the cytotoxic agent is an auristatin.
36. The lyophilized formulation of claim 11, wherein the cytotoxic agent is an auristatin.
37. The lyophilized formulation of claim 26, wherein the cytotoxic agent is an auristatin.
38. The lyophilized formulation of claim 1, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 36, 37, and 38, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 39, the sequence GAS, and SEQ ID No: 40, respectively.
39. The lyophilized formulation of claim 1, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 49, the sequence AAS, and SEQ ID No: 50, respectively.
40. The lyophilized formulation of claim 1, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 117, the sequence DAS, and SEQ ID No: 118, respectively.
41. The lyophilized formulation of claim 1, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 54, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 55, the sequence GAS, and SEQ ID No: 56, respectively.
42. The lyophilized formulation of claim 1, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 60, the sequence GAS, and SEQ ID No: 61, respectively.
43. The lyophilized formulation of claim 1, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 76, the sequence ATS, and SEQ ID No: 77, respectively.
44. The lyophilized formulation of claim 1, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 94, and 95, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 96, the sequence GAS, and SEQ ID No: 97, respectively.
45. The lyophilized formulation of claim 1, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 98, 99, and 100, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 101, the sequence DAS, and SEQ ID No: 102, respectively.
46. The lyophilized formulation of claim 1, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 112, the sequence AAS, and SEQ ID No: 113, respectively.
47. The lyophilized formulation of claim 10, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 36, 37, and 38, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 39, the sequence GAS, and SEQ ID No: 40, respectively.
48. The lyophilized formulation of claim 10, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 49, the sequence AAS, and SEQ ID No: 50, respectively.
49. The lyophilized formulation of claim 10, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 117, the sequence DAS, and SEQ ID No: 118, respectively.
50. The lyophilized formulation of claim 10, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 54, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 55, the sequence GAS, and SEQ ID No: 56, respectively.
51. The lyophilized formulation of claim 10, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 60, the sequence GAS, and SEQ ID No: 61, respectively.
52. The lyophilized formulation of claim 10, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 76, the sequence ATS, and SEQ ID No: 77, respectively.
53. The lyophilized formulation of claim 10, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 94, and 95, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 96, the sequence GAS, and SEQ ID No: 97, respectively.
54. The lyophilized formulation of claim 10, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 98, 99, and 100, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 101, the sequence DAS, and SEQ ID No: 102, respectively.
55. The lyophilized formulation of claim 10, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 112, the sequence AAS, and SEQ ID No: 113, respectively.
56. The pharmaceutical formulation of claim 11, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 36, 37, and 38, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 39, the sequence GAS, and SEQ ID No: 40, respectively.
57. The pharmaceutical formulation of claim 11, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 49, the sequence AAS, and SEQ ID No: 50, respectively.
58. The pharmaceutical formulation of claim 11, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 117, the sequence DAS, and SEQ ID No: 118, respectively.
59. The pharmaceutical formulation of claim 11, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 54, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 55, the sequence GAS, and SEQ ID No: 56, respectively.
60. The pharmaceutical formulation of claim 11, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 60, the sequence GAS, and SEQ ID No: 61, respectively.
61. The pharmaceutical formulation of claim 11, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 76, the sequence ATS, and SEQ ID No: 77, respectively.
62. The pharmaceutical formulation of claim 11, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 94, and 95, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 96, the sequence GAS, and SEQ ID No: 97, respectively.
63. The pharmaceutical formulation of claim 11, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 98, 99, and 100, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 101, the sequence DAS, and SEQ ID No: 102, respectively.
64. The pharmaceutical formulation of claim 11, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 112, the sequence AAS, and SEQ ID No: 113, respectively.
65. The aqueous formulation of claim 13, wherein the anti-AXL antibody comprises a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 36, 37, and 38, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 39, the sequence GAS, and SEQ ID No: 40, respectively.
66. The aqueous formulation of claim 13, wherein the anti-AXL antibody comprises a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 49, the sequence AAS, and SEQ ID No: 50, respectively.
67. The aqueous formulation of claim 13, wherein the anti-AXL antibody comprises a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 117, the sequence DAS, and SEQ ID No: 118, respectively.
68. The aqueous formulation of claim 13, wherein the anti-AXL antibody comprises a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 54, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 55, the sequence GAS, and SEQ ID No: 56, respectively.
69. The aqueous formulation of claim 13, wherein the anti-AXL antibody comprises a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 60, the sequence GAS, and SEQ ID No: 61, respectively.
70. The aqueous formulation of claim 13, wherein the anti-AXL antibody comprises a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 76, the sequence ATS, and SEQ ID No: 77, respectively.
71. The aqueous formulation of claim 13, wherein the anti-AXL antibody comprises a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 94, and 95, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 96, the sequence GAS, and SEQ ID No: 97, respectively.
72. The aqueous formulation of claim 13, wherein the anti-AXL antibody comprises a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 98, 99, and 100, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 101, the sequence DAS, and SEQ ID No: 102, respectively.
73. The aqueous formulation of claim 13, wherein the anti-AXL antibody comprises a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 112, the sequence AAS, and SEQ ID No: 113, respectively.
74. The lyophilized formulation of claim 25, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 36, 37, and 38, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 39, the sequence GAS, and SEQ ID No: 40, respectively.
75. The lyophilized formulation of claim 25, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 49, the sequence AAS, and SEQ ID No: 50, respectively.
76. The lyophilized formulation of claim 25, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 117, the sequence DAS, and SEQ ID No: 118, respectively.
77. The lyophilized formulation of claim 25, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 54, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 55, the sequence GAS, and SEQ ID No: 56, respectively.
78. The lyophilized formulation of claim 25, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 60, the sequence GAS, and SEQ ID No: 61, respectively.
79. The lyophilized formulation of claim 25, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 76, the sequence ATS, and SEQ ID No: 77, respectively.
80. The lyophilized formulation of claim 25, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 94, and 95, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 96, the sequence GAS, and SEQ ID No: 97, respectively.
81. The lyophilized formulation of claim 25, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 98, 99, and 100, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 101, the sequence DAS, and SEQ ID No: 102, respectively.
82. The lyophilized formulation of claim 25, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 112, the sequence AAS, and SEQ ID No: 113, respectively.
83. The aqueous formulation of claim 26, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos: 36, 37, and 38, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 39, the sequence GAS, and SEQ ID No: 40, respectively.
84. The aqueous formulation of claim 26, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 49, the sequence AAS, and SEQ ID No: 50, respectively.
85. The aqueous formulation of claim 26, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 117, the sequence DAS, and SEQ ID No: 118, respectively.
86. The aqueous formulation of claim 26, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 54, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 55, the sequence GAS, and SEQ ID No: 56, respectively.
87. The aqueous formulation of claim 26, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 60, the sequence GAS, and SEQ ID No: 61, respectively.
88. The aqueous formulation of claim 26, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 76, the sequence ATS, and SEQ ID No: 77, respectively.
89. The aqueous formulation of claim 26, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 94, and 95, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 96, the sequence GAS, and SEQ ID No: 97, respectively.
90. The aqueous formulation of claim 26, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 98, 99, and 100, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 101, the sequence DAS, and SEQ ID No: 102, respectively.
91. The aqueous formulation of claim 26, wherein the antibody moiety of the AXL-ADC comprises at least one binding region comprising a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID No: 112, the sequence AAS, and SEQ ID No: 113, respectively.
Description
LEGENDS TO THE FIGURES
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
DETAILED DISCLOSURE OF THE INVENTION
Definitions
(14) The terms lyophilized and freeze-dried are used interchangeably herein and refer to a material that is dehydrated by first freezing and then reducing the surrounding pressure to allow the frozen water in the material to sublimate.
(15) The term buffer as used herein denotes a pharmaceutically acceptable buffer. The term buffer encompasses those agents which maintain the pH value of a solution, e.g., in an acceptable range and includes, but is not limited to, histidine, citrate, MES, phosphate, TRIS? (tris (hydroxymethyl) aminomethane), carbonic acid, succinate, glycolate and the like, as described herein. Generally, the buffer as used herein has a pka and buffering capacity suitable for the pH range of about 5 to about 7, preferably of about 5.5 to 6.5, preferably about 5.8 to 6.2, such as about pH 6 or about pH 6.0.
(16) The term bulking agent includes agents that can provide additional structure to a freeze-dried product (e.g., to provide a pharmaceutically acceptable cake). Commonly used bulking agents include mannitol, glycine, and the like. In addition to providing a pharmaceutically acceptable cake, bulking agents also typically impart useful qualities to the lyophilized composition such as modifying the collapse temperature, providing freeze-thaw protection, further enhancing the protein stability over long-term storage, and the like. These agents can also serve as tonicity modifiers.
(17) The term stabilizer as used herein includes agents that provide stability to a protein, e.g., serving as a cryoprotectant during freezing and/or a lyoprotectant during a (freeze-) drying or dehydration process. Suitable stabilizers include non-reducing sugars or saccharides and sugar alcohols such as sucrose, trehalose, mannitol, xylitol and the like, as well as amino acids such as glycine, alanine and lysine. Stabilizers can also serve as bulking agents, tonicity-modifying and/or viscosity-increasing agents.
(18) A surfactant as used herein is a compound that is typically used in pharmaceutical formulations to prevent drug adsorption to surfaces and or aggregation. Furthermore, surfactants lower the surface tension (or interfacial tension) between two liquids or between a liquid and a solid. For example, an exemplary surfactant can significantly lower the surface tension when present at very low concentrations (e.g., 5% w/w or less, such as 3% w/w or less, such as 1% w/w or less). Surfactants are amphiphilic, which means they are usually composed of both hydrophilic and hydrophobic or lipophilic groups, thus being capable of forming micelles or similar self-assembled structures in aqueous solutions. Known surfactants for pharmaceutical use include glycerol monooleat, benzethonium chloride, sodium docusate, phospholipids, polyethylene alkyl ethers, sodium lauryl sulfate and tricaprylin (anionic surfactants); benzalkonium chloride, citrimide, cetylpyridinium chloride and phospholipids (cationic surfactants); and alpha tocopherol, glycerol monooleate, myristyl alcohol, phospholipids, poloxamers, polyoxyethylene alkyl ethers, polyoxyethylene castor oil derivatives, polyoxyethylene sorbintan fatty acid esters, polyoxyethylene sterarates, polyoxyl 15 hydroxystearate, polyoxylglycerides, polysorbates, propylene glycol dilaurate, propylene glycol monolaurate, sorbitan esters sucrose palmitate, sucrose stearate, tricaprylin and TPGS (Nonionic and zwitterionic surfactants).
(19) A diluent of interest herein is one which is pharmaceutically acceptable (safe and non-toxic for administration to a human) and is useful for the preparation of a reconstituted formulation. Exemplary diluents are liquids, preferably aqueous, and include sterile water, bacteriostatic water for injection (BWFI), a pH buffered solution (e.g. phosphate-buffered saline), sterile saline solution, Ringer's solution or dextrose solution.
(20) The term antibody as used herein is intended to refer to an immunoglobulin molecule, a fragment of an immunoglobulin molecule, or a derivative of either thereof, which has the ability to specifically bind to an antigen under typical physiological and/or tumor-specific conditions with a half-life of significant periods of time, such as at least about 30 minutes, at least about 45 minutes, at least about one hour, at least about two hours, at least about four hours, at least about 8 hours, at least about 12 hours, about 24 hours or more, about 48 hours or more, about 3, 4, 5, 6, 7 or more days, etc., or any other relevant functionally-defined period (such as a time sufficient to induce, promote, enhance, and/or modulate a physiological response associated with antibody binding to the antigen and/or time sufficient for the antibody to be internalized). The binding region (or binding domain which may be used herein, both having the same meaning) which interacts with an antigen, comprises variable regions of both the heavy and light chains of the immunoglobulin molecule. The constant regions of the antibodies (Abs) may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (such as effector cells) and components of the complement system such as C1q, the first component in the classical pathway of complement activation. As indicated above, the term antibody as used herein, unless otherwise stated or clearly contradicted by context, includes fragments of an antibody that retain the ability to specifically interact, such as bind, to the antigen. It has been shown that the antigen-binding function of an antibody may be performed by fragments of a full-length antibody. Examples of binding fragments encompassed within the term antibody include (i) a Fab or Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains, or a monovalent antibody as described in [35]; (ii) F(ab).sub.2 fragments, bivalent fragments comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) an Fd fragment consisting essentially of the VH and CH1 domains; (iv) an Fv fragment consisting essentially of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment [36], which consists essentially of a VH domain and is also called domain antibody [37]; (vi) camelid or nanobodies and (vii) an isolated complementarity determining region (CDR). Furthermore, although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they may be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain antibodies or single chain Fv (scFv), see for instance and [40]). Such single chain antibodies are encompassed within the term antibody unless otherwise noted or clearly indicated by context. Although such fragments are generally included within the meaning of antibody, they collectively and each independently are unique features of the present invention, exhibiting different biological properties and utility. These and other useful antibody fragments in the context of the present invention are discussed further herein. It also should be understood that the term antibody, unless specified otherwise, also includes polyclonal antibodies, monoclonal antibodies (mAbs), antibody-like polypeptides, such as chimeric antibodies and humanized antibodies, as well as antibody fragments or fragments thereof retaining the ability to specifically bind to the antigen (antigen-binding fragments) provided by any known technique, such as enzymatic cleavage, peptide synthesis, and recombinant techniques, and retaining the ability to be conjugated to a toxin. An antibody as generated can possess any isotype.
(21) The term antigen-binding region or binding region as used herein, refers to a region of an antibody which is capable of binding to the antigen. The terms antigen and target may, unless contradicted by the context, be used interchangeably in the context of the present invention.
(22) The term binding as used herein refers to the binding of an antibody to a predetermined antigen or target, typically a binding with an affinity corresponding to a K.sub.D of about 10.sup.?6 M or less, e.g. 10.sup.?7 M or less, such as about 10.sup.?8 M or less, such as about 10.sup.?9 M or less, about 10.sup.?10 M or less, or about 10.sup.?11 M or even less when determined by for instance surface plasmon resonance (SPR) technology in a BIAcore 3000 instrument using the antigen as the ligand and the antibody as the analyte, and wherein the antibody binds to the predetermined antigen with an affinity corresponding to a K.sub.D that is at least ten-fold lower, such as at least 100 fold lower, for instance at least 1,000 fold lower, such as at least 10,000 fold lower, for instance at least 100,000 fold lower than its K.sub.D of binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely-related antigen. The amount with which the K.sub.D of binding is lower is dependent on the K.sub.D of the antibody, so that when the K.sub.D of the antibody is very low (that is, the antibody is highly specific), then the amount with which the affinity for the antigen is lower than the affinity for a non-specific antigen may be at least 10,000 fold. Affinity, as used herein, and K.sub.D are inversely related, that is higher affinity is intended to refer to lower K.sub.D, and lower affinity is intended to refer to higher K.sub.D.
(23) As used herein: The term K.sub.D (M) refers to the dissociation equilibrium constant of a particular antibody-antigen interaction, and is obtained by dividing k.sub.d by k.sub.a. The term k.sub.d (sec.sup.?1) refers to the dissociation rate constant of a particular antibody-antigen interaction. Said value is also referred to as the K.sub.off value or off-rate. The term k.sub.a (M.sup.?1?sec.sup.?1) refers to the association rate constant of a particular antibody-antigen interaction. Said value is also referred to as the k.sub.on value or on-rate. The term K.sub.A (M.sup.?1) refers to the association equilibrium constant of a particular antibody-antigen interaction and is obtained by dividing k.sub.a by k.sub.d.
(24) The term antibody binding AXL as used herein, refers to any antibody binding an epitope on the extracellular portion of AXL.
(25) The term epitope means a protein determinant capable of specific binding to an antibody. Epitopes usually consist of surface groupings of molecules such as amino acids, sugar side chains or a combination thereof and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. Conformational and non-conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents. The epitope may comprise amino acid residues which are directly involved in the binding, and other amino acid residues, which are not directly involved in the binding, such as amino acid residues which are effectively blocked or covered by the specific antigen binding peptide (in other words, the amino acid residue is within the footprint of the specific antigen binding peptide).
(26) The term AXL as used herein, refers to the protein entitled AXL, which is also referred to as UFO or JTK11, a 894 amino acid protein with a molecular weight of 104-140 kDa that is part of the subfamily of mammalian TAM Receptor Tyrosine Kinases (RTKs). The molecular weight is variable due to potential differences in glycosylation of the protein. The AXL protein consists of two extracellular immunoglobulin-like (Ig-like) domains on the N-terminal end of the protein, two membrane-proximal extracellular fibronectin type III (FNIII) domains, a transmembrane domain and an intracellular kinase domain. AXL is activated upon binding of its ligand Gas6, by ligand-independent homophilic interactions between AXL extracellular domains, by autophosphorylation in presence of reactive oxygen species or by transactivation through EGFR, and is aberrantly expressed in several tumor types. In humans, the AXL protein is encoded by a nucleic acid sequence encoding the amino acid sequence shown in SEQ ID NO: 130 (human AXL protein: Swissprot P30530; cynomolgus AXL protein: Genbank accession HB387229.1)).
(27) The terms monoclonal antibody, monoclonal Ab, monoclonal antibody composition, mAb, or the like, as used herein refer to a preparation of antibody molecules of single molecular composition. A monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope. Accordingly, the term human monoclonal antibody refers to antibodies displaying a single binding specificity which have variable and constant regions derived from human germline immunoglobulin sequences. The human monoclonal antibodies may be produced by a hybridoma which includes a B cell obtained from a transgenic or transchromosomal non-human animal, such as a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene, fused to an immortalized cell.
(28) In the context of the present invention the term ADC refers to an antibody drug conjugate, which in the context of the present invention refers to an anti-AXL antibody which is coupled to a therapeutic moiety, e.g., a cytotoxic moiety as described in the present application. It may e.g. be coupled with a linker to e.g. cysteine or with other conjugation methods to other amino acids. The moiety may e.g. be a drug or a toxin or the like.
(29) As used herein, a therapeutic moiety means a compound which exerts a therapeutic or preventive effect when administered to a subject, particularly when delivered as an ADC as described herein. A cytotoxic or cytostatic moiety is a compound that is detrimental to (e.g., kills) cells. Some cytotoxic or cytostatic moieties for use in ADCs are hydrophobic, meaning that they have no or only a limited solubility in water, e.g., 1 g/L or less (very slightly soluble), such as 0.8 g/L or less, such as 0.6 g/L or less, such as 0.4 g/L or less, such as 0.3 g/L or less, such as 0.2 g/L or less, such as 0.1 g/L or less (practically insoluble). Exemplary hydrophobic cytotoxic or cytostatic moieties include, but are not limited to, certain microtubulin inhibitors such as auristatin and its derivatives, e.g., MMAF and MMAE, as well as maytansine and its derivatives, e.g., DM1.
(30) When used herein in the context of an antibody and a ligand or in the context of two or more antibodies, the term competes with or cross-competes with indicates that the antibody competes with the ligand or another antibody, e.g., a reference antibody in binding to an antigen, respectively. Example 13 describes an example of how to test competition of an anti-AXL antibody with the AXL-ligand Gas6. Preferred reference antibodies for cross-competition between two antibodies are those comprising a binding region comprising the VH region and VL region of an antibody herein designated 107, 148, 733, 154, 171, 183, 613, 726, 140, 154-M103L, 172, 181, 183-N52Q, 187, 608-01, 610-01, 613-08, 620-06 or 726-M101L, as set forth in Table 1. A particularly preferred reference antibody is the antibody designated 107.
(31) The present invention also provides, in one embodiment, formulations of antibodies comprising functional variants of the VL region, VH region, or one or more CDRs of the antibodies described herein. A functional variant of a VL, VH, or CDR used in the context of an anti-AXL antibody still allows the antibody to retain at least a substantial proportion (at least about 50%, 60%, 70%, 80%, 90%, 95%, 99% or more) of the affinity/avidity and/or the specificity/selectivity of the parent antibody and in some cases such an anti-AXL antibody may be associated with greater affinity, selectivity and/or specificity than the parent antibody.
(32) Such functional variants typically retain significant sequence identity to the parent antibody. The percent identity between two sequences is a function of the number of identical positions shared by the sequences (i.e., % identity=# of identical positions/total # of positions?100), taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences may be accomplished using a mathematical algorithm, as described below.
(33) For purposes of the present invention, the sequence identity between two amino acid sequences is determined using the Needleman-Wunsch algorithm (Needleman and Wunsch, 1970, J. Mol. Biol. 48:443-453) as implemented in the Needle program of the EMBOSS package (EMBOSS: The European Molecular Biology Open Software Suite, Rice et al., 2000, Trends Genet. 16:276-277), preferably version 5.0.0 or later. The parameters used are gap open penalty of 10, gap extension penalty of 0.5, and the EBLOSUM62 (EMBOSS version of BLOSUM62) substitution matrix. The output of Needle labeled longest identity (obtained using the -nobrief option) is used as the percent identity and is calculated as follows: (Identical Residues?100)/(Length of Alignment?Total Number of Gaps in Alignment).
(34) The retention of similar residues may also or alternatively be measured by a similarity score, as determined by use of a BLAST program (e.g., BLAST 2.2.8 available through the NCBI using standard settings BLOSUM62, Open Gap=11 and Extended Gap=1). Suitable variants typically exhibit at least about 45%, such as at least about 55%, at least about 65%, at least about 75%, at least about 85%, at least about 90%, at least about 95%, or more (e.g., about 99%) similarity to the parent sequence.
(35) The sequence of CDR, VH or VL variants may differ from the sequence of the CDR, VH or VL of the parent antibody through mostly conservative substitutions; for instance at least about 35%, about 50% or more, about 60% or more, about 70% or more, about 75% or more, about 80% or more, about 85% or more, about 90% or more, about 95% or more such as about 96%, 97% or 98% or 99% of the substitutions in the variant are conservative amino acid residue replacements. For example, the sequences of CDR, VH or VL variants may differ from the sequence of the CDRs, VH or VL of the parent antibody through mostly conservative substitutions; for instance at least 10, such as at least 9, 8, 7, 6, 5, 4, 3, 2 or 1 of the substitutions in the variant are conservative amino acid residue replacements.
(36) In the context of the present invention, conservative substitutions may be defined by substitutions within the classes of amino acids reflected in one or more of the following tables:
(37) Amino acid residue of conservative class:
(38) TABLE-US-00001 Acidic Residues D and E Basic Residues K, R, and H Hydrophilic Uncharged Residues S, T, N, and Q Aliphatic Uncharged Residues G, A, V, L, and I Non-polar Uncharged Residues C, M, and P Aromatic Residues F, Y, and W
(39) Alternative Physical and Functional Classifications of Amino Acid Residues:
(40) TABLE-US-00002 Alcohol group-containing residues S and T Aliphatic residues I, L, V, and M Cycloalkenyl-associated residues F, H, W, and Y Hydrophobic residues A, C, F, G, H, I, L, M, R, T, V, W, and Y Negatively charged residues D and E Polar residues C, D, E, H, K, N, Q, R, S, and T Positively charged residues H, K, and R Small residues A, C, D, G, N, P, S, T, and V Very small residues A, G, and S Residues involved in turn formation A, C, D, E, G, H, K, N, Q, R, S, P, and T Flexible residues Q, T, K, S, G, P, D, E, and R
(41) The term isotype as used herein refers to the immunoglobulin class (for instance IgG1, IgG2, IgG3, IgG4, IgD, IgA, IgE, or IgM) or any allotypes thereof, such as IgG1m (za) and IgG1m (f)) that is encoded by heavy chain constant region genes. Further, each heavy chain isotype can be combined with either a kappa (x) or lambda (2) light chain. In one embodiment, the isotype is IgG1, optionally allotype IgG1m (f). In one embodiment, the antibody is a full-length monoclonal antibody, optionally a full-length monoclonal IgG1,? antibody.
(42) The term full-length antibody when used herein, refers to an antibody (e.g., a parent or variant antibody) which contains all heavy and light chain constant and variable domains corresponding to those that are normally found in a wild-type antibody of that isotype. A full-length antibody according to the present invention may be produced by a method comprising the steps of (i) cloning the CDR sequences into a suitable vector comprising complete heavy chain sequences and complete light chain sequence, and (ii) expressing the complete heavy and light chain sequences in suitable expression systems. It is within the knowledge of the skilled person to produce a full-length antibody when starting out from either CDR sequences or full variable region sequences. Thus, the skilled person would know how to generate a full-length antibody according to the present invention.
(43) In one preferred aspect, any one of the formulations described herein comprises an exact quantity or exact quantities of one or more components as comprised therein and/or an exact pH value. In other words, one or more of the terms about are deleted in this other preferred aspect of the invention.
(44) In each aspect or embodiment relating to a formulation comprising certain features or components, such a formulation which consists essentially of such features or components is also a separate aspect or embodiment of the invention.
Specific Embodiments of the Invention
(45) The present invention is based, at least in part, on the discovery of certain aqueous compositions, particularly formulations, of AXL-ADCs which, when lyophilized, provide for stable lyophilized formulations suitable for pharmaceutical purposes and for therapeutic applications of the AXL-ADCs. Such lyophilized formulations may, for example, be reconstituted into pharmaceutically acceptable liquid formulations by adding a diluent, typically an aqueous diluent.
(46) The present invention is also based, in part, on the discovery of certain aqueous compositions, particularly, formulations of anti-AXL antibodies wherein the antibody is stable during freezing and thawing. The formulations disclosed herein also provide for the option of excluding surfactants such as, e.g., polysorbate 20 and 80; inorganic salts such as, e.g., NaCl; or both.
(47) In order to ensure efficacy and safety during long term storage (shelf life) of the pharmaceutical product, the product is stored under selected conditions, typically including storage both at the intended storage temperature and at elevated temperature(s), and is analysed for stability at regular time intervals. The stability tests may, for example, include analyses of the identity, purity and/or potency of the product. Purity can be analysed using, e.g., sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE), capillary electrophoresis sodium dodecyl sulfate (CE-SDS), capillary isoelectrofocusing (cIEF), immunoelectrophoresis, reverse-phase chromatography (RP-HPLC), size-exclusion chromatograhy (SEC), ion exchange and affinity chromatography. Stability analyses may also include, for example, visual appearance such as colour and transparency, particulates, pH, moisture and reconstitution time.
(48) The resulting degradation profile, particularly as regards purity and potency, during long term storage (shelf life) is affected by the composition and/or the formulation of the pharmaceutical product. In particular, proper choice of formulation may significantly improve the degradation profile. Typical degradation profiles of monoclonal antibodies and conjugated drug products derived from monoclonal antibodies includes the formation of covalent and non-covalent high molecular weight aggregates, fragments, deamidation and oxidation products. Particularly, deamidation and oxidation products, as well as acidic species, usually develop during long-term storage (shelf life). In some cases these degradation products limits the acceptable shelf life of the pharmaceutical composition. The degradation products can be identified by a variety of analytical tests such as cIEF, SEC, SDS-PAGE, CE-SDS, dynamic light scattering (DLS), analytical ultracentrifugation (AUC) and field flow fractionation (FFF).
(49) Specifically, cIEF separates antibody isomers by differences in their isoelectric point (pI) which results from the overall charge on the molecule being a function of the pH of its surroundings. The cIEF electropherograms of non-stressed HuMax-AXL samples typically showed one major peak accounting for more than 60% of the total peak area, as well as both acidic and basic isoforms. For the comparison of cIEF data between various formulations, the percentage main, acidic and basic isoforms was used.
(50) SEC is a chromatographic method in which molecules in solution are separated by their size and/or molecular weight. The SEC chromatograms of non-stressed HuMax-AXL samples typically showed one major peak that corresponded to the monomeric antibody, and accounted for more than 90% of the total peak area. This one major SEC peak reflected the antibody's size homogeneity in each formulation. For the comparison of SEC data between various formulations, the peak area values for species that eluted before the main peak were combined and reported as percent HMW (High molecular weight) species and usually represent an aggregated form. Similarly, the peak area values for species that eluted after the main peak were combined and reported as percent LMW (low molecular weight) species and usually represent degraded forms.
(51) A280 is a spectrophotometric method measuring the ultraviolet absorbance at 280 nm. Determination of the protein concentration by ultraviolet absorption (280 nm) depends on the presence of aromatic amino acids in the protein. The concentration of the solution can be calculated using Beer-Lambert Law: (c=A/?.sup.?I); where c is the molar concentration, I is the path-length of the cuvette (units cm), ? is the molar extinction coefficient (units M.sup.?1 cm.sup.?1) and A is the absorbance at 280 nm.
(52) For example, a lyophilized AXL-ADC formulation of the invention of pharmaceutically acceptable stability can be one wherein, when stored at a temperature of about 5?3? C. or 25?2? C. for a period of least about 3 months, preferably about 6 months, and more preferably about 12 months or longer, such as 18 months or longer, such as for at least 24 or even 36 months, the amount of aggregates is less than about 10%, preferably less than about 5%, more preferably less than about 2%, when determined using SEC analysis e.g.
(53) according to Example 9. Additionally or alternatively, a stable lyophilized AXL-ADC formulation of the invention can be one wherein, when stored at a temperature of about 5?3? C. or 25?2? C. for a period of least about 3 months, preferably about 6 months, and more preferably about 12 months or longer, the changes of main isoform are less than 15%, preferably less than 10%, more preferably less than 8%, most preferably less than 5%, when determined using cIEF analysis, e.g., according to Example 9.
(54) In one embodiment, a lyophilized AXL-ADC formulation of pharmaceutically acceptable stability can be one wherein, when stored at 2-8? C., such as at about 5? C. for at least 6 months, such as for at least 9 months, such as for at least 15 months or preferably for at least 18 months, or even more preferred for at least 24 months, or most preferred for at least 36 months, the amount of aggregates is less than 10%, such as less than 5.0%, such as less than 3.0%, such as less than 2.0%.
(55) In one embodiment, an aqueous anti-AXL antibody formulation of pharmaceutically acceptable stability can be one wherein, when stored at ?70? C.?10? C., such as at about-70? C. for at least 6 months, such as for at least 9 months, such as for at least 15 months, such as for at least 18 months, such as for at least 24 months, or such as for at least 36 months, the amount of aggregates is less than 15%, such as less than 10%, such as less than 8.0%, such as less than 5.0%.
(56) AXL-ADCS:
(57) 1) Lyophilized Formulations:
(58) The invention thus provides for the following exemplary and non-limiting lyophilized formulations of AXL-ADCs, each representing a specific embodiment:
(59) In one embodiment, the invention provides a lyophilized formulation of an anti-AXL antibody-drug conjugate (AXL-ADC), the lyophilized formulation obtainable or obtained by lyophilizing an aqueous formulation comprising said AXL-ADC and one or more excipients, wherein the formulation is free, or at least essentially free, of surfactant. Suitable excipients include a buffer which provides for a pH of between about 5 and about 7 in the aqueous formulation, at least one non-reducing sugar which forms an amorphous phase with the AXL-ADC in solid state; and at least one bulking agent.
(60) In another embodiment, the invention provides a lyophilized formulation of an AXL-ADC, the lyophilized formulation obtainable or obtained by lyophilizing an aqueous formulation comprising (a) an AXL-ADC; (b) a buffer providing for a pH of between about 5 and about 7 in the aqueous formulation; (c) at least one bulking agent; and (d) at least one non-reducing sugar which forms an amorphous phase with the ADC in solid state.
(61) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH in the range of about 5 to about 7, such as about 5.5 to about 6.5, and comprising about 5 mg/ml to about 30 mg/ml AXL-ADC; about 10 mM to about 100 mM histidine buffer; about 15 mM to about 200 mM sucrose or trehalose; and about 50 mM to about 300 mM mannitol or glycine.
(62) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH in the range of about 5 to about 7, such as of about 5.5 to about 6.5, and comprising about 5 mg/mL to about 30 mg/ml AXL-ADC and about 5 mM to about 100 mM histidine buffer; about 15 mM to about 200 mM sucrose or trehalose; and about 100 mM to about 225 mM mannitol or glycine.
(63) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH in the range of about 5 to about 7, optionally of about 5.5 to about 6.5; comprising about 5 mg/ml to about 30 mg/mL AXL-ADC; about 5 mM to about 100 mM histidine buffer; about 30 mM to about 150 mM sucrose or trehalose; and about 100 mM to about 225 mM mannitol or glycine.
(64) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH in the range of about 5 to about 7, optionally of about 5.5 to about 6.5; comprising about 5 mg/ml to about 30 mg/ml AXL-ADC; about 10 mM to about 50 mM histidine buffer; about 30 mM to 150 mM sucrose or trehalose; and about 100 mM to about 225 mM mannitol or glycine.
(65) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH in the range of about 5 to about 7, optionally of about 5.5 to about 6.5; comprising about 5 mg/ml to about 30 mg/ml AXL-ADC; about 10 mM to about 50 mM histidine buffer; about 30 mM to about 150 mM sucrose or trehalose; and about 150 mM to about 180 mM, such as about 160 mM to about 170 mM mannitol or glycine.
(66) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH in the range of about 5 to about 7, optionally of about 5.5 to about 6.5; comprising about 5 mg/ml to about 30 mg/mL AXL-ADC; about 10 mM to about 50 mM histidine buffer; about 30 mM to about 150 mM sucrose or trehalose, such as about 80 mM to 100 mM; and about 100 mM to about 225 mM mannitol or glycine.
(67) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH in the range of about 5 to about 7, optionally of about 5.5 to about 6.5; comprising about 5 mg/ml to about 30 mg/ml AXL-ADC; about 10 mM to about 50 mM histidine buffer; about 30 mM to about 150 mM sucrose; and about 100 mM to about 225 mM mannitol.
(68) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH in the range of about 5 to about 7, optionally between about 5.5 and about 6.5, and comprising about 5 mg/ml to about 30 mg/mL AXL-ADC; about 10 mM to about 50 mM histidine buffer; about 30 mM to about 150 mM sucrose or trehalose; and about 150 mM to about 180 mM mannitol or glycine.
(69) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH in the range of about 5 to about 7, optionally of about 5.5 to about 6.5; comprising about 5 mg/ml to about 30 mg/mL AXL-ADC; about 10 mM to about 50 mM histidine buffer; about 15 mM to 120 mM sucrose or trehalose; and about 100 mM to about 225 mM mannitol or glycine.
(70) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH in the range of about 5 to about 7, optionally of about 5.5 to about 6.5; comprising about 5 mg/mL to about 30 mg/ml AXL-ADC; about 10 mM to about 50 mM histidine buffer; about 15 mM to about 120 mM sucrose or trehalose; and about 150 mM to about 180 mM, such as about 160 mM to about 170 mM mannitol or glycine.
(71) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH in the range of about 5 to about 7, optionally of about 5.5 to about 6.5; comprising about 5 mg/ml to about 30 mg/ml AXL-ADC; about 10 mM to about 50 mM histidine buffer; about 15 mM to about 120 mM sucrose or trehalose, such as about 80 mM to 100 mM; and about 100 mM to about 225 mM mannitol or glycine.
(72) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH in the range of about 5 to about 7, optionally of about 5.5 to about 6.5; comprising about 5 mg/ml to about 30 mg/mL AXL-ADC; about 10 mM to about 50 mM histidine buffer; about 15 mM to about 120 mM sucrose; and about 100 mM to about 225 mM mannitol.
(73) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH of about 5 to about 7, optionally between about 5.5 and about 6.5, and comprising about 5 mg/mL to about 30 mg/mL AXL-ADC; about 10 mM to about 50 mM histidine buffer; about 15 mM to about 120 mM sucrose or trehalose; and about 150 mM to about 180 mM mannitol or glycine.
(74) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH in the range of about 5 to about 7, such as of about 5.5 to about 6.5, and comprising about 5 mg/mL to about 30 mg/ml AXL-ADC and about 5 mM to about 100 mM histidine buffer; about 20 mM to about 100 mM, such as about 30 mM to about 90 mM, such as about 70 to about 90 mM sucrose or trehalose; and about 100 mM to about 225 mM mannitol or glycine.
(75) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH in the range of about 5 to about 7, such as of about 5.5 to about 6.5, and comprising about 5 mg/mL to about 30 mg/mL AXL-ADC and about 10 mM to about 50 mM histidine buffer; about 20 mM to about 100 mM, such as about 30 mM to about 90 mM, such as about 70 to about 90 mM sucrose or trehalose; and about 150 mM to about 180 mM mannitol or glycine.
(76) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH of about 5 to about 7, optionally between about 5.5 and about 6.5; comprising about 5 mg/ml to about 30 mg/ml AXL-ADC; about 10 mM to about 50 mM histidine buffer; about 80 mM to about 100 mM sucrose or trehalose; and about 150 mM to about 180 mM mannitol or glycine.
(77) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH of about 5 to about 7, optionally between about 5.5 and about 6.5; comprising about 5 mg/ml to about 30 mg/ml AXL-ADC; about 10 mM to about 50 mM histidine buffer; about 80 mM to about 100 mM sucrose; and about 150 mM to about 180 mM mannitol.
(78) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH between about 5.5 and about 6.5 and comprising about 5 mg/mL to about 30 mg/mL AXL-ADC; about 20 mM to about 40 mM histidine buffer; about 80 mM to about 100 mM sucrose; and about 150 mM to about 180 mM mannitol.
(79) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH between about 5.5 and about 6.5 and comprising about 7 mg/mL to about 20 mg/mL AXL-ADC; about 20 mM to about 40 mM histidine buffer; about 80 mM to about 100 mM sucrose; and about 150 mM to about 180 mM mannitol.
(80) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH between about 5.5 and about 6.5 and comprising about 7 mg/mL to about 20 mg/ml AXL-ADC; about 20 mM to about 40 mM histidine buffer; about 80 mM to about 100 mM sucrose; and about 158 mM to about 172 mM mannitol.
(81) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH between about 5.5 and about 6.5 and comprising about 7 mg/mL to about 20 mg/mL AXL-ADC; about 20 mM to about 40 mM histidine buffer; about 84 mM to about 92 mM sucrose; and about 158 mM to about 172 mM mannitol.
(82) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH between about 5.5 and about 6.5 and comprising about 9 mg/mL to about 11 mg/ml AXL-ADC; about 20 mM to about 40 mM histidine buffer; about 84 mM to about 92 mM sucrose; and about 158 mM to about 172 mM mannitol.
(83) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH of about 6 and comprising about 10 mg/mL AXL-ADC; about 30 mM histidine buffer; about 88 mM sucrose; and about 165 mM mannitol.
(84) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation comprising about 9 mg/ml to about 11 mg/mL AXL-ADC, such as about 10 mg/mL AXL-ADC wherein the AXL-ADC is HuMax-AXL-ADC (IgG1, vcMMAE), which is an ADC composed of a human monoclonal IgG1,? antibody herein referred to as 107, conjugated via a protease cleavable valine citrulline linker, mc-vc-PAB, to the drug monomethyl auristatin E (vcMMAE), and pharmaceutically acceptable excipients comprising about 30 mM histidine buffer providing for a pH of about 6; about 88 mM sucrose; and about 165 mM mannitol or glycine.
(85) In one preferred embodiment, the antibody moiety of the AXL-ADC, comprises at least one antigen-binding region which comprises a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107].
(86) In separate and specific embodiments, the formulations are essentially free of surfactant.
(87) In other separate and specific embodiments, the formulations are free of surfactant.
(88) In one embodiment, the invention relates to a lyophilized formulation of an AXL-ADC, the lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation comprising: a buffer which provides for a pH of the aqueous formulation and the reconstituted formulation in the range of about 5 to about 7, at least one non-reducing sugar which forms an amorphous phase with the AXL-ADC in solid state and at least one bulking agent, wherein the AXL-ADC comprises a linker which is selected from mc-vc-PAB and SSP, a cytotoxic agent selected from MMAE, MMAF and DM1 and an anti-AXL antibody which competes for binding to AXL with a reference antibody comprising the VH and VL regions from an anti-AXL antibody selected from the group consisting of 107, 148, 733, 154, 171, 183, 613, 726, 140, M103L, 172, 181, 183-N52Q, 187, 608-01, 610-01, 613-08, 620-06 and M101L; optionally wherein the lyophilized formulation is essentially free of any surfactant.
(89) In other separate and specific embodiments, the invention provides for a lyophilized formulation of any one of the preceding embodiments, which is essentially free of any polysorbate, optionally of any surfactant.
(90) In one specific embodiment of any one of the preceding embodiments, the lyophilized formulation of any one of the preceding embodiments comprises mannitol and sucrose, wherein the weight ratio of mannitol to sucrose is at least about 1, such as between about 1 and about 20, such as between about 1 and about 10, such as between about 1 and about 5, such as between about 1 and about 2, such as about 1.
(91) In one specific embodiment of any one of the preceding embodiments, the lyophilized formulation of any one of the preceding embodiments comprises mannitol and trehalose, wherein the weight ratio of mannitol to trehalose is at least about 1, such as between about 1 and about 20, such as between about 1 and about 10, such as between about 1 and about 5, such as between about 1 and about 2, such as about 1.
(92) In one specific embodiment of any one of the preceding embodiments, the lyophilized formulation of any one of the preceding embodiments comprises mannitol and sucrose, wherein the weight ratio of mannitol to sucrose is between about 1 and about 10 and the weight ratio of mannitol to ADC is at least about 3, such as between about 3 and about 20, such as between about 3 and about 10.
(93) The invention also provides for a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH in the range of about 5.5 to about 6.5 and comprising, optionally consisting of, from about 9 mg/ml to about 11 mg/ml AXL-ADC; about 30 mM histidine; about 88 mM sucrose; and about 165 mM mannitol.
(94) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH between about 5.5 and about 6.5 and comprising about 7 mg/mL to about 20 mg/mL AXL-ADC; about 20 mM to about 40 mM histidine buffer; about 84 mM to about 92 mM sucrose; and about 2.5% to about 3.5% (w/v), such as about 3% (w/v) mannitol, glycine or a combination thereof.
(95) In one embodiment, the invention relates to a lyophilized formulation obtained or obtainable by lyophilizing an aqueous formulation having a pH between about 5.5 and about 6.5 and comprising about 7 mg/mL to about 20 mg/mL AXL-ADC; about 20 mM to about 40 mM histidine buffer; about 2.5% (w/v) to about 3.5% (w/v) sucrose, trehalose or a combination thereof; and about 2.5% to about 3.5% (w/v) of mannitol, glycine or a combination thereof.
(96) A lyophilized formulation of an AXL-ADC can be prepared by lyophilizing an aqueous formulation comprising, or consisting essentially of, about 9 mg/mL to about 11 mg/mL AXL-ADC and pharmaceutically acceptable excipients comprising: about 30 mM histidine buffer providing for a pH of about 5.5 to about 6.5 in the aqueous formulation; about 88 mM sucrose; and about 165 mM mannitol; wherein the antibody comprises at least one binding region comprising a VH region and a VL region comprising the VH and VL CDRs, or the VH and VL sequences of, an antibody selected from the group consisting of 107, 148, 733, 154, 171, 183, 613, 726, 140, M103L, 172, 181, 183-N52Q, 187, 608-01, 610-01, 613-08, 620-06 and M101L; wherein the drug is MMAE or DM1, e.g., a linker-drug which is mc-vc-PAB-MMAE or SSP-DM1. In one embodiment, the AXL-ADC comprises at least one binding region comprising the VH and VL CDRs, or the VH and VL sequences of, antibody 107, and the linker-drug is mc-vc-PAB-MMAE. Additionally, the antibody moiety of the AXL-ADC may preferably be a full-length antibody, such as a full-length monoclonal IgG1,? antibody.
(97) In one embodiment, the lyophilized AXL-ADC formulation of the invention contains less than 3.0% moisture (wt/wt). In one embodiment, the lyophilized formulation of the invention contains less than 2.0% moisture. In one embodiment, the lyophilized formulation of the invention contains less than 1.0% moisture. In one embodiment, the lyophilized formulation of the invention contains less than 0.5% moisture.
(98) In one embodiment, in the lyophilized formulation, the AXL-ADC is stable at 2-8? C., such as at 5? C. for pharmaceutical use for at least 6 months, such as for at least 9 months, such as for at least 15 months or preferably for at least 18 months, or even more preferred for at least 24 months, or most preferred for at least 36 months.
(99) In one embodiment, the lyophilized formulation is stable when it has less than 10% aggregates, such as less than 5.0% aggregates, such as less than 3.0% aggregates, such as less than 2.0% aggregates when stored at 5? C. for at least 6 months, such as for at least 9 months, such as for at least 15 months or preferably for at least 18 months, or even more preferred for at least 24 months, or most preferred for at least 36 months.
(100) In one embodiment, the stability is determined by size-exclusion analysis, cIEF, or both.
(101) In one embodiment, the lyophilized formulation is free of any inorganic salts.
(102) The following are additional embodiments contemplated: 1. A lyophilized formulation of an AXL-ADC, the lyophilized formulation obtainable or obtained by lyophilizing an aqueous formulation comprising the AXL-ADC and one or more excipients, wherein the aqueous formulation is free of any surfactant. 2. A lyophilized formulation of an AXL-ADC, the lyophilized formulation obtainable or obtained by lyophilizing an aqueous formulation comprising the AXL-ADC and (a) a buffer providing for a pH of between about 5 and about 7 in the aqueous formulation; (b) at least one bulking agent; and (c) at least one non-reducing sugar which forms an amorphous phase with the ADC in solid state. 3. The lyophilized formulation of embodiment 2, wherein the aqueous formulation is free of any surfactant. 4. The lyophilized formulation of any one of the preceding embodiments, wherein the aqueous formulation comprises a buffer selected from the group consisting of histidine, citrate, 2-(N-morpholino) ethanesulfonic acid (MES), succinate, glycolate, carbonic acid and phosphate, or a combination of any thereof, wherein the pH of the aqueous formulation is in a range from about 5 to about 7. 5. The lyophilized formulation of any one of the preceding embodiments, wherein the aqueous formulation comprises a histidine buffer. 6. The lyophilized formulation of any one of the preceding embodiments, wherein the aqueous formulation comprises a buffer at a concentration of about 5 mM to about 100 mM, such as from about 10 mM to about 50 mM buffer, such as from about 20 mM to about 40 mM, such as from about 28 mM to about 32 mM, such as about 30 mM buffer. 7. The lyophilized formulation of any one of the preceding embodiments, comprising a bulking agent selected from mannitol, glycine, and a combination thereof. 8. The lyophilized formulation of any one of the preceding embodiments, comprising mannitol. 9. The lyophilized formulation of any one of the preceding embodiments, wherein the aqueous formulation comprises a bulking agent at a concentration of about 1% (w/v) to about 5% (w/v), such as about 2% (w/v) to about 4% (w/v), such as from about 2.5% (w/v) to about 3.5% (w/v), such as about 3% (w/v). 10. The lyophilized formulation of any one of the preceding embodiments, wherein the aqueous formulation comprises a bulking agent at a concentration of about 50 mM to about 300 mM, such as from about 100 mM to about 225 mM, such as from about 150 mM to about 180 mM, such as about 165 mM. 11. The lyophilized formulation of any one of the preceding embodiments, comprising a non-reducing sugar selected from sucrose, trehalose, and a combination thereof. 12. The lyophilized formulation of any one of the preceding embodiments, comprising sucrose. 13. The lyophilized formulation of any one of the preceding embodiments, wherein the aqueous formulation comprises a non-reducing sugar at a concentration of about 0.5% (w/v) to about 7% (w/v), such as from about 0.5% (w/v) to about 4% (w/v), such as from about 1% (w/v) to about 3% (w/v) or from about 2.5% to about 3.5%, such as about 3% (w/v). 14. The lyophilized formulation of any one of the preceding embodiments, wherein the aqueous formulation comprises a non-reducing sugar at a concentration of about 15 mM to about 200 mM, such as from about 15 mM to about 120 mM, such as from about 30 mM to about 90 mM, such as 80 mM to about 100 mM, such as from about 84 mM to about 92 mM sucrose, such as about 88 mM. 15. The lyophilized formulation of any one of the preceding embodiments, wherein the AXL-ADC concentration in the aqueous formulation is from about 5 mg/mL to about 30 mg/mL, such as from about 7 mg/mL to about 20 mg/mL, such as from about 8 mg/ml to about 15 mg/mL, such as from about 9 mg/ml to about 11 mg/mL, such as about 10 mg/mL. 16. The lyophilized formulation of any one of the preceding embodiments, wherein the pH of the aqueous formulation is in a range from about 5.5 to 6.5, such as from about 5.8 to about 6.2, such as about 6. 17. A lyophilized formulation obtainable or obtained by lyophilizing an aqueous formulation having a pH of about 5 to about 7 and comprising (a) from about 5 mg/mL to about 30 mg/ml of an AXL-ADC and (b) from about 10 mM to about 50 mM histidine; (c) from about 15 mM to about 120 mM sucrose or trehalose; and (d) from about 150 mM to about 180 mM mannitol or glycine. 18. The lyophilized formulation of embodiment 17, wherein the aqueous formulation has a pH in the range of about 5.5 to about 6.5 and comprises (a) from about 9 mg/mL to about 11 mg/mL AXL-ADC, such as about 10 mg/ml of the AXL-ADC; (b) from about 20 mM to about 40 mM histidine, such as about 30 mM histidine; (c) from about 80 mM to about 100 mM sucrose, such as about 88 mM sucrose; and (d) from about 150 mM to about 180 mM mannitol, such as about 165 mM; wherein the aqueous formulation is free of any surfactant.
(103) In a preferred embodiment, in the AXL-ADC of the lyophilized formulation, the antibody moiety comprises the VH and VL CDRs, optionally the VH (SEQ ID NO:1) and VL (SEQ ID NO: 2) sequences, of human anti-ADC antibody 107, and the linker is mc-vc-PAB and the cytotoxic agent is MMAE.
(104) In another preferred embodiment, in the AXL-ADC of the lyophilized formulation, the antibody moiety comprises the VH and VL CDRs, optionally the VH (SEQ ID NO:1) and VL (SEQ ID NO:2) sequences, of human anti-ADC antibody 107, and the linker is SSP and the cytotoxic agent is DM1.
(105) Additionally, the antibody moiety of the AXL-ADC may preferably be a full-length antibody, such as a full-length monoclonal IgG1,? antibody.
(106) 2) Liquid Formulation:
(107) The invention also provides for a pharmaceutically acceptable liquid formulation obtained or obtainable by reconstituting the lyophilized formulation of any one of the preceding aspects or embodiments in a sterile aqueous diluent.
(108) For example, such a liquid formulation may have a pH of between about 5 and about 7 and comprise or consist essentially of about 5 mg/ml to about 30 mg/ml AXL-ADC, about 10 mM to about 50 mM histidine; about 30 mM to about 150 mM sucrose or trehalose; and about 50 mM to about 300 mM mannitol or glycine.
(109) In one embodiment, the liquid formulation has a pH of about 5 to about 7 and comprises or consist essentially of about 5 mg/mL to about 30 mg/mL AXL-ADC, about 10 mM to about 50 mM histidine; about 15 mM to about 120 mM sucrose or trehalose; and about 100 mM to about 225 mM mannitol or glycine.
(110) In one embodiment, the liquid formulation has a pH of between about 5.5 and about 6.5 and comprises or consists essentially of from about 9 mg/mL to about 11 mg/mL AXL-ADC; from about 20 mM to about 40 mM histidine; from about 80 mm to about 100 mM sucrose; and from about 150 mM to about 180 mM mannitol; wherein the liquid formulation is essentially free of any surfactant.
(111) In one embodiment, the liquid formulation has a pH of about 6 and comprises or consists essentially of about 10 mg/ml of the AXL-ADC; about 30 mM histidine; about 88 mM sucrose; and about 165 mM mannitol; wherein the liquid formulation is free of any surfactant.
(112) In one embodiment, the liquid formulation has a pH of between about 5.5 and about 6.5 and comprises or consists essentially of from about 9 mg/ml to about 11 mg/ml AXL-ADC, about 28 mM to about 34 mM histidine, about 84 mM to about 92 mM sucrose and about 160 to about 170 mM mannitol.
(113) In a preferred embodiment, in the AXL-ADC of the liquid formulation, the antibody moiety comprises the VH and VL CDRs, optionally the VH (SEQ ID NO: 1) and VL (SEQ ID NO:2) sequences, of human anti-ADC antibody 107, and the linker is mc-vc-PAB and the cytotoxic agent is MMAE.
(114) In another preferred embodiment, in the AXL-ADC of the liquid formulation, the antibody moiety comprises the VH and VL CDRs, optionally the VH (SEQ ID NO:1) and VL (SEQ ID NO:2) sequences, of human anti-ADC antibody 107, and the linker is SSP and the cytotoxic agent is DM1.
(115) Additionally, the antibody moiety of the AXL-ADC may preferably be a full-length antibody, such as a full-length monoclonal IgG1,? antibody.
(116) 3) Aqueous Formulation:
(117) The invention also provides for an aqueous formulation (also referred to as aqueous solution herein) suitable for preparing a lyophilized formulation of an AXL-ADC according to any one of the preceding aspects or embodiments. The aqueous formulation of an AXL-ADC may also in itself be suitable for pharmaceutical purposes and for therapeutic applications of the AXL-ADCs.
(118) Such an aqueous formulation may, for example, comprise (a) from about 7 mg/mL to about 20 mg/ml AXL-ADC, optionally comprising the VH and VL CDRs or the VH and VL sequences, of anti-AXL antibody 107, (b) about 10 mM to 50 mM histidine; (c) about 30 mM to about 150 mM sucrose; (d) about 150 mM to about 180 mM mannitol; or (e) a combination of a) and any two, three or all of (b) to (d).
(119) The invention also provides for an aqueous formulation suitable for preparing a lyophilized formulation of an AXL-ADC, comprising (a) from about 7 mg/mL to about 20 mg/mL AXL-ADC, optionally comprising the VH and VL CDRs or the VH and VL sequences, of anti-AXL antibody 107, (b) about 10 mM to 50 mM histidine; (c) about 15 mM to about 120 mM sucrose; (d) about 150 mM to about 180 mM mannitol; or (e) a combination of (a) and any two, three or all of (b) to (d).
(120) The invention also provides for an aqueous formulation suitable for preparing a lyophilized formulation of an AXL-ADC, comprising (a) from about 7 mg/mL to about 20 mg/mL AXL-ADC, optionally comprising the VH and VL CDRs or the VH and VL sequences, of anti-AXL antibody 107, (b) about 10 mM to 50 mM histidine; (c) about 80 mM to about 100 mM sucrose; (d) about 150 mM to about 180 mM mannitol; or (e) a combination of a) and any two, three or all of (b) to (d).
(121) The invention also provides for an aqueous formulation suitable for preparing a lyophilized formulation of an AXL-ADC wherein the aqueous formulation does not contain a surfactant, said solution comprising: (a) from about 7 mg/mL to about 20 mg/mL AXL-ADC, optionally comprising the VH and VL CDRs or the VH and VL sequences, of anti-AXL antibody 107, (b) about 10 mM to 50 mM histidine; (c) about 30 mM to about 150 mM sucrose; (d) about 150 mM to about 180 mM mannitol; or (e) a combination of (a) and any two, three or all of (b) to (d).
(122) The invention also provides for an aqueous formulation suitable for preparing a lyophilized formulation of an AXL-ADC wherein the aqueous formulation does not contain a surfactant, said solution comprising: (a) from about 7 mg/mL to about 20 mg/mL AXL-ADC, optionally comprising the VH and VL CDRs or the VH and VL sequences, of anti-AXL antibody 107, (b) about 10 mM to 50 mM histidine; (c) about 80 mM to about 100 mM sucrose; (d) about 150 mM to about 180 mM mannitol; or (e) a combination of (a) and any two, three or all of (b) to (d).
(123) The invention also provides for an aqueous formulation suitable for preparing a lyophilized formulation of an AXL-ADC, consisting of: (a) from about 7 mg/mL to about 20 mg/mL AXL-ADC, optionally comprising the VH and VL CDRs or the VH and VL sequences, of anti-AXL antibody 107, (b) about 10 mM to 50 mM histidine; (c) about 80 mM to about 100 mM sucrose; (d) about 150 mM to about 180 mM mannitol; or (e) a combination of (a) and any two, three or all of (b) to (d).
(124) Preferably, the histidine buffer provides for a pH in the range from about 5 to about 7, preferably from about 5.5 to about 6.5, such as about pH6, in the aqueous formulation.
(125) In a preferred embodiment, in the AXL-ADC of any aqueous formulation, the antibody moiety comprises the VH and VL CDRs, optionally the VH (SEQ ID NO:1) and VL (SEQ ID NO:2) sequences, of human anti-ADC antibody 107, and the linker is mc-vc-PAB and the cytotoxic agent is MMAE.
(126) In another preferred embodiment, in the AXL-ADC of any aqueous formulation, the antibody moiety comprises the VH and VL CDRs, optionally the VH (SEQ ID NO: 1) and VL (SEQ ID NO: 2) sequences, of human anti-ADC antibody 107, and the linker is SSP and the cytotoxic agent is DM1.
(127) Additionally, the antibody moiety of the AXL-ADC may preferably be a full-length antibody, such as a full-length monoclonal IgG1,? antibody.
(128) Anti-AXL Antibody:
(129) In one aspect, the invention relates to an aqueous formulation of an anti-AXL antibody, comprising one or more pharmaceutically acceptable excipients, wherein the aqueous formulation is free of any surfactant. In one embodiment, the one or more pharmaceutically acceptable excipients comprise a buffer and at least one stabilizer, wherein the pH of the aqueous formulation is between about 5 and about 7, preferably between about 5.5 and about 6.5, such as between about 5.8 to about 6.2, such as about 6.
(130) Non-limiting examples of suitable buffers include histidine, citrate, MES, phosphate, carbonic acid, succinate, glycolate, and a combination of any thereof. One preferred buffer is histidine. The aqueous formulation may, for example, comprise a buffer at a concentration of about 10 to about 50 mM, such as from about 20 mM to about 40 mM buffer, such as from about 28 mM to about 34 mM, such as from about 29 mM to about 31 mM, such as about 30 mM buffer.
(131) Suitable stabilizers include mannitol, sucrose and trehalose, and combinations thereof. In one embodiment, the stabilizer is mannitol. The aqueous formulation may, for example, comprise a stabilizer at a concentration of about 20 mM to about 400 mM, such as from about 20 mM to about 200 mM or from about 30 mM to about 300 mM, such as from about 30 mM to about 100 mM, such as from about 40 mM to about 80 mM, such as about 50 mM to about 60 mM, such as about 55 mM. In one embodiment, the aqueous formulation comprises a stabilizer at a concentration of about 5% (w/v) or less, such as about 4% (w/v) or less, such as about 3% (w/v) or less, such as about 2% (w/v) or less, such as about 1% (w/v) or less, such as about 1% (w/v), such as between 0.4% to about 7% (w/v), such as between 0.5% to about 5% (w/v), such as between 0.5% and 1.5% (w/v), such as about 1% (w/v). In one embodiment, the stabilizer is mannitol.
(132) Optionally, the aqueous formulation further comprises a non-reducing sugar selected from sucrose, trehalose and a combination thereof.
(133) In one embodiment, the aqueous formulation of an anti-AXL antibody is free of any one or more of arginine, glycine, glutamic acid, sorbitol, trehalose, sucrose and sodium chloride.
(134) In one embodiment, the antibody concentration is from about 5 mg/mL to about 40 mg/mL, such as from about 8 mg/mL to about 35 mg/mL, such as from about 10 mg/mL to about 30 mg/mL, such as from about 15 mg/mL to about 25 mg/mL, such as about 20 mg/mL.
(135) In one embodiment, the aqueous formulation has a pH of about 5 to about 7 and comprises (a) from about 5 mg/mL to about 40 mg/mL of an anti-AXL antibody and (b) from about 10 mM to about 50 mM histidine; (c) from about 50 mM to about 300 mM mannitol.
(136) In one embodiment, the aqueous formulation has a pH in the range of about 5.5 to about 6.5 and comprises (a) from about 15 mg/mL to about 25 mg/mL anti-AXL antibody, such as about 20 mg/ml of the anti-AXL antibody; (b) from about 20 mM to about 40 mM histidine, such as about 30 mM histidine; (c) from about 50 mM to about 60 mM mannitol, such as about 55 mM,
wherein the aqueous formulation is free of any added surfactant, amino acid excipient and/or sodium chloride.
(137) In one embodiment, the anti-AXL antibody binds to the same epitope on human AXL as a reference antibody comprising an antigen-binding region comprising the VH and VL region sequences of SEQ ID NOS: 1 and 2, respectively. In one embodiment, the anti-AXL antibody comprises the VH and VL CDRs of anti-AXL antibody 107.
(138) In one embodiment, the invention relates to a frozen aqueous formulation of an anti-AXL antibody, obtained or obtainable by freezing the aqueous formulation of any preceding aspect or embodiment.
(139) In one preferred embodiment, the anti-AXL antibody comprises at least one antigen-binding region which comprises a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107].
(140) Antibodies
(141) The anti-AXL antibodies described in this section are suitable both for the aqueous formulations of the invention and for use in the AXL-ADCs of the lyophilized formulations of the invention, as described in the aspects and embodiments herein.
(142) Although generally applicable to any anti-AXL antibody, anti-AXL antibodies that share one or more physicochemical and/or antigen-binding binding properties with any one or more of the anti-AXL antibodies for which VH and VL sequences are provided herein are particularly suitable (see Table 1). The VH, VL and CDR sequences of preferred anti-AXL antibodies are shown in Table 1. The antibody designated 107, optionally in an IgG1,? format (also called HuMax AXL or IgG1-HuMax-AXL) is particularly preferred.
(143) In one embodiment, the anti-AXL antibody comprises at least one binding region comprising a VH region and a VL region selected from the group consisting of: (a) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; (b) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; (c) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively [733]; (d) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 53, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 55, GAS, and 56, respectively [154]; (e) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 54, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 55, GAS, and 56, respectively [154-M103L]; (f) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 60, GAS, and 61, respectively, [171]; (g) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 62, 63, and 64, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 65, GAS, and 66, respectively, [172]; (h) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 67, 68, and 69, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 70, GAS, and 71, respectively, [181]; (i) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 73, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183]; (j) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183-N52Q]; (k) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 78, 79, and 80, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 81, AAS, and 82, respectively, [187]; (l) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 83, 84, and 85, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 86, GAS, and 87, respectively, [608-01]; (m) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 88, 89, and 90, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 91, GAS, and 92, respectively, [610-01]; (n) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 94, and 95, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 96, GAS, and 97, respectively, [613]; (o) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 98, 99, and 100, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 101, DAS, and 102, respectively, [613-08]; (p) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 103, 104, and 105, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 106, GAS, and 107, respectively, [620-06]; (q) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 110, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively, [726]; (r) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively, [726-M101L]; (s) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 41, 42, and 43, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 44, AAS, and 45, respectively, [140]; (t) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 94, and 95, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 128, XAS, wherein X is D or G, and 129, respectively, [613/613-08]; (u) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 119, and 120, respectively; and a VL region comprising CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148/140]; (v) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 123, 124, and 125, respectively; and a VL region comprising CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 60, GAS, and 61, respectively [171/172/181]; and (w) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 121, 109, and 122, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively [726/187]; and (x) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 126, and 127, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 96, GAS, and 97, respectively [613/608-01/610-01/620-06].
(144) In one embodiment, the anti-AXL antibody comprises at least one binding region comprising a VH region and a VL region selected from the group consisting of VH and VL sequences at least 90%, such as at least 95%, such as at least 97%, such as at least 99% identical to: (a) a VH region comprising SEQ ID No: 1 and a VL region comprising SEQ ID No: 2 [107]; (b) a VH region comprising SEQ ID No: 5 and a VL region comprising SEQ ID No:6 [148]; (c) a VH region comprising SEQ ID No:34 and a VL region comprising SEQ ID No:35 (d) a VH region comprising SEQ ID No: 7 and a VL region comprising SEQ ID No:9 [154]; (e) a VH region comprising SEQ ID No:10 and a VL region comprising SEQ ID No: 11 [171];
(145) (f) a VH region comprising SEQ ID No:16 and a VL region comprising SEQ ID No: 18 [183];
(146) (g) a VH region comprising SEQ ID No:25 and a VL region comprising SEQ ID No:26 [613];
(147) (h) a VH region comprising SEQ ID No:31 and a VL region comprising SEQ ID No:33 [726];
(148) (i) a VH region comprising SEQ ID No:3 and a VL region comprising SEQ ID No: 4 [140];
(149) (j) a VH region comprising SEQ ID No:8 and a VL region comprising SEQ ID No:9 [154-M103L];
(150) (k) a VH region comprising SEQ ID No:12 and a VL region comprising SEQ ID No: 13 [172];
(151) (I) a VH region comprising SEQ ID No:14 and a VL region comprising SEQ ID No: 15 [181];
(152) (m) a VH region comprising SEQ ID No:17 and a VL region comprising SEQ ID No: 18 [183-N52Q];
(153) (n) a VH region comprising SEQ ID No:19 and a VL region comprising SEQ ID No:20 [187];
(154) (o) a VH region comprising SEQ ID No:21 and a VL region comprising SEQ ID No:22 [608-01];
(155) (p) a VH region comprising SEQ ID No:23 and a VL region comprising SEQ ID No:24 [610-01];
(156) (q) a VH region comprising SEQ ID No:27 and a VL region comprising SEQ ID No:28 [613-08];
(157) (r) a VH region comprising SEQ ID No:29 and a VL region comprising SEQ ID No:30 [620-06]; and(s) a VH region comprising SEQ ID No:32 and a VL region comprising SEQ ID No:33 [726-M101L].
(158) In one embodiment, the anti-AXL antibody comprises at least one binding region comprising a VH region and a VL region selected from the group consisting of: (a) a VH region comprising SEQ ID No: 1 and a VL region comprising SEQ ID No: 2 [107]; (b) a VH region comprising SEQ ID No: 5 and a VL region comprising SEQ ID No: 6 [148]; (c) a VH region comprising SEQ ID No:34 and a VL region comprising SEQ ID No:35 (d) a VH region comprising SEQ ID No:7 and a VL region comprising SEQ ID No:9 [154]; (e) a VH region comprising SEQ ID No:10 and a VL region comprising SEQ ID No: 11 [171]; (f) a VH region comprising SEQ ID No:16 and a VL region comprising SEQ ID No: 18 [183]; (g) a VH region comprising SEQ ID No:25 and a VL region comprising SEQ ID No:26 [613]; (h) a VH region comprising SEQ ID No:31 and a VL region comprising SEQ ID No:33 [726]; (i) a VH region comprising SEQ ID No:3 and a VL region comprising SEQ ID No: 4 [140]; (j) a VH region comprising SEQ ID No: 8 and a VL region comprising SEQ ID No:9 [154-M103L]; (k) a VH region comprising SEQ ID No:12 and a VL region comprising SEQ ID No:13 [172]; (l) a VH region comprising SEQ ID No:14 and a VL region comprising SEQ ID No:15 [181]; (m) a VH region comprising SEQ ID No:17 and a VL region comprising SEQ ID No: 18 [183-N52Q]; (n) a VH region comprising SEQ ID No:19 and a VL region comprising SEQ ID No:20 [187]; (o) a VH region comprising SEQ ID No:21 and a VL region comprising SEQ ID No:22 [608-01]; (p) a VH region comprising SEQ ID No:23 and a VL region comprising SEQ ID No:24 [610-01]; (q) a VH region comprising SEQ ID No:27 and a VL region comprising SEQ ID No:28 [613-08]; (r) a VH region comprising SEQ ID No:29 and a VL region comprising SEQ ID No:30 [620-06]; and(s) a VH region comprising SEQ ID No:32 and a VL region comprising SEQ ID No:33 [726-M101L].
(159) In one embodiment, the anti-AXL antibody binds to the same epitope on AXL as any one or more of the antibodies according to the aforementioned embodiment, as defined by their VH and VL sequences, e.g., a VH region comprising SEQ ID No: 1 and a VL region comprising SEQ ID No: 2 [107].
(160) Methods of determining an epitope to which an antibody binds are well-known in the art. One such method was used in Example 15, wherein the AXL epitope and/or domain specificity was mapped by preparing a panel of human-mouse chimeric AXL mutants where the human Ig1-like, Ig2-like, FN1 or FN2 domain has been replaced by its murine analog and determining which mutant an anti-AXL antibody bound to. So, in separate and specific embodiments, the antibody binds to the Ig1-like domain of AXL, the Ig2-like domain of AXL, the FN1 domain of AXL, or the FN2 domain of AXL.
(161) A more high-resolution epitope mapping method was also used in this Example. Specifically, this method analyzed binding of the anti-AXL antibody to a library of AXL sequence variants generated by recombination of AXL sequences derived from species with variable levels of homology with the human AXL sequence (SEQ ID NO: 130) in the extracellular domain.
(162) A more high-resolution epitope-mapping method, identifying AXL extracellular domain amino acids involved in antibody binding, was also used in this Example. Specifically, this method analyzed binding of the anti-AXL antibody to a library of AXL sequence variants generated by recombination of AXL sequences derived from species with variable levels of homology with the human AXL sequence (SEQ ID NO: 130) in the extracellular domain. This method was based on the principle that these human AXL-specific antibodies recognize human AXL, but not the AXL from any of the other species used in the example.
(163) So, in one embodiment, the antibody binds to an epitope within the Ig1 domain of AXL, and the antibody binding is dependent on one or more or all of the amino acids corresponding to positions L121 to Q129 or one or more or all of T112 to Q124 of human AXL, wherein the numbering of amino acid residues refers to their respective positions in human AXL (SEQ ID NO: 130). In one embodiment, the antibody binds to an epitope within the Ig1 domain of AXL, and antibody binding is dependent on the amino acids corresponding to positions L121 to Q129 or T112 to Q124 of human AXL. In a preferred embodiment antibody binding is dependent on one or more or all amino acids in position L121, G122, H123, Q124, T125, F126, V127, S128 and Q129, corresponding to the amino acids involved in the binding of the antibody herein designated 107. In one embodiment, antibody binding is dependent on one or more or all amino acid in position T112, G113, Q114, Y115, Q116, C117, L118, V119, F120, L121, G122, H123 and Q124.
(164) In another embodiment, the antibody binds to an epitope within the Ig2 domain of AXL, and antibody binding is dependent on one or more or all of the amino acids corresponding to position D170 or the combination of D179 or one or more or all of the amino acids in positions T182 to R190 of human AXL. In one embodiment antibody binding is dependent on the amino acids in position T182, A183, P183, G184, H185, G186, P187, Q189 and R190.
(165) In another embodiment, the antibody binds to an the FN1 domain of human AXL, and antibody binding is dependent on one or more or all of the amino acids corresponding to positions Q272 to A287 and G297 to P301 of human AXL. In one embodiment, antibody binding is dependent on the amino acids corresponding to positions Q272 to A287 and G297 to P301 of human AXL.
(166) In another embodiment, the antibody binds to the FN2 domain of human AXL and antibody binding is dependent on one or more or all of the amino acids corresponding to positions A359, R386, and Q436 to K439 of human AXL.
(167) In yet another embodiment, the antibody binds to an epitope within the Ig1 domain of AXL, and the epitope comprises or requires one or more or all of the amino acids corresponding to positions L121 to Q129 or one or more or all of T112 to Q124 of human AXL, wherein the numbering of amino acid residues refers to their respective positions in human AXL (SEQ ID NO: 130). In one embodiment, the antibody binds to an epitope within the Ig1 domain of AXL, and the epitope comprises or requires the amino acids corresponding to positions L121 to Q129 or T112 to Q124 of human AXL. In a preferred embodiment the epitope comprises one or more or all amino acid in position L121, G122, H123, Q124, T125, F126, V127, S128 and Q129, corresponding to the amino acids involved in the binding of the antibody herein designated 107. In one embodiment, the epitope comprises one or more or all amino acid in position T112, G113, Q114, Y115, Q116, C117, L118, V119, F120, L121, G122, H123 and Q124.
(168) In another embodiment, the antibody binds to an epitope within the Ig2 domain of AXL, and the epitope comprises or requires one or more or all of the amino acids corresponding to position D170 or the combination of D179 or one or more or all of the amino acids in positions T182 to R190 of human AXL. In one embodiment the epitope comprises or requires the amino acids in position T182, A183, P183, G184, H185, G186, P187, Q189 and R190.
(169) In another embodiment, the antibody binds to an epitope within the FN1 domain of human AXL, which epitope comprises or requires one or more or all of the amino acids corresponding to positions Q272 to A287 and G297 to P301 of human AXL. In one embodiment, the epitope comprises or requires the amino acids corresponding to positions Q272 to A287 and G297 to P301 of human AXL.
(170) In another embodiment, the antibody binds to an epitope within the FN2 domain of human AXL, which epitope comprises or requires one or more or all of the amino acids corresponding to positions A359, R386, and Q436 to K439 of human AXL.
(171) In one embodiment, the antibody binds to an epitope within the FN1-like domain of human AXL.
(172) Antibody-Drug Conjugates (ADCs)
(173) The lyophilized formulations according to any aspect or embodiment of the present invention may comprise an AXL-ADC comprising an anti-AXL antibody according to any embodiment in the previous section, conjugated to a therapeutic moiety, such as a cytotoxic agent, a chemotherapeutic drug, a cytokine, an immunosuppressant, antibiotic, or a radioisotope.
(174) In one embodiment, when conjugated to the drug in question, the anti-AXL antibody can have a pI in the range of about 5 to about 12, such as about 7 to about 10, such as about 8.5 to about 9.5, such as about 8.5 to about 9.0.
(175) In some instances it may be desired to use anti-AXL antibodies which undergo internalization for AXL-ADCs. The term internalized or internalization as used herein, refers to a biological process in which molecules such as the antibody according to the present invention, are engulfed by the cell membrane and drawn into the interior of the cell. It may also be referred to as endocytosis.
(176) ADCs are often designed such that the cytotoxic payload is inactive when conjugated to the antibody. Once internalized, the ADC may be delivered to lysosomes in most cases, where effective drug release takes advantage of the catabolic environment found with these organelles. The cytotoxic payload may then be released intracellularly upon internalization of the ADC after binding to the plasma-membrane of cells, or alternatively in response to proteolytic activity in the tumor microenvironment. So, one option is to conjugate the anti-AXL antibody to the therapeutic moiety via a linker which is designed to be cleaved intracellularly.
(177) Specialized linkers have been designed to be cleaved only in a specific microenvironment found in or on the target tumor cell or in the tumor microenvironment. Examples include linkers that are cleaved by acidic conditions, reducing conditions, or specific proteases.
(178) The stability of the antibody-linker-drug in circulation is important because this allows antibody-mediated delivery of the drug to specific target cells. In addition, the long circulating half-life of the ADC provides exposure for several days to weeks post injection. Drugs that are conjugated through non-cleavable linkers and protease-cleavable linkers are generally more stable in circulation than disulfide and hydrazone linkers, although the stability of the latter two linkers can be tuned by altering the neighboring chemical structure.
(179) In one embodiment, the therapeutic moiety is a cytotoxic agent.
(180) A cytotoxin or cytotoxic agent includes any agent that is detrimental to (e.g., kills) cells. Suitable cytotoxic agents for forming ADCs for use in the present invention include taxol, tubulysins, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, maytansine or an analog or derivative thereof, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin; calicheamicin or analogs or derivatives thereof; antimetabolites (such as methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, fludarabin, 5-fluorouracil, decarbazine, hydroxyurea, asparaginase, gemcitabine, cladribine), alkylating agents (such as mechlorethamine, thioepa, chlorambucil, melphalan, carmustine (BSNU), lomustine (CCNU), cyclophosphamide, busulfan, dibromomannitol, streptozotocin, dacarbazine (DTIC), procarbazine, mitomycin C, cisplatin and other platinum derivatives, such as carboplatin; as well as duocarmycin A, duocarmycin SA, CC-1065 (a.k.a. rachelmycin), or analogs or derivatives of CC-1065), dolastatin, auristatin, pyrrolo[2,1-c][1,4] benzodiazepins (PDBs), indolinobenzodiazepine (IGNs) or analogues thereof, antibiotics (such as dactinomycin (formerly actinomycin), bleomycin, daunorubicin (formerly daunomycin), doxorubicin, idarubicin, mithramycin, mitomycin, mitoxantrone, plicamycin, anthramycin (AMC)), anti-mitotic agents (e.g., tubulin-targeting agents), such as diphtheria toxin and related molecules (such as diphtheria A chain and active fragments thereof and hybrid molecules); ricin toxin (such as ricin A or a deglycosylated ricin A chain toxin), cholera toxin, a Shiga-like toxin (SLT-I, SLT-II, SLT-IIV), LT toxin, C3 toxin, Shiga toxin, pertussis toxin, tetanus toxin, soybean Bowman-Birk protease inhibitor, Pseudomonas exotoxin, alorin, saporin, modeccin, gelanin, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolacca americana proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, and enomycin toxins. Other suitable conjugated molecules include antimicrobial/lytic peptides such as CLIP, Magainin 2, mellitin, Cecropin, and P18; ribonuclease (RNase), DNase I, Staphylococcal enterotoxin-A, pokeweed antiviral protein, diphtherin toxin, and Pseudomonas endotoxin. See, for example, Pastan et al., Cell 47, 641 (1986) and Goldenberg, Calif. A Cancer Journal for Clinicians 44, 43 (1994). Therapeutic agents that may be administered in combination with anti-AXL antibodies or antibody-drug conjugates of the present invention as described elsewhere herein, such as, e.g., anti-cancer cytokines or chemokines, are also candidates for therapeutic moieties useful for conjugation to an antibody disclosed in the present invention.
(181) In one embodiment, the cytotoxic agent is linked to said antibody, or fragment thereof, with a cleavable linker, such as N-succinimydyl 4-(2-pyridyldithio)-pentanoate (SSP), maleimidocaproyl-valine-citrulline-p-aminobenzyloxycarbonyl (mc-vc-PAB) or AV-1 K-lock valine-citrulline.
(182) The term cleavable linker as used herein, refers to a subset of linkers that are catalyzed by specific proteases in the targeted cell or in the tumor microenvironment, resulting in release of the cytotoxic agent. Examples of cleavable linkers are linkers based on chemical motifs including disulfides, hydrazones or peptides. Another subset of cleavable linker, adds an extra linker motif between the cytotoxic agent and the primary linker, i.e. the site that attaches the linker-drug combination to the antibody. In some embodiments, the extra linker motif is cleavable by a cleavable agent that is present in the intracellular environment (e. g.
(183) within a lysosome or endosome or caveola). The linker can be, e. g. a peptidyl linker that is cleaved by an intracellular peptidase or protease enzyme, including but not limited to, a lysosomal or endosomal protease. In some embodiments, the peptidyl linker is at least two amino acids long or at least three amino acids long. Cleaving agents can include cathepsins B and D and plasmin, all of which are known to hydrolyze dipeptide drug derivatives resulting in the release of active drug inside the target cells (see e. g. Dubowchik and Walker, 1999, Pharm. Therapeutics 83:67-123). In a specific embodiment, the peptidyl linker cleavable by an intracellular protease is a Val-Cit (valine-citrulline) linker or a Phe-Lys (phenylalanine-lysine) linker (see e.g. U.S. Pat. No. 6,214,345, which describes the synthesis of doxorubicin with the Val-Cit linker). An advantage of using intracellular proteolytic release of the therapeutic agent is that the agent is typically attenuated when conjugated and the serum stabilities of the conjugates are typically high.
(184) In another embodiment, the cytotoxic agent is linked to said antibody, or fragment thereof, with a non-cleavable linker, such as succinimidyl-4 (N-maleimidomethyl)cyclohexane-1-carboxylate (MCC) or maleimidocaproyl (MC).
(185) The term non-cleavable linker as used herein, refers to a subset of linkers which, in contrast to cleavable linkers, do not comprise motifs that are specifically and predictably recognized by intracellular or extracellular proteases. Thus, ADCs based on non-cleavable linkers are not released or cleaved form the antibody until the complete antibody-linker-drug complex is degraded in the lysosomal compartment. Examples of a non-cleavable linker are thioethers. In yet another embodiment, the linker unit is not cleavable and the drug is released by antibody degradation (see US 2005/0238649). Typically, such a linker is not substantially sensitive to the extracellular environment. As used herein, not substantially sensitive to the extracellular environment in the context of a linker means that no more than 20%, typically no more than about 15%, more typically no more than about 10%, and even more typically no more than about 5%, no more than about 3%, or no more than about 1% of the linkers, in a sample of antibody drug conjugate compound, are cleaved when the antibody drug conjugate compound is present in an extracellular environment (e.g. plasma). Whether a linker is not substantially sensitive to the extracellular environment can be determined for example by incubating with plasma the antibody drug conjugate compound for a predetermined time period (e.g. 2, 4, 8, 16 or 24 hours) and then quantitating the amount of free drug present in the plasma.
(186) In one embodiment, cytotoxic agent is selected from the group: DNA-targeting agents, e.g. DNA alkylators and cross-linkers, such as calicheamicin, duocarmycin, rachelmycin (CC-1065), pyrrolo[2,1-c][1,4] benzodiazepines (PBDs), and indolinobenzodiazepine (IGN); microtubule-targeting agents, auristatin, such as monomethylauristatin E (MMAE) and monomethylauristatin F (MMAF), dolastatin, maytansine, N (2)-deacetyl-N(2)-(3-mercapto-1-oxopropyl)-maytansine (DM1), and tubulysin; and nucleoside analogs; or an analogs, derivatives, or prodrugs thereof.
(187) In one embodiment, the immunoconjugate comprise a combination of; i) the cytotoxic agent and said cleavable linker having bystander kill capacity; ii) the cytotoxic agent and said cleavable linker not having bystander kill capacity; iii) the cytotoxic agent and said non-cleavable linker having bystander kill capacity; or iv) the cytotoxic agent and said non-cleavable linker not having bystander kill capacity.
(188) The term bystander killing effect, bystander kill, bystander kill capacity or bystander cytotoxicity as used herein, refers to the effect where the cytotoxic agent that is conjugated to the antibody by either a cleavable or non-cleavable linker has the capacity to diffuse across cell membranes after the release from the antibody and thereby cause killing of neighboring cells. When the cytotoxic agent is conjugated by a cleavable or non-cleavable linker, it may be either the cytotoxic agent only or the cytotoxic agent with a part of the linker that has the bystander kill capacity. The capacity to diffuse across cell membranes is related to the hydrophobicity of the the cytotoxic agent or the combination of the cytotoxic agent and the linker. Such cytotoxic agents may advantageously be membrane-permeable toxins, such as MMAE that has been released from the antibody by proteases. Especially in tumors with heterogeneous target expression and in solid tumors where antibody penetration may be limited, a bystander killing effect may be desirable.
(189) The term no bystander kill capacity, no bystander killing effect, no-bystander kill or no bystander cytotoxicity as used herein, refers to the effect where the cytotoxic agent that is conjugated to the antibody by either a cleavable or non-cleavable linker does not have the capacity to diffuse across cell membranes after release from the antibody. Thus, such cytotoxic agents or combinations of the cytotoxic agent with the linker, will not be able to kill neighboring cells upon release from the antibody. It is believed without being bound by theory, that such combinations of a cytotoxic agent and either a cleavable or non-cleavable linker will only kill cells expressing the target that the antibody binds.
(190) A stable link between the antibody and cytotoxic agent is an important factor of an ADC. Both cleavable and non-cleavable types of linkers have been proven to be safe in preclinical and clinical trials.
(191) In one embodiment, the cytotoxic agent is chosen from the group of microtubule targeting agents, such as auristatins and maytansinoids.
(192) The term microtubule-targeting agent as used herein, refers to an agent or drug which inhibits mitosis (cell division). Microtubules are structures that are essential for proper separation of DNA during cell division, and microtubule function critically depends on dynamic instability, i.e. the process in which microtubule structures are continuously elongated and shortened. Microtubule-targeting agents disrupt or stabilize microtubules, which prevents formation of the mitotic spindle, resulting in mitotic arrest and apoptosis. The microtubule-targeting agents can be derived from e.g. natural substances such as plant alkaloids, and prevent cells from undergoing mitosis by disrupting or stabilizing microtubule polymerization, thus preventing formation of the mitotic spindle and subsequent cell division, resulting in inhibition of cancerous growth. Examples of microtubule-targeting agents are paclitaxel, docetaxel, vinblastine, vincristine, vinorelbine, auristatins, maytansanoids, tubulysins, and dolastatin.
(193) In one embodiment, the cytotoxic agent is auristatins or auristatin peptide analogs and derivates [45][46]. Auristatins have been shown to interfere with microtubule dynamics, GTP
(194) hydrolysis and nuclear and cellular division and have anti-cancer and anti-fungal activity. The auristatin drug moiety may be attached to the antibody via a linker, through the N (amino) terminus or the C (terminus) of the peptidic drug moiety.
(195) Exemplary auristatin embodiments include the N-terminus-linked monomethyl auristatin drug moieties DE and DF [48].
(196) In a particular embodiment, the cytotoxic agent is monomethyl auristatin E (MMAE);
(197) ##STR00001##
wherein the antibody is linked to MMAE at the nitrogen (N) on the left-hand side of the chemical structure above by the appropriate linker.
(198) In one embodiment, the cytotoxic agent monomethyl auristatin E (MMAE) is linked to the antibody via a valine-citrulline (VC) linker.
(199) In another embodiment, the cytotoxic agent monomethyl auristatin E (MMAE) is linked to the antibody via a valine-citrulline (VC) linker and the maleimidocaproyl (MC) linker, wherein the combination of the cytotoxic agent and the linkers has the chemical structure;
(200) ##STR00002##
wherein MAb is the antibody.
(201) In one embodiment, the cytotoxic agent is monomethyl auristatin F (MMAF);
(202) ##STR00003##
wherein the antibody is linked to MMAF at the nitrogen (N) on the left-hand side of the chemical structure above by the appropriate linker.
(203) In one embodiment, the cytotoxic agent monomethyl auristatin F (MMAF) is linked to the antibody via a maleimidocaproyl (mc)-linker, wherein the combination of the cytotoxic agent and linker has the chemical structure;
(204) ##STR00004##
wherein MAb is the antibody.
(205) In another particular embodiment, the cytotoxic agent is a DNA-targeting agent.
(206) The term DNA-acting agent as used herein, refers to a specific class of cytotoxic agents which are able to alkylate and/or cross-link DNA. An example of such a DNA-acting agent is IGN agents comprising indolino-benzodiazepinedimers and pyrrolo[2,1-c][1,4] benzodiazepines (PBDs) which are highly potent by virtue of their ability to alkylate and cross-link DNA. Another example is IGN agents comprising indolino-benzodiazepinemonomers which are highly potent by virtue of the ability to alkylate only DNA. Duocarmycins are another class of DNA-acting agents. Duocarmycins are small-molecule, synthetic DNA minor groove binding alkylating agents. These compounds are suitable to target solid tumors as well as hematological tumors.
(207) In one embodiment, the immunoconjugate comprises two to four cytotoxic molecules per antibody. Depending on the chemical properties of the toxin and the linker-toxin combination, two to four cytotoxic molecules per antibody may be superior to more heavily loaded conjugates that are cleared more rapidly from the circulation than less loaded conjugates. The cytotoxic agent loading is represented by p and is the average number of cytotoxic agent moieties per antibody in a molecule (also designated as the drug to antibody ratio, DAR). The cytotoxic agent loading may range from 1 to 20 drug moieties per antibody and may occur on amino acids with useful functional groups such as, but not limited to, amino or sulfhydryl groups, as in lysine or cysteine.
(208) In one embodiment, the number of cytotoxic agents per antibody is from 1 to 8, such as 2 to 7, such as 2 to 6, such as 2 to 5, such as 2 to 4, and such as 2 to 3.
(209) In another embodiment, the immunoconjugate comprises four to eight cytotoxic molecules per antibody. In another embodiment, the immunoconjugate comprises six to ten cytotoxic molecules per antibody. In yet another embodiment, the immunoconjugate comprises 10 to 30, such as 15 to 25, such as 20, cytotoxic molecules per antibody.
(210) Depending on the way of conjugation, the number of cytotoxic molecules per antibody may be limited by the number of attachment sites on the antibody, for example where the attachment is a cysteine thiol or a lysine. Generally, antibodies do not contain many free and reactive cysteine thiol groups which may be linked to a drug moiety as most cysteine thiol residues in antibodies exist as disulfide bridges. Therefore, in those embodiments, where the cytotoxic agent is conjugated via a cysteine thiol, the antibody may be reduced with reducing agent such as dithiothreitol (DTT) or tricarbonylethylphosphine (TCEP), under partial or fully reducing conditions, to generate reactive cysteine thiol groups. In certain embodiments, the drug loading for an ADC of the invention ranges from 1 to about 8, as a maximum of 8 free cysteine thiol groups becomes available after (partial) reduction of the antibody (there are 8 cysteines involved in inter-chain disulfide bonding).
(211) In one embodiment, the drug linker moiety is vcMMAE. The vcMMAE drug linker moiety and
(212) conjugation methods are disclosed in [49], [50], [51], and (which are incorporated herein by reference). vcMMAE is formed by conjugation of the linker mc-vc-PAB and the cytotoxic moiety MMAE, and the vcMMAE drug linker moiety is bound to the anti-AXL antibodies at the cysteine residues using a method similar to those disclosed therein.
(213) In one embodiment, the drug linker moiety is mcMMAF. The mcMMAF drug linker moiety and
(214) conjugation methods are disclosed in [54], [55], and (which are incorporated herein by reference), and the mcMMAF drug linker moiety is bound to the anti-AXL antibodies at the cysteine residues using a method similar to those disclosed therein.
(215) Other linker technologies may be used in the anti-AXL antibody drug conjugates of the invention, such as linkers comprising a hydroxyl group.
(216) In one embodiment, the linker is attached to free cysteine residues of the anti-AXL antibody obtained by (partial) reduction of the anti-AXL antibody.
(217) The VH, VL and CDR sequences of specific anti-AXL antibodies suitable for AXL-ADCs of the lyophilized formulations of the invention are shown in Table 1. In a particular embodiment, the linker is mc-vc-PAB and the cytotoxic agent is MMAE; or the linker SSP and the cytotoxic agent is DM1. In another particular embodiment, the linker is MMC and the cytotoxic agent is DM1; or the linker is MC and the cytotoxic agent is MMAF. The antibody designated 107, optionally in an IgG1, K format (also called IgG1-HuMax-AXL) is particularly preferred.
(218) In one embodiment, the ADC comprises the linker mc-vc-PAB, the cytotoxic agent MMAE and an anti-AXL antibody according to any aspect or embodiment of the preceding section, such as antibody 107.
(219) Formulations
(220) Therapeutic formulations for the anti-AXL antibodies and ADCs in accordance with the present invention are prepared for storage by formulating an antibody or ADC having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of aqueous or lyophilized formulations. Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed.
(221) Generally, the lyophilized and reconstituted formulations of AXL-ADCs comprise an AXL-ADC, a buffering agent, a stabilizing agent (typically a non-reducing sugar), and a bulking agent. Preferred stabilizing agents are sucrose, trehalose and combinations thereof. Preferred bulking agents are mannitol, glycine and combinations thereof.
(222) Generally, the aqueous formulations of anti-AXL antibodies comprise an anti-AXL antibody, a buffering agent, and a stabilizing agent. Preferred stabilizing agents are mannitol, sucrose and trehalose.
(223) The term buffer as used herein denotes a pharmaceutically acceptable buffer. Generally, the buffer has a pka and buffering capacity suitable for the pH range of about 5 to about 7, preferably of about 5.5 to 6.5, such as about pH 6 or about pH 6.0. For lyophilized formulations, the buffer components should not crystallize at sub-ambient temperatures at the concentration used. Buffers having a higher collapse temperature are preferred, since it will enable a faster and more robust lyophilization cycle. Suitable pharmaceutically acceptable buffers include, but are not limited to, histidine-buffers, citrate-buffers, succinate-buffers, carbonic acid-buffers, MES buffers, phosphate buffers, TRIS? (tris (hydroxymethyl) aminomethane) buffers and mixtures thereof. Preferred buffers are based on L-histidine, citrate, phosphate, carbonic acid, and/or succinate e, such as histidine and/or citrate, and include also mixtures, e.g., of L-histidine with L-histidine hydrochloride or with TRIS? (tris (hydroxymethyl) aminomethane). Potentially, pH adjustment with an acid or a base known in the art may be needed. The above-mentioned L-histidine, citrate, phosphate, carbonic acid, and/or succinate buffers are generally used in an amount of about 1 mM to about 120 mM, such as from about 5 mM to about 100 mM, preferably of about 10 mM to about 50 mM, more preferably of about 20 mM to about 40 mM, and still more preferably of about 30 mM. Independently from the buffer used, the pH can be adjusted at a value in the range of about 5 to about 7 and preferably about 5.5 to about 6.5 and most preferably about 6 or about 6.0 by adjustment with an acid or base known in the art or by using adequate mixtures of buffer components or both. Optionally, the pH can be adjusted to within the desired range or to the desired value when also other ingredients, e.g., bulking agents stabilizing agents, or both, are present in the buffer. Preferably, the buffer comprises a histidine and/or citrate buffer at a concentration of about 10 mM to about 50 mM, such as a histidine buffer at a concentration of about 30 mM.
(224) The formulation of the invention can further comprise one or more pharmaceutically acceptable stabilizers as defined hereinabove and ingredients also known in the art as lyoprotectants such as sugars, sugar alcohols, amino sugars, amino acids and dextrans as known in the art. Typically, pharmaceutically acceptable stabilizer can be used in an amount of about 1 mM to about 500 mM. Suitable sugars comprise but are not limited to monosaccharides and disaccharides. Non-limiting examples of sugars and sugar alcohols for use according to the invention include trehalose, sucrose, mannitol, sorbitol, mannose, maltose, galactose, fructose, sorbose, raffinose, glucosamine, N-methylglucosamine (also referred to as meglumine), galactosamine and neuraminic acid and combinations thereof. Preferred are non-reducing sugars and sugar alcohols, such as sucrose or trehalose, at concentrations of about 15 mM to about 200 mM, such as about 30 mm to 150 mM or about 15 to about 120 mM, such as about 20 mM to about 100 mM, such as about 30 mM to about 90 mM or about 80 mM to about 100 mM, such as about 70 mM to about 90 mM, such as about 84 mM to 92 mM. Most preferred is sucrose.
(225) In one embodiment, the formulation comprises one or more non-reducing sugars, such as sucrose, trehalose or a combination thereof, at a total concentration of about 5% (w/v) or less, such as from about 0.5% (w/v) to about 4% (w/v), such as from about 1% (w/v) to about 3% (v/w), such as about 2.5% to about 3.5% (w/v), such as about 3% (w/v).
(226) In one embodiment the formulation comprises 84 mM to 92 mM sucrose, such as 85 mM, 86 mM, 87 mM, 88 mM, 89 mM, 90 mM, 91 mM or 92 mM sucrose. Most preferred the formulation comprises 88 mM sucrose.
(227) Particularly, sugar alcohols such as mannitol may also be used as bulking agent to produce a homogeneous and stable lyophilization cake, which can be reconstituted within an acceptable time, more specifically within 0-600 seconds. In general, a bulking agent is used when the total amount of API is too small to provide adequate structure to the cake. Bulking agents should provide an inert matrix which gives a pharmaceutically elegant cake. The bulking agent also modifies the thermal characteristics of a formulation. The concentration of the active drug is often so low that the freeze-drying characteristics of the system are due solely to the bulking agent. Common bulking agents are including mannitol, glycine as crystalline bulking agents; sucrose, trehalose, gelatin, dextran as amorphous bulking agents. Preferred bulking agents are mannitol and glycine, and combinations thereof.
(228) In one embodiment, the formulation comprises one or more bulking agents, such as mannitol, glycine or a combination thereof, at a total concentration of about 10% or less, such as about 7% or less, such as about 5% (w/v) or less, such as from about 1% (w/v) to about 5% (w/v), such as about 2% (w/v) to about 4% (w/v), such as from about 2.5 (w/v) to about 3.5% (w/v), such as about 3%.
(229) In one embodiment, particularly for AXL-ADCs, the formulation comprises a bulking agent such as mannitol at a concentration of about 50 mM to about 300 mM, such as from about 100 mM to about 225 mM, such as from about 150 mM to about 180 mM, such as about 165 mM.
(230) In one embodiment, particularly for AXL-ADCs, the formulation comprises from about 100 mM to about 225 mM mannitol, such as 160 mM, or 162 mM, or 165 mM, or 170 mM, or 180 mM, or 200 mM mannitol. Most preferred it comprises about 165 mM mannitol, or 165 mM mannitol.
(231) In one embodiment, particularly for anti-AXL antibodies, the formulation comprises from about 20 mM to about 400 mM, such as from about 30 mM to about 300 mM, such as from about 40 mM to about 80 mM, such as about 50 mM to about 60 mM, such as about 55 mM mannitol.
(232) Certain lyophilized formulations according to the invention are designed so that it is possible to exclude surfactants. However, as a person skilled in the art can appreciate, while not necessary for preserving stability of the anti-AXL antibody or ADCs, for some purposes it may nonetheless be desirable to include a surfactant. Suitable pharmaceutically acceptable surfactants comprise but are not limited to polyethylen-sorbitan-fatty acid esters, polyethylene-polypropylene glycols, polyoxyethylene-stearates and sodium dodecyl sulphates. Polyethylen-sorbitan-fatty acid esters include polyethylen (20)-sorbitan-esters (synonym to polysorbate 20, sold under the trademark? Tween 20? and polyoxyethylene (20) sorbitanmonooleate (synonym to polysorbate 80 sold under the trademark Tween 80 ?). Polyethylene-polypropylene glycols are those sold under the names Pluronic (R) F68 or Poloxamer 188 ?. Polyoxyethylene-stearates are sold under the trademark Myrj?. Polyoxyethylene monolauryl ether are those sold under the trademark Brij?. When desirable, polyethylen-sorbitan-polyethylen (20)-sorbitan-esters (Tween 20 ?) and polyoxyethylene (20) sorbitanmonooleate (Tween 80 ?) can be used, e.g., in an amount of about 0.01% to about 0.06%, such as about 0.02% to about 0.04%.
(233) Certain lyophilized formulations according to the invention are designed so that it is possible to exclude inorganic salts such as sodium chloride (NaCl), often used as isotonicity agent, from the pre-lyophilization liquid and lyophilized formulation. Other examples of salts include salts of any combinations of the cations sodium potassium, calcium or magnesium with anions chloride, phosphate, citrate, succinate, sulphate or mixtures thereof. However, as a person of skill in the art can appreciate, for some purposes it may nonetheless be desirable to include an inorganic salts, e.g., for reconstitution of the lyophilized formulation, i.e., as a diluent as described below.
(234) The formulation of the invention can further comprise one or more of the following ingredients: antioxidants, ascorbic acid, glutathione, preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); cyclodextrin, e.g. hydroxypropyl--cyclodextrin, sulfobutylethyl--cyclodextrin, [beta]-cyclodextrin, polyethyleneglycol, e.g. PEG 3000, 3350, 4000, or 6000; low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; chelating agents such as EDTA; salt-forming counter-ions such as sodium;
(235) and metal complexes (e.g. Zn-protein complexes).
(236) Process
(237) Freeze drying generally contains three main steps: freezing, primary drying, and secondary drying. The first stage is for the product to be frozen at a temperature lower than eutectic or glass transition temperature of the product. Rate of freezing affects size of water crystals and subsequent rate of drying. The second stage is primary drying, which removes the solvent (ice) water. It is important that product temperature remains below the collapse temperature and all ice/water is sublimed. The third stage is secondary drying which removes bound water or water from solute, during which the shelf temperature often is raised higher than 40? C. to accelerate desorption process. Lyophilization methods suitable for antibody- and other protein or protein conjugate formulations are well-known by a person the skilled in the art and are described in, e.g. Lyophilization of Biopharmaceuticals by Henry R. Costantino and Michael J. Pikal; Freeze Drying/Lyophilization of Pharmaceuticals and Biological Products by Louis Rey and Joan C. May. A non-limiting example of a lyophilization process is described in Example 10.
(238) Use
(239) In another aspect the invention provides an AXL-ADC formulation as defined in any of aspects or embodiments herein for use in the treatment of cancer. Exemplary cancers include, but are not limited to, colorectal cancer, such as colorectal carcinoma and colorectal adenocarcinoma, bladder cancer, bone cancer such as chondrosarcoma, breast cancer such as triple-negative breast cancer, cancers of the central nervous system such as glioblastoma, astrocytoma, neuroblastoma, cervical cancer, connective tissue cancer, endometrium cancer, fibroblast cancer, gastric cancer such as gastric carcinoma, head and neck cancer, kidney cancer, liver cancer such as hepatocellular carcinoma, lung cancer such as NSCLC and lung squamous cell carcinoma, muscle cancer, neural tissue cancer, ovarian cancer, pancreatic cancer such as pancreatic ductal carcinoma and pancreatic adenocarcinoma, skin cancer such as malignant melanoma and soft tissue sarcoma.
(240) Prior to administration to a subject, a lyophilized formulation of the invention comprising a therapeutically effective amount of ADC is dissolved, i.e., reconstituted, into a pharmaceutically acceptable diluent. Exemplary, non-limiting diluents include sterile pharmaceutical grade water (water for injection, WFI) or saline, bacteriostatic water for injection (BWFI), a pH buffered solution (e.g. phosphate-buffered saline), Ringer's solution and dextrose solution. For example, a lyophilized formulation of the invention can be reconstituted in water, pH buffered solution (e.g. phosphate-buffered saline), Ringer's solution and dextrose solution. For example, a lyophilized formulation of the invention can be reconstituted in sterile water for injection (WFI) to a concentration of about 5 to about 30 mg/ml AXL-ADC, such as about 7 to about 20 mg/mL ADC, such as about 8 to 15 mg/ml ADC, such as about 9 to about 11 mg/mL ADC, such as about 10 mg/mL ADC. The concentrate may optionally be further diluted for, e.g., infusion into a pH buffered solution (e.g. phosphate-buffered saline, Ringer's solution and/or dextrose solution) to a concentration of about 0.05 mg/ml to 30 mg/mL ADC, such as, e.g., 0.12 mg/ml to 2.40 mg/mL ADC.
(241) Typically, the reconstituted formulation of the present invention is suitable for parenteral administration. The phrases parenteral administration and administered parentally as used herein means modes of administration other than enteral and topical administration, usually by injection or infusion, and include epidermal, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, intratendinous, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, intracranial, intrathoracic, epidural and intrasternal injection and infusion. In one embodiment the pharmaceutical composition is administered by intravenous or subcutaneous injection or infusion, e.g., by reconstituting the lyophilized formulation in sterile water or saline and held in IV bags or syringes before administration to a subject.
(242) The invention also provides for a kit comprising the lyophilized formulation of an AXL-ADC according to the invention, typically in a hermetically sealed container such as a vial, an ampoule or sachette, indicating the quantity of the active agent. Where the pharmaceutical is administered by injection, an ampoule of sterile water for injection or saline can be, for example, provided, optionally as part of the kit, so that the ingredients can be mixed prior to administration. Such kits can further include, if desired, one or more of various conventional pharmaceutical kit components, such as, for example, containers with one or more pharmaceutically acceptable carriers, additional containers, etc., as will be readily apparent to those skilled in the art. Printed instructions, either as inserts or as labels, indicating quantities of the components to be administered, guidelines for administration, and/or guidelines for mixing the components, can also be included in the kit.
(243) TABLE-US-00003 TABLE1 AminoacidsequencesofantibodyVHs,VLsandCDRs,aswellasofAXL.TheCDR sequencesareindicatedinbold,underlinedtextinthevariableregionsequences. SEQIDNO: Name Aminoacidsequence Comments SEQIDNO:1 107VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWV HCo12-BalbC RQAPGKGLEWVSTTSGSGASTYYADSVKGRFTISRDNS Ig1domain KNTLYLQMNSLRAEDTAVYYCAKIWIAFDIWGQGTMV bindingAb TVSS SEQIDNO:2 107VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQ KPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLE PEDFAVYYCQQYGSSPYTFGQGTKLEIK SEQIDNO:3 140VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMTWVR QAPGKGLEWVSAISISGASTFYADSVKGRFTISRDNSKN TLSLQMNSLRAEDTAVYFCRGYSGYVYDAFDIWGQGT MVTVSS SEQIDNO:4 140VL DIQMTQSPSSLSASVGDRVTITCRASQGISNWLAWYQ QKPEKAPKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSL QPEDFATYYCQQYNSYPLTFGGGTKVEIK SEQIDNO:5 148VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMTWVR HCo12-BalbC QAPGKGLEWVSAISISGGSTFYADSVKGRFTISRDNSKN Ig2domain TLYLQMNSLRAEDTAVYYCRGYSGYVYDAFDFWGQGT bindingAb MVTVSS SEQIDNO:6 148VL DIQMTQSPSSLSASVGDRVTITCRASQGISNWLAWYQ QKPEKAPKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSL QPEDFATYYCQQYNSYPLTFGGGTKVEIK SEQIDNO:7 154VH EVQLLDSGGGLVQPGGSLRLSCAASGFTFSSYAMSWVR HCo12-BalbC QAPGKGLEWVSAISIGGGNAYYADSVKGRFTISRDNSK FN1domain NTLYLQMNSLRAADTAVYYCAKPGFIMVRGPLDYWG bindingAb QGALVTVSS SEQIDNO:8 154-M103LVH EVQLLDSGGGLVQPGGSLRLSCAASGFTFSSYAMSWVR QAPGKGLEWVSAISIGGGNAYYADSVKGRFTISRDNSK NTLYLQMNSLRAADTAVYYCAKPGFILVRGPLDYWGQ GALVTVSS SEQIDNO:9 154VL EIVLTQSPGTLSLSPGERATLSCRASQSVSNSYLAWYQQ KPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLE PEDFAVYYCQQYGSSPYTFGQGTKLEIK SEQIDNO:10 171VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVR HCo17-BalbC QAPGKGLEWVSDISVSGGSTYYADSVKGRFTISRDNSK Ig2domain NTLYLQMNSLRAEDTAVYYCAKEGYIWFGESLSYAFDI bindingAb WGQGTMVTVSS SEQIDNO:11 171VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQ KPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLE PEDFAVYYCQQYGRSFTFGPGTKVDIK SEQIDNO:12 172VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWV RQAPGKGLEWVSDISVSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKEGYIWFGESLSYAFDI WGQGTMVTVSS SEQIDNO:13 172VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQ KPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLE PEDFAVYYCQQYGRSFTFGPGTKVDIK SEQIDNO:14 181VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVR QAPGKGLEWVSDISVSGGSTYYADSVKGRFTISRDNSK NTLYLHMNSLRAEDTAVYYCAKEGYIWFGESLSYAFDI WGQGTMVTVSS SEQIDNO:15 181VH EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQ KPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLE PEDFAVYYCQQYGRSFTFGPGTKVDIK SEQIDNO:16 183VH QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWI HCo17-BalbC RQPPGKGLEWIGEINQSGSTNYNPSLKSRVTISVDTSKN FN1domain QFSLKLSSVTAADTSVYYCASGNWDHFFDYWGQGTLV bindingAb TVSS SEQIDNO:17 183-N52QVH QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWI RQPPGKGLEWIGEIQQSGSTNYNPSLKSRVTISVDTSKN QFSLKLSSVTAADTSVYYCASGNWDHFFDYWGQGTLV TVSS SEQIDNO:18 183VL DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQ HKPGKAPKLLIYATSSLQSGVTSRFSGSGSGTDFTLTISSL QPEDFATYYCQQAKSFPWTFGQGTKVEIK SEQIDNO:19 187VH QVPLQQWGAGLLKPSETLSLTCAVYGGSFSGYHWSWI RQPPGKGLEWIGEISHSGRTNYNPSLKSRVTISIDTSKNQ FSLKLSSVTAADTAVYYCASFITMIRGTIITHFDYWGQGT LVTVSS SEQIDNO:20 187VL DIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQ KPEKAPKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQ PEDFATYYCQQYHSYPYTFGQGTKLEIK SEQIDNO:21 608-01VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVR QAPGQGLEWMGRIIPIFGIANYVQKFQGRVTITADKST STAYMELSSLRAEDTAVYYCARRGDYYGSGSPDVFDIW GQGTMVTVSS SEQIDNO:22 608-01VL EIVLTQSPGTLSLSPGRATLSCRASQSVSSSYLAWYQQ KPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLE PEDFAVYYCQQYGSSYTFGQGTKLEIK SEQIDNO:23 610-01VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVR QAPGQGLEWMGRIIPIFGIANYVQKFQGRVTITADKST STAYMELSSLRAEDTAVYYCARRGNYYGSGSPDVFDIW GQGTMVTVSS SEQIDNO:24 610-01VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQ KPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLE PEDFAVYYCQQYGSSYTFGQGTKLEIK SEQIDNO:25 613VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAINWM HCo20 RQAPGQGLEWMGRIIPIFGIVNYAQKFQGRVTLTADKS Ig1domain TSTAYMELSSLRSEDTAVYYCARRGNYYGSGSPDVFDI bindingAb WGQGTMVTVSS SEQIDNO:26 613VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQ KPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLE PEDFAVYYCQQYGSSYTFGQGTKLEIK SEQIDNO:27 613-08VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAINWM RQAPGQGLEWMGRIIPIFGIVNYAQKFQGRVTLTADKS TSTAYMELSSLRSEDTAVYYCARRGNYYGSGSPDVFDI WGQGTMVTVSS SEQIDNO:28 613-08VL EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQK PGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEP EDFAVYYCQQRSNWLTFGGGTKVEIK SEQIDNO:29 620-06VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVR QAPGQGLEWMGRIIPIFGIANYAQKFQGRVTITADKST STAYMELSSLRSEDTAVYYCARRGNYYGSGSPDVFDIW GQGTMVTVSS SEQIDNO:30 620-06VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQ KPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLE PEDFAVYYCQQYGSSYTFGQGTKLEIK SEQIDNO:31 726VH QVQLQQWGAGLLKPSETLSLTCAIDGGSFSGYYWSWIR HCo17-BalbC QPPGKGLEWIGEISHSGRTNYNPSLKSRVTISIDTSKNQF FN2domain SLKLSSVAAADTAVYYCARFITMIRGAIITHFDYWGQGA bindingAb LVTVSS SEQIDNO:32 726-M101L QVQLQQWGAGLLKPSETLSLTCAIDGGSFSGYYWSWIR VH QPPGKGLEWIGEISHSGRTNYNPSLKSRVTISIDTSKNQF SLKLSSVAAADTAVYYCARFITLIRGAIITHFDYWGQGAL VTVSS SEQIDNO:33 726VL DIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQ KPEKAPKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQ PEDFATYYCQQYHSYPYTFGQGTKLEIK SEQIDNO:34 733VH QVQLVESGGGVVQPGRSLRLSCAASGFSFSTYAMHWV HCo17-BalbC RQAPGKGLEWVAVISYDGDNKYSADSVKGRFTISRDNS FN1domain KNTLYLQMNSLRAEDTAVYYCARGRKLGIDAFDIWGQ bindingAb GTMVTVSS SEQIDNO:35 733VL AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQK PGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISGLQP EDFATYYCQQFNSYPFTFGPGTKVDIK SEQIDNO:36 107VHCDR1 GFTFSSYA SEQIDNO:37 107VHCDR2 TSGSGAST SEQIDNO:38 107VHCDR3 AKIWIAFDI SEQIDNO:39 107VLCDR1 QSVSSSY 107VLCDR2 GAS SEQIDNO:40 107VLCDR3 QQYGSSPYT SEQIDNO:41 140VHCDR1 GFTFSSYA SEQIDNO:42 140VHCDR2 ISISGAST SEQIDNO:43 140VHCDR3 RGYSGYVYDAFDI SEQIDNO:44 140VLCDR1 QGISNW 140VLCDR2 AAS SEQIDNO:45 140VLCDR3 QQYNSYPLT SEQIDNO:46 148VHCDR1 GFTFSSYA SEQIDNO:47 148VHCDR2 ISISGGST SEQIDNO:48 148VHCDR3 RGYSGYVYDAFDF SEQIDNO:49 148VLCDR1 QGISNW 148VLCDR2 AAS SEQIDNO:50 148VLCDR3 QQYNSYPLT SEQIDNO:51 154VHCDR1 GFTFSSYA SEQIDNO:52 154VHCDR2 ISIGGGNA SEQIDNO:53 154VHCDR3 AKPGFIMVRGPLDY SEQIDNO:54 154-M103LVH AKPGFILVRGPLDY CDR3 SEQIDNO:55 154VLCDR1 QSVSNSY 154VLCDR2 GAS SEQIDNO:56 154VLCDR3 QQYGSSPYT SEQIDNO:57 171VHCDR1 GFTFSSYA SEQIDNO:58 171VHCDR2 ISVSGGST SEQIDNO:59 171VHCDR3 AKEGYIWFGESLSYAFDI SEQIDNO:60 171VLCDR1 QSVSSSY 171VLCDR2 GAS SEQIDNO:61 171VLCDR3 QQYGRSFT SEQIDNO:62 172VHCDR1 GFTFSNYA SEQIDNO:63 172VHCDR2 ISVSGGST SEQIDNO:64 172VHCDR3 AKEGYIWFGESLSYAFDI SEQIDNO:65 172VLCDR1 QSVSSSY 172VLCDR2 GAS SEQIDNO:66 172VLCDR3 QQYGRSFT SEQIDNO:67 181VHCDR1 GFTFSSYA SEQIDNO:68 181VHCDR2 ISVSGGST SEQIDNO:69 181VHCDR3 AKEGYIWFGESLSYAFDI SEQIDNO:70 181VLCDR1 QSVSSSY 181VLCDR2 GAS SEQIDNO:71 181VLCDR3 QQYGRSFT SEQIDNO:72 183VHCDR1 GGSFSGYY SEQIDNO:73 183VHCDR2 INQSGST SEQIDNO:74 183-N52QVH IQQSGST CDR2 SEQIDNO:75 183VHCDR3 ASGNWDHFFDY SEQIDNO:76 183VLCDR1 QGISSW 183VLCDR2 ATS SEQIDNO:77 183VLCDR3 QQAKSFPWT SEQIDNO:78 187VHCDR1 GGSFSGYH SEQIDNO:79 187VHCDR2 ISHSGRT SEQIDNO:80 187VHCDR3 ASFITMIRGTIITHFDY SEQIDNO:81 187VLCDR1 QGISSW 187VLCDR2 AAS SEQIDNO:82 187VLCDR3 QQYHSYPYT SEQIDNO:83 608-01VHCDR1 GGTFSSYA SEQIDNO:84 608-01VHCDR2 IIPIFGIA SEQIDNO:85 608-01VHCDR3 ARRGDYYGSGSPDVFDI SEQIDNO:86 608-01VLCDR1 QSVSSSY 608-01VLCDR2 GAS SEQIDNO:87 608-01VLCDR3 QQYGSSYT SEQIDNO:88 610-01VHCDR1 GGTFSSYA SEQIDNO:89 610-01VHCDR2 IIPIFGIA SEQIDNO:90 610-01VHCDR3 ARRGNYYGSGSPDVFDI SEQIDNO:91 610-01VLCDR1 QSVSSSY 610-01VLCDR2 GAS SEQIDNO:92 610-01VLCDR3 QQYGSSYT SEQIDNO:93 613VHCDR1 GGTFSSYA SEQIDNO:94 613VHCDR2 IIPIFGIV SEQIDNO:95 613VHCDR3 ARRGNYYGSGSPDVFDI SEQIDNO:96 613VLCDR1 QSVSSSY 613VLCDR2 GAS SEQIDNO:97 613VLCDR3 QQYGSSYT SEQIDNO:98 613-08VHCDR1 GGTFSSYA SEQIDNO:99 613-08VHCDR2 IIPIFGIV SEQIDNO:100 613-08VHCDR3 ARRGNYYGSGSPDVFDI SEQIDNO:101 613-08VLCDR1 QSVSSY 613-08VLCDR2 DAS SEQIDNO:102 613-08VLCDR3 QQRSNWLT SEQIDNO:103 620-06VHCDR1 GGTFSSYA SEQIDNO:104 620-06VHCDR2 IIPIFGIA SEQIDNO:105 620-06VHCDR3 ARRGNYYGSGSPDVFDI SEQIDNO:106 620-06VLCDR1 QSVSSSY 620-06VLCDR2 GAS SEQIDNO:107 620-06VLCDR3 QQYGSSYT SEQIDNO:108 726VHCDR1 GGSFSGYY SEQIDNO:109 726VHCDR2 ISHSGRT SEQIDNO:110 726VHCDR3 ARFITMIRGAIITHFDY SEQIDNO:111 726-M101LVH ARFITLIRGAIITHFDY CDR3 SEQIDNO:112 726VLCDR1 QGISSW 726VLCDR2 AAS SEQIDNO:113 726VLCDR3 QQYHSYPYT SEQIDNO:114 733VHCDR1 GFSFSTYA SEQIDNO:115 733VHCDR2 ISYDGDNK SEQIDNO:116 733VHCDR3 ARGRKLGIDAFDI SEQIDNO:117 733VLCDR1 QGISSA 733VLCDR2 DAS SEQIDNO:118 733VLCDR3 QQFNSYPFT SEQIDNO:119 Ig2domainVH ISISGXST-whereinXisAorG CDR2 SEQIDNO:120 Ig2domainVH RGYSGYVYDAFDX-whereinXisIorF CDR3 SEQIDNO:121 FN2domainVH GGSFSGYX-whereinXisHorY CDR1 SEQIDNO:122 FN2domainVH AX1FITMIRGX2IITHFDY-whereinX1isSorR; CDR3 andX2isTorA SEQIDNO:123 FN1domainVH GFTFSXYA-whereinXisSorN CDR1 SEQIDNO:124 FN1domainVH ISVSGGST CDR2 SEQIDNO:125 FN1domainVH AKEGYIWFGESLSYAFDI CDR3 SEQIDNO:126 Ig1domainVH IIPIFGIX-whereinXisAorV CDR2 SEQIDNO:127 Ig1domainVH ARRGXYYGSGSPDVFDI-whereinXisDorN CDR3 SEQIDNO:128 Ig1domainVL QSVXSSY-whereinXisSordel CDR1 Ig1domainVL XAS-whereinXisDorG CDR2 SEQIDNO:129 Ig1domainVL QQX1X2X3X4X5T-whereinX1isRorY;X2is CDR3 SorG;X3isNorS;X4isWorS;andX5 isLorY SEQIDNO:130 HumanAXL MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEES protein PFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRD (Swissprot GQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSD P30530) TGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDRTV AANTPFNLSCQAQGPPEPVDLLWLQDAVPLATAPGHG PQRSLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQ QPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLS DDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLHPHT PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISA TRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEV LMDIGLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGP WSLPVPLEAWRPGQAQPVHQLVKEPSTPAFSWPWWY VLLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVERG ELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVD RHKVALGKTLGEGEFGAVMEGQLNQDDSILKVAVKTM KIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGS ERESFPAPVVILPFMKHGDLHSFLLYSRLGDQPVYLPTQ MLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENM SVCVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLAD RVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDY LRQGNRLKQPADCLDGLYALMSRCWELNPQDRPSFTE LREDLENTLKALPPAQEPDEILYVNMDEGGGYPEPPGA AGGADPPTQPDPKDSCSCLTAAEVHPAGRYVLCPSTTP SPAQPADRGSPAAPGQEDGA SEQIDNO:131 Musmusculus MAWRCPRMGRVPLAWCLALCGWACMYPYDVPDYAA AXL HKDTQTEAGSPFVGNPGNITGARGLTGTLRCELQVQGE PPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVV SQLRISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEG LPYFLEEPEDKAVPANTPFNLSCQAQGPPEPVTLLWLQ DAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGV TTSRTATITVLPQRPHHLHVVSRQPTELEVAWTPGLSGI YPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQVSVP PHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTE GVPLGPPENVSAMRNGSQVLVRWQEPRVPLQGTLLGY RLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVSV TAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPP RAFSWPWWYVLLGAVVAAACVLILALFLVHRRKKETRY GEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEEL KEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQD DSILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNV MRLIGVCFQGSERESFPAPVVILPFMKHGDLHSFLLYSRL GDQPVYLPTQMLVKFMADIASGMEYLSTKRFIHRDLAA RNCMLNENMSVCVADFGLSKKIYNGDYYRQGRIAKMP VKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPY PGVENSEIYDYLRQGNRLKQPADCLDGLYALMSRCWEL NPQDRPSFTELREDLENTLKALPPAQEPDEILYVNMDEG GGYPEPPGAAGGADPPTQPDPKDSCSCLTAAEVHPAG RYVLCPSTTPSPAQPADRGSPAAPGQEDGA SEQIDNO:132 Homosapiens- MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEES AXLMus PFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRD musculusIg1 GQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSD domain TGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDKAV PANTPFNLSCQAQGPPEPVTLLWLQDAVPLAPVTGHSS QHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQQ PRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLSD DGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLHPHTP YHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISAT RNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVL MDIGLRQEVTLELOGDGSVSNLTVCVAAYTAAGDGPW SLPVPLEAWRPGQAQPVHQLVKEPSTPAFSWPWWYV LLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVERGE LVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVDR HKVALGKTLGEGEFGAVMEGQLNQDDS ILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMR LIGVCFQGSERESFPAPVVILPFMKHGDLHSFLLYSRLGD QPVYLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARN CMLNENMSVCVADFGLSKKIYNGDYYRQGRIAKMPVK WIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPG VENSEIYDYLRQGNRLKQPADCLDGLYALMSRCWELNP QDRPSFTELREDLENTLKALPPAQEPDEILYVNMDEGG GYPEPPGAAGGADPPTQPDPKDSCSCLTAAEVHPAGRY VLCPSTTPSPAQPADRGSPAAPGQEDGA SEQIDNO:133 Homosapiens MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEES AXL-Mus PFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRD musculusIg2 GQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSD domain TGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDKAV PANTPFNLSCQAQGPPEPVTLLWLQDAVPLAPVTGHSS QHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQQ PRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLSD DGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLHPHTP YHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISAT RNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVL MDIGLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGPW SLPVPLEAWRPGQAQPVHQLVKEPSTPAFSWPWWYV LLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVERGE LVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVDR HKVALGKTLGEGEFGAVMEGQLNQDDS ILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMR LIGVCFQGSERESFPAPVVILPFMKHGDLHSFLLYSRLGD QPVYLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARN CMLNENMSVCVADFGLSKKIYNGDYYRQGRIAKMPVK WIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPG VENSEIYDYLRQGNRLKQPADCLDGLYALMSRCWELNP QDRPSFTELREDLENTLKALPPAQEPDEILYVNMDEGG GYPEPPGAAGGADPPTQPDPKDSCSCLTAAEVHPAGRY VLCPSTTPSPAQPADRGSPAAPGQEDGA SEQIDNO:134 Homosapiens MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEES AXL- PFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRD Musmusculus GQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSD FN1domain TGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDRTV AANTPFNLSCQAQGPPEPVDLLWLQDAVPLATAPGHG PQRSLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQ RPHHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLS DDGVGIWLGKSDPPEDPLTLQVSVPPHQLRLEKLLPHTP YHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENISAT RNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVL MDIGLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGPW SLPVPLEAWRPGQAQPVHQLVKEPSTPAFSWPWWYV LLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVERGE LVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVDR HKVALGKTLGEGEFGAVMEGQLNQDDS ILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMR LIGVCFQGSERESFPAPVVILPFMKHGDLHSFLLYSRLGD QPVYLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARN CMLNENMSVCVADFGLSKKIYNGDYYRQGRIAKMPVK WIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPG VENSEIYDYLRQGNRLKQPADCLDGLYALMSRCWELNP QDRPSFTELREDLENTLKALPPAQEPDEILYVNMDEGG GYPEPPGAAGGADPPTQPDPKDSCSCLTAAEVHPAGRY VLCPSTTPSPAQPADRGSPAAPGQEDGA SEQIDNO:135 Homosapiens MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEES AXL- PFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRD Musmusculus GQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSD FN2domain TGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDRTV AANTPFNLSCQAQGPPEPVDLLWLQDAVPLATAPGHG PQRSLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQ QPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLS DDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLHPHT PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENVS AMRNGSQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPE VLMDIGLTREVTLELRGDRPVANLTVSVTAYTSAGDGP WSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWPWWY VLLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVERG ELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVD RHKVALGKTLGEGEFGAVMEGQLNQDDSILKVAVKTM KIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGS ERESFPAPVVILPFMKHGDLHSFLLYSRLGDQPVYLPTQ MLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENM SVCVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLAD RVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDY LRQGNRLKQPADCLDGLYALMSRCWELNPQDRPSFTE LREDLENTLKALPPAQEPDEILYVNMDEGGGYPEPPGA AGGADPPTQPDPKDSCSCLTAAEVHPAGRYVLCPSTTP SPAQPADRGSPAAPGQEDGA SEQIDNO:136 511VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWV Ig2domain RQAPGKGLEWVSGISGSGGHTYHADSVKGRFTISRDNS bindingAb KNTLYLQMNSLRAEDTAVYYCAKDRYDILTGYYNLLDY WGQGTLVTVSS SEQIDNO:137 511VHCDR1 GFTFSSYA SEQIDNO:138 511VHCDR2 ISGSGGHT SEQIDNO:139 511VHCDR3 AKDRYDILTGYYNLLDY SEQIDNO:140 511VL DIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQ KPEEAPKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQ PEDFATYYCQQYNSYPLTFGGGAKVEIK SEQIDNO:141 511VLCDR1 QGISSW 511VLCDR2 AAS SEQIDNO:142 511VLCDR3 QQYNSYPLT SEQIDNO:143 061VH QVQLVQSGAEVKKPGASVKVSCKASGYAFTGYGISWVR Ig1domain QAPGQGLEWIGWISAYNGNTNYVQNLQDRVTMTTDT bindingAb STSTAYMELRSLRSDDTAVYYCARDHISMLRGIIIRNYW GQGTLVTVSS SEQIDNO:144 061VL EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKP GQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPE DFAVYYCQQRSSWPRLTFGGGTKVEIK SEQIDNO:145 137VH QVQLVQSGAEVKKPGSSVKVSCKASGGTFSRYAISWVR QAPGQGLEWMGRIIPIVGIANYAQKFQGRVTLTADKST STAYMELSSLRSEDTAVYYCAREAGYSSSWYAEYFQHW GQGTLVTVSS SEQIDNO:146 137VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSNYLAWYQQ KPGQAPRLLIYGASSRATGFPDRFSGSGSGTDFTLTISRL EPEDFAVYYCQQYGSSPYTFGQGTKLEIK SEQIDNO:147 Cynomolgus AWRCPRMGRVPLAWCLALCGWVCMAPRGTQAEESP monkeyAXL FVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDG (GenBank QILELADSTQTQVPLGEDEQDDWIVVSQLRIASLQLSDA number GQYQCLVFLGHQNFVSQPGYVGLEGLPYFLEEPEDRTV HB387229.1) AANTPFNLSCQAQGPPEPVDLLWLQDAVPLATAPGHG PQRNLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQ QPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLS DDGMGIQAGEPDPPEEPLTLQASVPPHQLRLGSLHPHT PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISA TRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEV LMDIGLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGP WSLPVPLEAWRPGQAQPVHQLVKETSAPAFSWPWW YILLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVER GELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMV DRHKVALGKTLGEGEFGAVMEGQLNQDDSILKVAVKT MKIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQG SERESFPAPVVILPFMKHGDLHSFLLYSRLGDQPVYLPTQ MLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENM SVCVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLAD RVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDY LRQGNRLKQPADCLDGLYALMSRCWELNPQDRPSFTE LREDLENTLKALPPAQEPDEILYVNMDEGGGYPEPPGA AGGADPPTQLDPKDSCSCLTSAEVHPAGRYVLCPSTAPS PAQPADRGSPAAPGQEDGA
EXAMPLES
Example 1: Testing of pH, Buffers, Ionic Strength and Excipients Using Chemical Denaturation [HuMax-AXL]
(244) Chemical denaturation by urea was used to screen different formulation components to assess their effect on the thermodynamic stability of anti-AXL human antibody 107, a.k.a. IgG1-AXL-107 or HuMax-AXL. This example shows the effect of pH, buffer type (Histidine, Citrate, and 2-(N-morpholino) ethanesulfonic acid (MES), buffer concentration and various excipients (sugars, amino acids, polyols and surfactant) on the thermodynamic stability of HuMax-AXL.
(245) In this example, the thermodynamic value C.sub.1/2, the concentration of denaturant where the fraction of folded to unfolded protein is equal, is used as the parameter to compare the stabilizing effect of different formulation components. The higher the C.sub.1/2 value the higher the thermodynamic stability.
(246) Multiple buffers used to screen for pH, showed that the C.sub.1/2 values increased significantly with increasing pH, but leveled off around pH 6.5 as shown in Table 2. Screening of three different buffers with pK.sub.a values close to pH 6.5 (Histidine, Citrate and 2-(N-morpholino) ethanesulfonic acid (MES)) showed no marked difference in the C.sub.1/2 values as shown in Table 3. Further analysis of Histidine in the range from 10 to 50 mM, as shown in Table 4, showed that the thermodynamic stability was not dependent on the Histidine concentration. Increasing the ionic strength from 0 to 500 mM NaCl also did not affect the thermodynamic stability of HuMax-AXL as shown in Table 5.
(247) TABLE-US-00004 TABLE 2 C.sub.1/2 values as an effect of different buffers used to screen for pH in chemical denaturation of HuMax-AXL Sample Formulation C? 0.75 mg/mL 10 mM Histidine pH 5.0 4.91 HuMax-AXL 10 mM Histidine pH 5.5 6.16 10 mM Histidine pH 6.0 6.09 10 mM Histidine pH 6.5 6.34 10 mM HEPES pH 7.0 6.39 10 mM HEPES pH 7.5 6.40 10 mM Glycine pH 8.0 6.41
(248) TABLE-US-00005 TABLE 3 C.sub.1/2 values as an effect of a Histidine, Citrate and MES buffer (pKa in 6.5 range) in chemical denaturation of HuMax-AXL. Sample Formulation C? 0.75 mg/mL 10 mM Histidine pH 6.5 6.39 HuMax-AXL 10 mM Citrate pH 6.5 6.35 10 mM MES pH 6.5 6.45
(249) TABLE-US-00006 TABLE 4 C.sub.1/2 values as an effect of Histidine in different concentrations from 10 to 50 mM in chemical denaturation of HuMax-AXL. Sample Formulation C? 0.75 mg/mL 10 mM Histidine pH 6.5 6.30 HuMax-AXL 20 mM Histidine pH 6.5 6.34 30 mM Histidine pH 6.5 6.19 40 mM Histidine pH 6.5 6.25 50 mM Histidine pH 6.5 6.29
(250) TABLE-US-00007 TABLE 5 C.sub.1/2 values as an effect of increasing ionic strength from 2-500 mM NaCl in chemical denaturation of HuMax-AXL Sample Formulation Ionic Strength (mM NaCl) C? 0.75 mg/mL 30 mM Histidine 0 6.47 HuMax-AXL pH 6.5 25 6.43 50 6.30 100 6.37 150 6.39 250 6.42 500 6.52
(251) Screening for different excipients (sugars, amino acids, polyols and surfactant) using a formulation of 30 mM Histidine pH 6.5, showed that the three sugars tested (sucrose, Trehalose, and Mannitol) all had a stabilizing effect, with the higher sugar concentration providing greater thermodynamic stability, and with Mannitol showing higher C.sub.1/2 value than Trehalose and Sucrose, Table 6.
(252) TABLE-US-00008 TABLE 6 C.sub.1/2 values as an effect of using Sucrose, Trehalose, and Mannitol at different concentrations as stabilizers in chemical denaturation of HuMax-AXL Sugar Concentration Sample Formulation Sugar (%) C? 0.75 mg/mL 30 mM Histidine Sucrose 1 6.45 HuMax-AXL pH 6.5 5 6.62 Trehalose 1 6.36 5 6.74 Mannitol 1 7.00 5 7.32
(253) Screening for different amino acids (Arginine, Glycine, and Glutamic acid) indicated that these did not confer additional stability to the formulation. Data was somewhat dissimilar as higher C.sub.1/2 values were obtained for formulations with Glycine and Glutamic acid at higher concentrations, whereas the C.sub.1/2 values decreased for higher concentrations of Arginine. As the pH for the Glycine and Glutamic Acid formulations were unstable, the higher C.sub.1/2 values obtained for these formulations, was probably more a result of the thermodynamic stability conferred by the higher pH of the formulations. Table 7, shows the respective C.sub.1/2 values.
(254) TABLE-US-00009 TABLE 7 C.sub.1/2 values as an effect of using Arginine, Glutamic Acid, and Glycine at different concentrations as stabilizers in chemical denaturation of HuMax-AXL. Amino Acid Sample Formulation Sugar Concentration (mM) C? 0.75 mg/mL 30 mM Histidine Arginine 25 6.21 HuMax- pH 6.5 100 6.12 AXL (unstable pH) 150 5.85 Glycine 25 6.46 100 6.62 Glutamic 25 6.70 Acid 100 6.92
(255) The polyols Sorbitol and Glycerol both showed to have a stabilizing effect on the thermodynamic stability of HuMax-AXL, with the higher concentration providing greater thermodynamic stability, and with Sorbitol showing higher C.sub.1/2 value than Glycerol, Table 8.
(256) TABLE-US-00010 TABLE 8 C.sub.1/2 values as an effect of using the polyols Sorbitol and Glycerol at different concentrations as stabilizers in chemical denaturation of HuMax-AXL. Polyol Sample Formulation Sugar Concentration C? 0.75 mg/mL 30 mM Histidine Sorbitol 100 mM 6.59 HuMax-AXL pH 6.5 200 mM 6.71 Glycerol 1% 6.46 5% 6.64
(257) The data for screening of surfactant (PS-20 and PS-80) were inconclusive because at a lower concentration of surfactant (0.03% w/v), the formulation containing PS-20 had a higher C.sub.1/2 value than the formulation containing PS-80, and at higher concentration of surfactant (0.06% w/v), the formulation containing PS-80 had a higher C.sub.1/2 value than the formulation containing PS-20, Table 9. The data thus do not indicate enhanced protein stability for either surfactant.
(258) TABLE-US-00011 TABLE 9 C.sub.1/2 values as an effect of using the surfactants Polysorbate 80 and Polysorbate 20 at different concentrations as stabilizers in chemical denaturation of HuMax-AXL. Surfactant Concentration Sample Formulation Sugar (%) C? 0.75 mg/mL 30 mM Histidine Polysorbate-80 0.03 6.45 HuMax- pH 6.5 0.06 6.73 AXL Polysorbate-20 0.03 6.63 0.06 6.36
Example 2: Freeze/Thaw Stability of HuMax-AXL Using Surfactant, Cryoprotectant and NaCl
(259) Evaluation of formulations containing either surfactant or cryoprotectant was investigated as protective agents during freeze-thaw stress of Humax-AXL. In addition, the effect of NaCl on the solubility of HuMax-AXL during freezing was investigated.
(260) Three concentrations of Polysorbate 80 (0.0%, 0.03% and 0.06%) and three concentrations of Sucrose (0, 5, or 10% sucrose) in 30 mM Histidine (pH 6.5) were used to investigate their protective effect on the degradation of HuMax-AXL upon three cycles of freeze-thaw. The formulations were subsequently evaluated by Appearance, concentration, turbidity (A550), reducing and non-reducing CE-SDS, and SEC. All formulations were clear and free of visible particles and as shown in Table 10 and Table 11, no changes in protein concentration, turbidity, or purity was observed between unstressed and stressed samples, indicating that neither Polysorbate 80 nor Sucrose enhances the stability of HuMax-AXL upon freeze-thaw.
(261) TABLE-US-00012 TABLE 10 effect of Polysorbate 80 at different concentrations on the stability of HuMax-AXL during freeze-thaw measured by Concentration (A280 nm), turbidity (A550 nm), CE-SDS (reduced and non-reduced), SEC. Purity % Conc. Purity % (CE-SDS, Purity % Sample mg/mL A550 (CE-SDS, Red) Non-red) (SEC) 0 F/T, 22.1 0.02547 96.7 91.6 98.0 0% PS80 0 F/T, 22.7 0.04425 96.7 91.5 98.3 0.03% PS80 0 F/T, 21.1 0.04576 96.7 92.7 98.2 0.06% PS80 3 F/T, 21.9 0.04951 96.6 93.0 98.4 0% PS80 3 F/T, 22.4 0.03540 96.6 92.9 98.6 0.03% PS80 3 F/T, 21.4 0.01299 96.6 93.1 98.6 0.06% PS80
(262) TABLE-US-00013 TABLE 11 effect of Sucrose at different concentration on the stability of HuMax- AXL during freeze-thaw measured by Concentration (A280 nm), turbidity (A550 nm), CE-SD (reduced and non-reduced), SEC. Purity % Purity Conc. Purity % (CE-SDS, % Sample mg/mL A550 (CE-SDS, Red) Non-red) (SEC) 0 F/T, 20.6 ?0.04932 97.6 95.1 98.3 0% sucrose 0 F/T, 22.5 ?0.00205 97.7 94.9 99.1 5% sucrose 0 F/T, 21.2 0.02576 97.4 95.2 98.4 10% sucrose 3 F/T, 20.4 0.03282 97.4 94.9 99.1 0% sucrose 3 F/T, 22.7 0.06612 96.7 94.5 98.2 5% sucrose 3 F/T, 21.2 0.04265 97.5 94.7 98.7 10% sucrose
(263) Also, it was shown that NaCl (0 mM, 25 mM, 50 mM and 100 mM of NaCl) did not enhance the solubility when tested at a 40 mg/mL concentration of HuMax-AXL. Samples were stored at ?5? C. on a pre-cooled lyophilizer shelf and evaluated by visual appearance for phase separation after 24 hrs. No phase separation was observed in any of the samples. Accordingly, no effect of NaCl on the solubility and phase separation of HuMax-AXL during freezing could be seen.
Example 3: Design of Experiment (DoE) [HuMax-AXL]
(264) This example describes a DoE study using a design space for pH, mannitol, and sorbitol concentrations for HuMax-AXL formulations. Histidine buffer concentration was used as a fourth parameter, see table below. Table 12 shows the experimental design space and table 13 shows the outline of the DoE study
(265) TABLE-US-00014 TABLE 12 Excipient Experimental Design Space in the DoE for HuMax-AXL. Sorbitol (mM) Mannitol 0 100 200 0% x x* X 1% x* x* X 5% X x x *Center points
(266) The samples were evaluated initially and after storage at 4 weeks at 40? C. A subset of the formulations were subjected to additional 5 freeze-thaw cycles and additional 2 weeks of storage at 40? C. (6 week time point). Samples were tested using product specific analysis, i.e. size-exclusion chromatography (SEC), capillary isoelectric focusing (cIEF) and capillary electrophoresis-sodium dodecyl sulfate (CE-SDS) (red and non-red). Selected results are shown and discussed below.
(267) TABLE-US-00015 TABLE 13 HuMax-AXL DoE study Formulation HuMax-AXL Sorbitol Mannitol Designation Conc. Buffer pH (mM) (%) F1 20 mg/mL 30 mM 6.5 200 0 F2 Histidine 100 0 F3 100 1 F4 0 1 F5 0 5 F6 100 5 F7 200 1 F8 7.0 200 0 F9 100 0 F10 100 1 F11 0 1 F12 0 5 F13 100 5 F14 200 1 F15 6.0 200 0 F16 100 0 F17 100 1 F18 0 1 F19 0 5 F20 100 5 F21 200 1 F22 20 mM 6.5 200 0 F23 Histidine 100 0 F24 100 1 F25 0 1 F26 0 5 F27 100 5 F28 200 1 F29 40 mM 200 0 F30 Histidine 100 0 F31 100 1 F32 0 1 F33 0 5 F34 100 5 F35 200 1
(268) The HuMax-AXL samples incubated at 40? C. for 4 weeks and 6 weeks were evaluated by SEC to determine the effect of various formulations on the extent of aggregation (high molecular weight species (HMW)) and degradation (low molecular weight species (LMW)). At the initial time point, no HMW) species were detected by SEC in any of the sample preparations and only low amounts of LMW species were detected. At the 4 week and 6 week time point, an increase in both the percentage of HMW and LHW species were detected. The formulations a pH 7.0 appeared to result in larger percentages of HMW species than the other formulations at the 4 week time point,
(269) The HuMax-AXL samples incubated at 40? C. for 4 weeks and 6 weeks were evaluated by cIEF to determine the effect of various formulations on the charge profile, i.e. presence of acidic and basic isoforms. The initial time point did not suggest any significant trends in percent main and acidic isoforms on the basis of differences in Histidine concentration, pH, Mannitol concentration, or Sorbitol concentration. Over the time course of the stability study, there was a significant decrease in main isoform, which trended inversely to the change in percent acidic peak, and hence can be attributed primarily to deamidation of the main peak isoform. The formulations at pH 7.0 appeared to result in larger percentages of acidic and basic isoforms than the other formulations at the 4 week time point, as well as lower percentage of the main peak isoform, with the remaining formulations being very similar. As shown in
(270) The HuMax-AXL samples incubated at 40? C. for 4 weeks and 6 weeks were evaluated by CE-SDS (red and non-red) to determine the effect of various formulations on the purity of HuMax-AXL. At the initial time point, the variation in the purity was within method variability, with no significant difference in purity for the formulations tested. At the 4 week time point an increase in impurities were observed for all formulations both in the reduced and non-reduced SDS, with that of the pH 7.0 formulations having the highest percentage of impurities. Only pH 6.0 and pH 6.5 was tested at the 6 week time point, with no appearance of new impurities (bands) from the 4 week time point. All the pH 6.0 formulations showed a lower percentage of impurities, although this could be within the expected method variability.
Example 4: Effect of Polysorbate-Freeze/Thaw and Agitation [HuMax-AXL-ADC]
(271) A study was designed to test the effect of Polysorbate 80 (PS-80) on interfacial stress of an antibody-drug conjugate of HuMax-AXL; IgG1-AXL-107-vcMMAE, herein referred to as HuMax-AXL-ADC, in solution by means of freeze-thaw and agitation. 10 mg/ml HuMax-AXL-ADC in 30 mM Histidine, 200 mM Sorbitol (pH 6.0) was formulated with three Polysorbate concentrations, i.e. 0, 0.02 and 0.1%. The samples with and without PS-80 were either exposed to agitation for 30 and 60 minutes or exposed to 3 and 5 freeze/thaw cycles after which the samples were evaluated by A280 (concentration), SEC (aggregation), and by cIEF (change in isoforms). As can be seen in Table 14,
(272) TABLE-US-00016 TABLE 14 Concentration data (A280nm) for HuMax-AXL-ADC samples containing Polysorbate and exposed to agitation and freeze-thaw cycles. Concentration mg/mL (A280) Polysorbate Agitation Freeze-thaw conc. (%) T0 30 min 60 min 3x 5x 0 9.39 9.37 9.39 9.26 9.43 9.36 9.39 9.39 9.44 9.44 0.02 9.42 9.31 9.44 9.27 9.39 9.39 9.39 9.48 9.35 9.48 0.10 9.27 9.30 9.16 8.88 9.47 9.32 9.34 9.36 8.64 9.61
(273) TABLE-US-00017 TABLE 15 SEC data (% Main Peak) for HuMax-AXL-ADC samples containing Polysorbate and exposed to agitation and freeze-thaw cycles. SEC Percentage (%) Main Peak Polysorbate Agitation Freeze-thaw conc. (%) T0 30 min 60 min 3x 5x 0 99.6 99.7 99.6 99.7 99.6 0.02 99.7 99.6 99.5 99.5 99.4 0.10 99.5 99.5 99.5 99.5 99.5
Example 5: Effect of Buffer Type, Concentration, and pH-DoE [HuMax-AXL-ADC]
(274) This example describes a DoE (Design of Experiment) study for HuMax-AXL-ADC using a design space for pH, buffer type, and buffer concentrations using fifteen formulations, see Table 16 below. The samples were evaluated initially and after storage for 2 weeks at 25? C. and 40? C. Samples were tested using product specific analysis, i.e. A280, SEC, cIEF. Selected results are discussed below.
(275) TABLE-US-00018 TABLE 16 HuMax-AXL-ADC study Buffer Formulation HuMax-AXL-ADC Concentration Designation Conc. Buffer Type (mM) pH 1 10 mg/mL Histidine 50 7 2 Histidine 10 5 3 Phosphate 10 7 4 Citrate 10 6 5 Citrate 10 5 6 Citrate 50 5 7 Phosphate 50 6 8 Phosphate 10 6 9 Phosphate 50 7 10 Citrate 50 6 11 Histidine 10 7 12 Histidine 50 5 13 Histidine 30 6 14 Citrate 30 6 15 Phosphate 30 6
(276) The HuMax-AXL-ADC samples incubated at 25? C. and 40? C. were evaluated by SEC to determine the effect of various formulations on the extent of aggregation (HMW species) and degradation (LMW species). A decrease in the average percent main peak was observed for samples stored at 25? C. and 40? C., the effect increasing with time and temperature,
(277) The HuMax-AXL-ADC samples incubated at 25? C. and 40? C. were evaluated by cIEF to determine the effect of various formulations on the formation of charge isomers, i.e. acidic and basic. cIEF data suggest that the stability of HuMax-AXL-ADC is mostly affected by pH of the solution. The average percent main peak decreased and the average percent acidic peak increased, after storage at 40? C. for 2 weeks as the pH of the solution increased. Furthermore, the ANOVA analysis suggested that the means of the average main peaks were equal with respect to buffer type. However, visual observations of the graphs suggested that the average percent main peak decreased in formulations prepared with the phosphate buffer. This was found to correlate well with statistical analyses of the data for the average percent acidic peak. Thus it appears that the stability of HuMax-AXL-ADC is affected by the type of buffer with the formulations prepared using a phosphate buffer exhibiting greater increases in the acidic peak. Although cIEF data suggested that pH and buffer type impacted the stability of HuMax-AXL-ADC, the data did not indicate that the buffer concentration had any effect on the stability.
Example 6: Lyophilization Cycle Study
(278) This example describes a screening study to examine the effect of an amorphous (trehalose/sucrose) and a crystallizing (mannitol) sugar on the stability of the lyophilized formulation of HuMax-AXL-ADC at different pH. Four formulations contained 10 mg/ml HuMax-AXL-ADC, 30 mM Histidine, and 5% Mannitol and remaining four formulations were used as center points for the statistical design and contained 10 mg/ml HuMax-AXL-ADC, 30 mM Histidine, 3% Sucrose or Trehalose, with 3% Mannitol prepared at pH 5.5 and 6.5. Samples were lyophilized using a conservative cycle and samples were stored at 25? C. and 40? C. for 2 months and evaluated by A280, SEC, cIEF, and Dynamic Light Scattering DLS. Outline of the study is shown in Table 17. Selected results are discussed below.
(279) TABLE-US-00019 TABLE 17 Lyophilization cycle study design Formu- lation HuMax- Desig- AXL-ADC Sugar Concen- Manni- nation Conc. Buffer Type tration (%) tol (%) pH 1 10 mg/mL 30 mM Trehalose 1 5 5.0 2 histidine Sucrose 5 5 5.0 3 Sucrose 1 5 6.0 4 Trehalose 5 5 6.0 5 Sucrose 3 3 5.5 6 Trehalose 3 3 5.5 7 Sucrose 3 3 6.5 8 Trehalose 3 3 6.5
(280) The HuMax-AXL-ADC samples incubated at 25? C. and 40? C. were evaluated by SEC to determine the effect of various formulations on the extent of aggregation (HMW species) and degradation (LMW species). The average percent main peak showed no changes in the pre- and post-lyophilization at TO. A slight increase in average percent HMW species was observed after storage at 25? C. for 2 months, with no presence of LMW species. An increase in average percent HMW species was observed after storage at 40? C. for 2 months, with presence of LMW species in some of the formulations.
(281) Statistical analysis,
(282) The HuMax-AXL-ADC samples incubated at 25? C. and 40? C. were evaluated by cIEF to determine the effect of various formulations on the formation of charge isomers, i.e. acidic and basic. cIEF data suggested that no statistical significance was observed for any of the variables when the data was compared,
(283) In conclusion the data suggested that the sugar concentration and pH of the solution were most important for stability of the formulation. Overall the data suggested that similar results were obtained using Sucrose or Trehalose at a concentration of less than 5%, with a pH between pH 5.5 and 6.5.
Example 7: Determination of Primary Drying Conditions for the Lyophilization Process of HuMax-AXL-ADC
(284) The lyophilization cycle for a HuMax-AXL-ADC preparation (10 mg/ml HuMax-AXL-ADC, 30 mM histidine, 88 mM sucrose, 165 mM mannitol, pH 6.0) was determined based on thermal characterization of the frozen solution and of the dried solid and by identification of the failure point during primary drying. The failure point was defined as the product temperature during primary drying that lead to changes in the visual appearance of the dried solid. Thermal characterization studies were conducted using modulated differential scanning calorimetry (DSC) and freeze-dry microscopy (FDM). Freeze-dry microscopy experiments were conducted by cooling a sample of the formulation to ?40? C. and then annealing at ?15? C. for 30 minutes to crystallize the mannitol in the formulation. The sample was cooled back to ?40? C. and a vacuum of 100 mTorr was initiated. An acceptable dried layer was established and then the product temperature was increased by increments of 2? C. until complete failure of the sample was observed. Complete failure was observed when the product temperature reached-16? C. This corresponded well with in-process lyophilization cycle data from an experiment used to identify the failure point. The lyophilization cycle developed for the formulation was designed to ensure the product temperature of all vials remains approximately 4? C. colder than the temperature identified as the point of failure. This ensures that the product temperature for vials located along the edges of the shelves remains well below the critical product temperature.
(285) Samples of the dried solids were examined using modulated differential scanning calorimetry to determine if mannitol completely crystallized when using a 3 hour annealing step at ?15? C. during the thermal treatment step of the lyophilization cycle. The data support that mannitol is completely crystalline in the dried solid by demonstrating no evidence of exothermal events during warming of the sample and thus is a suitable as a crystalline bulking agent in the HuMax-AXL-ADC formulation.
Example 8: Effect of Residual Moisture on the Stability of HuMax-AXL-ADC
(286) This example describes the effect of residual moisture in lyophilized HuMax-AXL-ADC (prepared from an aqueous solution comprising 10 mg/mL HuMax-AXL-ADC, 30 mM histidine, 88 mM sucrose, 165 mM mannitol, pH 6.0). Samples with a defined residual moisture level of app. 2.28%, 0.84% and 0.44% were removed during secondary drying of lyophilization and subsequently stored at 40? C./75% RH for up to 2 months and evaluated by Appearance, A280, SEC, cIEF, and DLS. Selected results are discussed below.
(287) No changes were observed in the appearance of any of the samples over the 2 month time frame of the study. However, an increase in the level of residual moisture was measured in the samples as expected, Table 18. This was also confirmed by DSC, measuring the midpoint Tg (glass transition temperature) value of the solids which decreased over time, i.e. the moisture acts as a plasticizer lowering the Tg. The Tg values ranged from approximately 78? C. for the low moisture sample to approximately 60? C. for the high moisture sample at the beginning of the study, but decreased to approximately 60? C. for the low moisture sample to approximately 45? C. for the medium and high moisture samples,
(288) TABLE-US-00020 TABLE 18 Residual Moisture values of HuMax-AXL-ADC lyophilized samples after 1 and 2 months of storage at 40? C./75% RH. Actual Actual Actual Residual Residual Residual Theoretical moisture moisture moisture Residual moisture (%) (%) (%) Sample (%) T0 1 month 2 month 20 0.44 0.29 0.97 n/a 21 (low moisture) 0.48 1.23 22 0.35 1.04 27 0.44 0.41 n/a 1.30 26 (low moisture) 0.36 1.22 23 0.40 1.29 10 0.84 0.83 1.98 n/a 13 (medium moisture) 1.10 1.93 14 0.75 1.84 18 0.84 0.88 n/a 2.12 17 (medium moisture) 0.86 2.11 16 0.98 2.20 1 2.28 2.58 3.66 n/a 4 (high moisture) 2.22 3.40 5 2.26 3.44 9 2.28 2.48 n/a 3.80 8 (high moisture) 2.44 3.59 7 2.31 3.71
(289) Analysis of the samples with SEC and cIEF showed that at a moisture level below 3% the characteristics of the product, as the percentage of main peak (Table 19) measured by SEC and percentage of main isoform (
(290) TABLE-US-00021 TABLE 19 SEC data (% Main Peak) for High, Medium, and Low Moisture samples after 2 months at 40? C. SEC Percentage (%) Main Peak Sample T0 1 month 2 month Pre-Lyo 99.6 n/a High Moisture 99.6 99.1 98.9 Medium Moisture 99.4 99.1 99.0 Low Moisture 99.3 99.1 99.0
Example 9: Demonstration Batch
(291) Lyophilized HuMax-AXL-ADC from a demonstration batch using the final lyophilization cycle, was evaluated on long-term stability at 5?3? C. The composition of Humax-AXL-ADC after reconstitution was 10 mg/ml, 30 mM histidine, 88 mM sucrose, 165 mM mannitol, pH 6.0. The long term stability samples were analyzed at TO, T1, T3, T6, T12, T18, and T24 months, and analyzed by product specific assays (SEC, cIEF, CE-SDS, etc.) as well as by freeze-drying based test (Residual Moisture, Reconstitution Time, and Appearance).
(292) After at least 1 month of storage at 5?3? C. all samples remained stable, i.e. the samples showed no significant change by any of the test methods, Table 20. These data supports the formulation for HuMax-AXL-ADC being acceptable for pharmaceutical use.
(293) TABLE-US-00022 TABLE 20 HuMax-AXL-ADC demonstration batch Time points (months) at 5 ? 3? C. Assay 0 1 3 6 12 Appearance Acceptable Acceptable Acceptable Acceptable Acceptable Reconstitution Time ?30 sec ?30 sec ?30 sec ?30 sec ?30 sec Concentration (A280) 10.04 10.02 10.50 9.88 10.40 Residual Moisture 0.87 NA 1.2 0.9 0.9 Sub-visible 10 ?M 45 NA 156 82 39 Particles 25 ?M 5 12 4 1 pH 5.98 5.98 5.92 5.87 5.99 SEC % Main 98.0 97.9 98.0 98.0 98.3 SEC % HMW 1.4 1.4 1.3 1.4 1.1 SEC % LMW 0.6 0.6 0.7 0.6 0.6 CE-SDS, red (%) 99.1 99.2 99.1 99.1 99.1 CE-SDS, non-red LC 23.25 23.24 23.22 22.72 22.41 HC 12.77 12.84 12.57 12.49 12.42 HL 25.24 25.17 25.33 25.47 25.82 HH 20.44 20.46 20.40 20.58 20.78 HHL 15.88 15.89 16.09 16.23 15.97 Whole 2.41 2.41 2.38 2.51 2.45 cIEF 68.59 68.35 68.6 68.3 64.9 DAR-HIC 4.0 3.9 3.8 3.9 3.9 n.d. = not determined
Example 10: Lyophilization Cycle
(294) The lyophilization cycle for the lyophilized formulation of HuMax-AXL-ADC of the invention may be performed as described below with the following steps specified below: freezing, annealing, primary drying and secondary drying.
(295) In the freezing step the vials may be cooled at 0.5? C./min to 1? C./min to ?40? C. or less and held isothermally for at least 120 min. At the annealing step the temperature is raised to between-20? C. and ?15? C. at a rate of 0.5? C./min to 1? C./min and held isothermally for at least 180 min. Primary drying is initiated with a decrease in pressure between 50-200 mTorr, at a temperature between ?15? C. to 0? C. At the secondary drying, the temperature is increased between 30? C. and 40? C. at a rate of 0.5? C./min and held isothermally for the least 8 hours. The residual moisture should not be more than 2% by weight.
Example 11: Generation of Anti-AXL Antibodies
(296) The generation and testing of anti-AXL antibodies is described in detail in International Application Number PCT/EP2015/065900, which is hereby incorporated by reference in its entirety. Briefly:
(297) Various full-length and chimeric constructs of human and other mammalian AXL were prepared and used for immunizing transgenic mice (Medarex, San Jos?, CA, USA). The following codon-optimized constructs for expression of various full-length AXL variants were generated: human (Homo sapiens) AXL (Genbank accession no. NP_068713.2), human-cynomolgus monkey chimeric AXL in which the human extracellular domain (ECD) was replaced with the ECD of cynomolgus monkey (Macaca fascicularis) AXL (translation of Genbank accession HB387229.1; aa 1-447), human-mouse chimeric AXL in which the human ECD was replaced with the ECD of mouse (Mus musculus) AXL (Genbank accession NP_033491.2; aa 1-441), human-mouse chimeric AXL in which the human Ig-like domain I (aa 1-134, also termed Ig1 domain herein) was replaced with the Ig-like domain I of mouse AXL, human-mouse chimeric AXL in which the human Ig-like domain II (aa 148-194, also termed Ig2 domain herein) was replaced by the Ig-like domain II of mouse AXL, human-mouse chimeric ALX in which the human FNIII-like domain I (aa 227-329, also termed FN1 domain herein) was replaced with the FNIII-like domain I of mouse AXL, human-mouse chimeric AXL in which the human FNIII-like domain II (aa 340-444, also termed FN2 domain herein) was replaced by the FNIII-like domain II of mouse AXL. In addition, the following codon-optimized constructs for various AXL ECD variants were generated: the extracellular domain (ECD) of human AXL (aa 1-447) with a C-terminal His tag (AXLECDHis), the FNIII-like domain II of human AXL (aa 327-447) with a N-terminal signal peptide and a C-terminal His tag (AXL-FN2ECDHis), and the Ig1- and Ig2-like domains of human AXL (aa 1-227) with a C-terminal His tag (AXL-Ig12ECDHis).
(298) The HuMab mouse with sufficient antigen-specific titer development was sacrificed and the spleen and lymph nodes flanking the abdominal aorta and vena cava were collected. Fusion of splenocytes and lymph node cells to a mouse myeloma cell line (SP2.0 cells) was done by electrofusion using a CytoPulse CEEF 50 Electrofusion System (Cellectis, Paris, France), essentially according to the manufacturer's instructions.
(299) The primary wells were sub-cloned using the ClonePix system (Genetix, Hampshire, UK). The presence of anti-AXL antibodies in sera of immunized mice or HuMab (human monoclonal antibody) hybridoma or transfectoma culture supernatant was determined by homogeneous antigen specific screening assays using Fluorometric Micro volume Assay Technology (FMAT; Applied Biosystems, Foster City, CA, USA).
(300) Total RNA was prepared from 0.2 to 5?10.sup.6 hybridoma cells and 5-RACE-Complementary DNA (DNA) was prepared from 100 ng total RNA, using the SMART RACE cDNA Amplification kit (Clontech), according to the manufacturer's instructions. VH and VL coding regions were amplified by PCR and cloned directly, in frame, in the pG1f and pKappa expression vectors, by ligation independent cloning (Aslanidis, C. and P. J. de Jong, Nucleic Acids Res 1990;18 (20): 6069-74). For each antibody, 12 VL clones and 12 VH clones were sequenced. The resulting sequences are shown in the Table 1. CDR sequences were defined according to IMGT [42].
(301) In some of the Examples, a comparison antibody against AXL was used (IgG1-YW327.6S2) that have been previously described (EP 2 220 131; U3 Pharma [43]; WO 2011/159980; Genentech [44]. The VH and VL sequences for these AXL-specific antibodies were cloned into the pG1f and pKappa expression vectors.
(302) In some of the examples the antibody b12, a gp120 specific antibody was used as a negative control.
(303) Antibodies were expressed as IgG1,?. Plasmid DNA mixtures encoding both heavy and light chains of antibodies were transiently transfected to Freestyle HEK293F cells (Invitrogen, US) using 293fectin (Invitrogen, US) essentially as described by the manufacturer.
Example 12: Expression of Anti-AXL Antibodies in CHO Cells
(304) HuMax AXL 107 is produced in a CHO cell line, CHO K1SV GS-KO, subcloned from the parental, CHO cell line, transfected with a GS vector carrying the variable region genes derived from a human anti AXL mAb producing hybridoma cell line. Standard mammalian cell culture conditions and purification technologies are employed in the manufacture of HuMax AXL.
Example 13-Binding Characteristics of AXL Antibodies
(305) Binding Affinity of AXL Antibodies
(306) The affinities of the panel of 9 anti-AXL antibodies as well as 3 variants of these antibodies with single amino acid mutations in the variable domains (IgG1-AXL-154-M103L, IgG1-AXL-183-N52Q, IgG1-AXL-726-M101L), were determined.
(307) Affinities were determined using Bio-Layer Interferometry on a ForteBio OctetRED384. Anti-human Fc Capture (AHC) biosensors (ForteBio, Portsmouth, UK; cat no. 18-5064) were loaded for 150 s with hIgG (1 ?g/mL) aiming at a loading response of 1 nm. After a baseline (150 s) the association (1000 s) and dissociation (2000 s) of AXLECDHis (as described in Example 1) was determined, using a concentration range of 10 ?g/mL-0.16 ?g/ml (218 nM-3 nM) with 2-fold dilution steps. For calculations, the theoretical molecular mass of AXLECDHis based on the amino acid sequence was used, i.e. 46 kDa. Experiments were carried out on an OctetRED384, while shaking at 1000 rpm and at 30? C. Each antibody was tested in three independent experiments.
(308) Data was analyzed with ForteBio Data Analysis Software v7.0.3.1, using the 1:1 model and a global full fit with 1000 s association time and 1000 s dissociation time unless stated otherwise. A dissociation time of 1000 s (instead of the 2000 s dissociation time that was acquired) was used since this resulted in better fits. For antibody IgG1-AXL-154 and IgG1-AXL-154-M103L a dissociation time of 500 s was used. For IgG1-AXL-012 and IgG1-AXL-094 dissociation times of 200 s were used. Data traces were corrected by subtraction of a reference curve (antibody without AXLECDHis), the Y-axis was aligned to the last 5 s of the baseline, and interstep correction as well as Savitzky-Golay filtering was applied.
(309) The affinities (K.sub.D) of the anti-AXL antibodies ranged from 0.3*10.sup.?9M to 63*10.sup.?9M (Table 21). For mutant IgG1-AXL-183-N52Q the K.sub.D was lower than for wild-type IgG1-AXL-183, due to an approximately 2.5-fold higher dissociation rate. The observed kinetics of the other two mutants were similar to the kinetics of the wild-type IgGs.
(310) TABLE-US-00023 TABLE 21 Binding of antibodies to AXL Binding affinity (OCTET) KD Kon Kdis Antibody (M) (1/Ms) (1/s) IgG1-AXL-107 16 * 10.sup.?9 2.8 * 10.sup.5 4.1 * 10.sup.?3 IgG1-AXL-148 20 * 10.sup.?9 2.3 * 10.sup.5 4.4 * 10.sup.?3 IgG1-AXL-154 7.2 * 10.sup.?9 2.6 * 10.sup.5 1.9 * 10.sup.?3 IgG1-AXL-154- 7.8 * 10.sup.?9 2.7 * 10.sup.5 2.0 * 10.sup.?3 M103L IgG1-AXL-171 17 * 10.sup.?9 1.1 * 10.sup.5 1.8 * 10.sup.?3 IgG1-AXL-183 10.2 * 10.sup.?9 4.1 * 10.sup.4 4.2 * 10.sup.?4 IgG1-AXL-183- 24 * 10.sup.?9 4.2 * 10.sup.4 1.0 * 10.sup.?3 N52Q IgG1-AXL-613 1.5 * 10.sup.?9 5.4 * 10.sup.5 8.0 * 10.sup.?4 IgG1-AXL-726 0.6 * 10.sup.?9 2.4 * 10.sup.5 1.3 * 10.sup.?4 IgG1-AXL-726- 0.3 * 10.sup.?9 2.1 * 10.sup.5 6.9 * 10.sup.?5 M101L IgG1-AXL-733 63 * 10.sup.?9 1.6 * 10.sup.5 9.7 * 10.sup.?3
Binding of AXL Antibodies to Human, Mouse and Cynomolqus AXL
(311) HEK293T cells were transiently transfected with expression constructs for full length human AXL, human AXL with a cynomolgus monkey extracellular domain (ECD) or human AXL with a mouse ECD. Binding of HuMab-AXL antibodies to these cells was evaluated by flow cytometry. Transfected HEK293 cells were incubated with serial dilutions of AXL-antibodies (final concentration range 0.0024-10 ?g/mL) for 30 minutes at 4? C. After washing three times in PBS/0.1% BSA/0.02% azide, cells were incubated with R-Phycoerythrin (PE)-conjugated goat-anti-human IgG F(ab)2 (Jackson ImmunoResearch Laboratories, Inc., West Grove, PA; cat. No. 109-116-098) diluted 1/100 in PBS/0.1% BSA/0.02% azide (final volume 100 ?L). Next, cells were washed twice in PBS/0.1% BSA/0.02% azide, resuspended in 120 UL PBS/0.1% BSA/0.02% azide and analyzed on a FACS Cantoll (BD Biosciences).
(312) Binding curves were analyzed using non-linear regression (sigmoidal dose-response with variable slope) using GraphPad Prism V5.04 software (GraphPad Software, San Diego, CA, USA).
(313) HuMab-AXL antibodies showed dose-dependent binding to the HEK293 cells expressing human AXL-ECD. Furthermore, HuMab-AXL antibodies recognized AXL with a cynomolgus monkey ECD, with EC.sub.50 values in the same range as for fully human AXL. In contrast, binding of HuMabs to AXL with a mouse ECD was low (IgG1-AXL-107, IgG1-AXL-154, IgG1-AXL-154-M103L, IgG1-AXL-733, IgG1-AXL-183, IgG1-AXL-183-N52Q) or not detectable (IgG1-AXL-171, IgG1-AXL-613, IgG1-AXL-726, IgG1-AXL-726-M101L, IgG1-AXL-148). As expected, the negative control antibody IgG1-b12 showed no binding to cells expressing any of the AXL variants. The Table below shows the EC50 values and standard deviations for binding of the anti-AXL antibodies to human AXL or human AXL with a cynomolgus AXL ECD (determined in at least 3 experiments). EC50 values for binding to human AXL with a mouse AXL ECD could not be determined to very low or absent binding.
(314) TABLE-US-00024 TABLE 22 Binding of anti-AXL antibodies to human AXL or human AXL with a cynomolgus AXL ECD Binding EC50 (?g/mL) human AXL cynomolgus AXL Antibody Average (s.d.) Average (s.d.) IgG1-AXL-107 0.050 (0.004) 0.149 (0.021) IgG1-AXL-154 0.105 (0.003) 0.160 (0.027) IgG1-AXL-154-M103L 0.110 (0.038) 0.161 (0.042) IgG1-AXL-171 0.073 (0.023) 0.157 (0.057) IgG1-AXL-613 0.040 (0.023) 0.146 (0.023) IgG1-AXL-726 0.288 (0.206) 0.349 (0.160) IgG1-AXL-726-M101L 0.184 (0.117) 0.250 (0.066) IgG1-AXL-733 0.176 (0.094) 0.254 (0.114) IgG1-AXL-148 0.094 (0.059) 0.152 (0.080) IgG1-AXL-183 0.526 (0.177) 0.309 (0.086) IgG1-AXL-183-N52Q 0.350 (0.206) 0.324 (0.121)
Competition Between AXL Antibodies and Gas6 for AXL Binding
(315) It was tested whether the AXL ligand Gas6 interfered with binding of the AXL antibodies to AXL. Therefore, AXL-positive A431 cells were incubated for 15 minutes at 4? C. with 10 ?g/mL recombinant human Gas6 (R&D Systems, Abingdon, UK; cat. No. 885-GS). Subsequently, serial dilutions of AXL antibodies were prepared (final concentration range 0.014-10 ?g/mL), added to the cells and incubated for 30 minutes at 4? C. After washing three times in PBS/0.1% BSA/0.02% azide, cells were incubated in 100 ?L with secondary antibody at 4? C. for 30 min in the dark. As a secondary antibody binding the Fc region, R-Phycoerythrin (PE)-conjugated goat-anti-human IgG F(ab)2 (Jackson ImmunoResearch Laboratories, Inc., West Grove, PA; cat. No. 109-116-098) diluted 1/100 in PBS/0.1% BSA/0.02% azide, was used. Next, cells were washed twice in PBS/0.1% BSA/0.02% azide, resuspended in 120 ?L PBS/0.1% BSA/0.02% azide and analyzed on a FACS Cantoll (BD Biosciences).
(316) Alternatively, A431 cells were pre-incubated with 10 ?g/mL AXL antibodies (15 minutes, 4? C.) to assess if the AXL ligand Gas6 could still bind in presence of AXL antibodies. After antibody pre-incubation, serial dilutions of recombinant human Gas6 (R&D Systems, Abingdon, UK; cat. No. 885-GS) were added to the cells at final concentrations of 0.001-20 ?g/mL and incubated for 30 minutes at 4? C. After washing three times in PBS/0.1% BSA/0.02% azide, cells were incubated with mouse anti-Gas6 IgG2a (R&D Systems; cat no. MAB885) at 4? C. for 30 min. After washing three times in PBS/0.1% BSA/0.02% azide, cells were incubated with FITC-labelled goat anti-mouse IgG (Dako, Heverlee, Belgium; cat no. F049702) at 4? C. for 30 min in the dark. Next, cells were washed twice in PBS/0.1% BSA/0.02% azide, resuspended in 120 ?L PBS/0.1% BSA/0.02% azide and analyzed on a FACS Cantoll (BD Biosciences).
(317) Binding curves were analyzed using non-linear regression (sigmoidal dose-response with variable slope) using GraphPad Prism V5.04 software (GraphPad Software, San Diego, CA, USA).
(318) In experiments (n=3) in which A431 cells were pre-incubated with Gas6, the maximal binding values of anti-AXL antibodies was comparable to antibody binding in absence of Gas6 (maximal binding after Gas6 pre-incubation was 90-108% of binding without Gas6 pre-incubation). The EC50 values for AXL antibody binding with or without Gas6 pre-incubation were in the same range, or somewhat enhanced after Gas6 pre-incubation (Table 23).
(319) The binding of control AXL antibody YW327.6S2 to A431 cells was greatly reduced in the presence of Gas6 compared to binding without Gas. Maximal binding of YW327.6S2 in the presence of Gas6 was 19% of binding without Gas6, and the EC50 value for binding to A431 cells was 21-fold higher when cells had been pre-incubated with Gas6.
(320) In experiments in which A431 cells were pre-incubated with anti-AXL antibodies, Gas6 binding was evaluated (n=3). Binding of Gas6 to A431 cells was similar with or without pre-incubation with HuMab-AXL antibodies. Average EC50 concentrations of Gas6 binding when cells were pre-incubated with HuMabs (0.34-0.83 ?g/mL) and maximal Gas6 binding were similar to Gas6 binding in the presence of negative control antibody b12 (EC50 concentration: 0.40 ?g/mL; 95-115% of Gas6 binding in the presence of the b12 control antibody). The binding of Gas6 to A431 cells was greatly reduced in the presence of control AXL antibody YW327.6S2 compared to pre-incubation with b12 (the EC50 concentration was 14-fold higher). Maximal binding of Gas6 in the presence of control antibody YW327.6S2 was 17% of binding in the presence of negative control antibody b12.
(321) TABLE-US-00025 TABLE 23 Competition between AXL antibodies and Gas6 for AXL binding Antibody binding to A431 cells Gas6 binding to A431 cells Maximal Maximal binding binding in in presence of EC50 w/o presence of AXL antibodies Gas6 EC50 in Gas6 (% of EC50 in (% of binding in EC50 presence of binding in presence of AXL prescence of (?g/mL) Gas6 absence of antibodies control mean (?g/mL) Gas6) (?g/mL) antibody) Antibody (s.d.) mean (s.d.) mean (s.d.) mean (s.d.) mean (s.d.) IgG1-AXL- 0.16 (0.17) 0.94 (1.18) 91 (5) 0.78 (0.54) 96 (8) 107 IgG1-AXL- 0.11 (0.13) 0.20 (0.30) 93 (5) 0.73 (0.52) 106 (7) 148 IgG1-AXL- 0.42 (0.55) 0.76 (0.78) 99 (13) 0.44 (0.28) 95 (10) 154 IgG1-AXL- 0.18 (0.21) 0.32 (0.40) 95 (5) 0.69 (0.42) 108 (5) 171 IgG1-AXL- 0.69 (0.72) 1.19 (1.11) 90 (19) 0.34 (0.13) 115 (8) 183 IgG1-AXL- 0.12 (0.11) 0.30 (0.31) 93 (15) 0.74 (0.44) 113 (6) 511 IgG1-AXL- 0.09 (0.09) 0.10 (0.10) 108 (22) 0.57 (0.36) 100 (11) 613 IgG1-AXL- 0.32 (0.35) 0.55 (0.69) 97 (10) 0.77 (0.58) 98 (10) 726 IgG1-AXL- 0.49 (0.51) 0.62 (0.23) 93 (5) 0.83 (0.54) 96 (5) 733 YW327.6S2 0.09 (0.09) 1.90 (1.04)* 41 (24) 5.53 (7.09)* 17 (10) b12 n.a..sup.a n.a. n.a. 0.40 (0.11) 100 .sup.an.a., not applicable *EC50 values less accurate due to low binding.
Example 14-Binding Characteristics of AXL Antibody-Drug Conjugates (AXL-ADCs)
(322) HEK293T cells were transiently transfected with expression constructs for full-length human AXL (see Example 1). Binding of anti-AXL antibodies and AXL-ADCs to these cells was evaluated by flow cytometry. Transiently transfected HEK293 cells were incubated with serial dilutions of anti-AXL antibodies or AXL-ADCs (4-fold dilutions; final concentration range 0.003-10 ?g/mL) for 30 minutes at 4? C. After washing three times in PBS/0.1% BSA/0.02% azide, cells were incubated in 100 ?L with secondary antibody at 4? C. for 30 min in the dark. As a secondary antibody, R-Phycoerythrin (PE)-conjugated goat-anti-human IgG F(ab)2 (Jackson ImmunoResearch Laboratories, Inc., West Grove, PA; cat. No. 109-116-098) diluted 1/100 in PBS/0.1% BSA/0.02% azide, was used. Next, cells were washed twice in PBS/0.1% BSA/0.02% azide, resuspended in 120 ?L PBS/0.1% BSA/0.02% azide and analyzed on a FACS Cantoll (BD Biosciences).
(323) Binding curves were analyzed using non-linear regression (sigmoidal dose-response with variable slope) using GraphPad Prism V5.04 software (GraphPad Software, San Diego, CA, USA). These showed that binding of the anti-AXL antibodies to the HEK293 cells expressing human AXL-ECD was similar to the binding of the AXL-ADCs.
Example 15-Epitope Mapping Studies Anti-AXL Antibody Panel
(324) Determining the AXL Domain Specificity Using Human-Mouse AXL Chimeric Molecules
(325) The AXL domain specificity of the AXL antibodies was determined using a panel of human-mouse chimeric AXL mutants. Five different chimeric AXL molecules were generated, in which either the human Ig-like domain I (Ig1), the Ig-like domain II (Ig2), the human FNIII-like domain I (FN1) or the human FNIII-like domain II domain (FN2) were replaced with their murine homologs. The codon-optimized constructs for expression of the AXL human-mouse chimeras were generated and expressed in HEK293F cells.
(326) Binding of 1 ?g/mL anti-AXL antibody to the human-mouse AXL chimeras was determined by flow cytometry. IgG1-b12 was included as an isotype control IgG1.
(327) All anti-AXL antibodies showed binding to human AXL, whereas binding was abrogated or strongly reduced when the human AXL ECD was replaced with its murine homolog. The human-mouse cross-reactive monoclonal AXL antibody YW327.6S2 was included to confirm expression of hsAXL-mmECD.
(328) Anti-AXL antibody 107 and 613 showed strongly reduced binding to hsAXL-mmIg1, indicating recognition of an epitope in the AXL Ig1 domain. IgG1-AXL-148 and IgG1-AXL-171 showed strongly reduced binding to hsAXL-mmIg2, indicating recognition of an epitope in the AXL Ig2 domain. IgG1-AXL-154, IgG1-AXL-183 and IgG1-AXL-733 showed reduced binding to hsAXL-mmFN1, indicative of a binding epitope in the AXL FN1 domain. Finally, binding of IgG1-AXL-726 was lost in hsAXL-mmFN2, indicating recognition of an epitope within the FN2 domain.
(329) High Resolution Epitope Mapping to Identify Amino Acids in the AXL Extracellular Domain Involved in Binding of AXL Antibodies
(330) To identify amino acids in the AXL extracellular domain involved in binding of anti-AXL antibodies, a library of AXL sequence variants was generated by recombination of AXL sequences derived from species with variable levels of homology with the human AXL sequence in the extracellular domain. Briefly, an expression plasmid encoding human AXL (Hs) was mixed with cloning plasmids encoding Mus musculus (Mm), Monodelphis domestica (Md; opossum) Anolis carolinensis (Ac; lizard) and Tetraodon nigroviridis (Tn; pufferfish) AXL homologs or vice versa. A combination of two primers specific to either the cloning or the expression vector was used to perform a PCR amplifying the AXL extracellular domain (ECD) with abbreviated elongation time, forcing melting and reannealing of nascent DNA replication strands during PCR cycling. Full length ECD was amplified using a nested PCR, again specific to recombination products containing termini originating from both vectors.
(331) Resulting AXL ECD PCR products were cloned into an expression vector creating full length AXL, and resulting plasmids were sequenced, ranked by maximal difference to the template vectors and selected to create a minimal ensemble with maximal differentiation power. Plasmids encoding AXL homologs from Hs, Mm, Md, Ac and Tn, four human/mouse chimeric plasmids encoding Hs AXL with murine Ig1, Ig2, Fn1 or Fn2 domains, and the sixteen most differentiating plasmids from the recombination library were transfected into HEK293-F cells according to the specifications supplied by the manufacturer (Life technologies). FACS binding data using 1 ?g/mL anti-AXL antibodies were deconvoluted by scoring per amino acid if mutation did (+1) or did not (?1) correlate with loss of binding, after which a baseline correction and normalization to a scale of ?5 to +5 was applied, resulting in an impact score per amino acid over the full ECD.
(332) The deconvoluted binding data is summarized in Table 24 as the amino acids involved in binding. Antibodies of which the binding site could not be mapped to high resolution due to a lack of recombination events in the proximity of the binding site, are indicated as not resolved.
(333) TABLE-US-00026 TABLE 24 AXL domain specificity for all anti-AXL antibodies AXL domain AXL aa's involved in Antibody specificity binding IgG1-AXL-107 Ig1 L121-Q129 IgG1-AXL-148 Ig2 D170-R190 IgG1-AXL-154 Fn1 Q272-A287, G297-P301 IgG1-AXL-154- n.d..sup.a n.d. M103L IgG1-AXL-171 Ig2 P170, T182-R190 IgG1-AXL-183 Fn1 Not resolved IgG1-AXL-183- n.d. n.d. N52Q IgG1-AXL-613 Ig1 T112-Q124 IgG1-AXL-726 Fn2 A359, R386, Q436- K439 IgG1-AXL-726- n.d. n.d. M101L IgG1-AXL-733 Fn1 Not resolved IgG1-AXL-061 Ig1 I97-Q124 IgG1-AXL-137 Ig1 Q57, E92-T105 YW327.6S2 Ig1 G39-D59 .sup.an.d., not determined
Example 16-Antibody VH and VL Variants that Allow Binding to AXL
(334) Protein sequences of the VH and VL regions of the anti-AXL antibody panel (described in Example 1) were aligned and compared for AXL binding to identify critical or permissive changes of amino acid residues in the VH or VL regions. Therefore, antibodies with identical VH or VL regions were grouped and compared for binding to human AXL and differences in VL or VH sequences, respectively. Binding to human AXL transiently expressed by HEK-293F cells was assessed in the homogeneous antigen specific screening assay as described in Example 1. Numbering of amino acid positions for the alignments done in the present example was done based on the sequences put forth in Table 1, i.e. the first amino acid in the shown sequence was numbered as position 1, the second as position 2, etc.
(335) First, antibodies with identical VL sequences were grouped. IgG1-AXL-148 and IgG1-AXL-140 were found to have an identical VL sequence, and showed 1 amino acid difference in the HC CDR3 region (F for I at amino acid position 109). Both antibodies bound to human AXL (Table 7), indicating that the amino acid at position 109 is not essential for antibody binding, assuming that a mutation identified in the CDR2 region (G for A at the amino acid position 56) does not compensate for loss of binding.
(336) IgG1-AXL-726 and IgG1-AXL-187 were found to have an identical VL sequence and both antibodies bound to human AXL (Table 25). Two amino acid residue changes in the HC CDR3 region (R for S at position 97 and A for T at position 105) were allowed without losing binding, assuming that mutations identified in the CDR1 (Y for H at position 32) and/or in the framework regions (P3Q, V241, Y25D, T86A and T117A) do not compensate for loss of binding.
(337) IgG1-AXL-171, IgG1-AXL-172 and IgG1-AXL-181 were found to have an identical VL sequence and all antibodies bound to human AXL (Table 7). The CDR3 regions of these three antibodies were identical, but an amino acid residue change in the HC CDR1 (S for N at position 31) or the framework region (H for Q at position 82) was allowed without losing binding.
(338) IgG1-AXL-613, IgG1-AXL-608-01, IgG1-AXL-610-01 and IgG1-AXL-620-06 were found to have an identical VL sequence, and showed one amino acid difference in the HC CDR3 region (N for D at amino acid position 101). All antibodies bound to human AXL (Table 25), indicating that the amino acid at position 101 is not essential, assuming that mutations identified in the HC CDR2 (V for A at position 58) and/or in the framework regions (N35S, M37V, A61V, L701, S88A) do not compensate for loss of binding.
(339) Next, antibodies with identical VH sequences were grouped.
(340) IgG1-AXL-613 and IgG1-AXL-613-08 were found to have an identical VH sequence, and showed five amino acid differences in the CDR3 region of the LC (RSNWL for YGSSY at positions 92 to 96). Both antibodies bound to human AXL (Table 25), indicating that the variation of amino acid at positions 92 to 96 are allowed and do not affect antibody binding, assuming that mutations identified in the CDR1 (deletion of the S at position 30), CDR2 (G51D), and/or in the framework regions (G9A, S54N, R78S, Q100G, L104V) do not compensate for loss of binding.
(341) TABLE-US-00027 TABLE 25 EC50 Maximal binding Antibody (?g/mL) (Arbitrary units) IgG1-AXL-140 0.0026 2889 IgG1-AXL-148 0.0036 3499 IgG1-AXL-171 0.003 2575 IgG1-AXL-172 0.0055 5378 IgG1-AXL-181 0.008 3598 IgG1-AXL-187 0.0065 2563 IgG1-AXL-608-01 0.0035 3318 IgG1-AXL-610-01 0.0023 2947 IgG1-AXL-613 0.0072 5211 IgG1-AXL-613-08 0.0242 2209 IgG1-AXL-620-06 0.0034 4352 IgG1-AXL-726 0.0471 3154
Example 17-In Vitro Cytotoxicity Induced by MMAE-Conjugated AXL Antibodies
(342) Conjugation of MMAE to Anti-AXL Antibodies
(343) Anti-AXL antibodies were purified by Protein A chromatography according to standard procedures and conjugated to vcMMAE. The drug-linker vcMMAE was alkylated to the cysteines of the reduced antibodies according to procedures described in the literature (see [150], [151], and [152]). The reaction was quenched by the addition of an excess of N-acetylcysteine. Any residual unconjugated drug was removed by purification and the final anti-AXL antibody drug conjugates were formulated in PBS. The anti-AXL antibody drug conjugates were subsequently analyzed for concentration (by absorbance at 280 nm), the drug to antibody ratio (DAR) by reverse phase chromatography (RP-HPLC) and hydrophobic interaction chromatography (HIC), the amount of unconjugated drug (by reverse phase chromatography), the percentage aggregation (by size-exclusion chromatography, SEC-HPLC) and the endotoxin levels (by LAL). The results are shown below.
(344) TABLE-US-00028 TABLE 26 Overview of different characteristics of the antibody-drug conjugates. ADC IgG1- IgG1- IgG1- IgG1- IgG1- AXL- IgG1- AXL- IgG1- IgG1- AXL- IgG1- AXL- AXL- 154- AXL- 183- AXL- AXL- 726- AXL- IgG1- Assay 107 148 M103L 171 N52Q 511 613 M101L 733 b12 Concentration 7.18 9.63 6.57 3.69 6.71 5.77 6.17 7.37 7.71 1.58 (mg/mL) DAR by HIC 3.97 3.96 3.71 3.65 3.92 3.87 4.23 4.12 4.08 4.00 % unconjugated 4.68 5.58 6.13 7.11 8.68 8.35 5.13 4.99 3.74 1.89 antibody % aggregate 6.3 2.28 2.9 3.3 5.2 5.1 6.4 4.0 3.5 2.5 by SEC-HPLC Endotoxin 2.3 1.2 2.6 3.1 5.9 4.5 2.0 3.6 7.6 11.5 (EU/mg)
Cell Culture
(345) LCLC-103H cells (human large cell lung cancer) and A431 cells (DMSZ, Braunschweig, Germany) were cultured in RPMI 1640 with L-Glutamine (Cambrex; cat.no. BE12-115F) supplemented with 10% (vol/vol) heat inactivated Cosmic Calf Serum (Perbio; cat.no. SH30087.03), 2 mM L-glutamine (Cambrex; cat.no. US17-905C), 50 IU/mL penicillin, and 50 ?g/mL streptomycin (Cambrex; cat.no. DE17-603E). MDA-MB231 cells were cultured in DMEM with high glucose and HEPES (Lonza #BE12-709F), Donor Bovine Serum with Iron (Life Technologies #10371-029), 2 mM L-glutamine (Lonza #BE17-605E), 1 mM Sodium Pyruvate (Lonza #BE13-115E), and MEM Non-Essential Amino Acids Solution (Life Technologies #11140). The cell lines were maintained at 37? C. in a 5% (vol/vol) CO.sub.2 humidified incubator. LCLC-103H, A431 and MDA-MB231 cells were cultured to near confluency, after which cells were trypsinized, resuspended in culture medium and passed through a cell strainer (BD Falcon, cat.no. 352340) to obtain a single cell suspension. 1?10.sup.3 cells were seeded in each well of a 96-well culture plate, and cells were incubated for 30 min at room temperature and subsequently for 5 hrs at 37? C., 5% CO.sub.2 to allow adherence to the plate.
(346) Cytotoxicity Assay
(347) Serial dilutions (final concentrations ranging from 0.00015 to 10 g/mL) of MMAE-conjugated AXL-antibodies were prepared in culture medium and added to the plates. Incubation of cells with 1 ?M staurosporin (#S6942-200, Sigma) was used as reference for 100% tumor cell kill. Untreated cells were used as reference for 100% cell growth. Plates were incubated for 5 days at 37? C., 5% CO.sub.2. Next, CellTiter-Glo Reagent (Promega; cat.no. G7571) was added to the wells (20 ?L per well) and plates were incubated for 1.5 hours at 37? C., 5% CO.sub.2. Subsequently, 180 ?L per well was transferred to white 96-well Optiplate? plates (PerkinElmer, Waltham, MA; cat.no. 6005299), which were incubated for 30 min at room temperature. Finally, luminescence was measured on an EnVision multiplate reader (Envision, Perkin Elmer).
(348) MMAE-conjugated AXL-antibodies induced 50% cell kill in LCLC-103H cells at concentrations between 0.004 and 0.219 ?g/mL as shown in the Table 27a below.
(349) Similarly, AXL-ADCs efficiently induced cytotoxicity in A431 and MDA-MB231 cells (Table 27b below).
(350) TABLE-US-00029 TABLE 27a Cytotoxicity of MMAE-conjugated-AXL-antibodies in LCLC-103H cells (EC50 values) ADC EC50 (?g/mL) IgG1-AXL-613-vcMMAE 0.004 IgG1-AXL-148-vcMMAE 0.012 IgG1-AXL-171-vcMMAE 0.018 IgG1-AXL-726-M101L-vcMMAE 0.018 IgG1-AXL-107-vcMMAE 0.022 IgG1-AXL-511-vcMMAE 0.032 IgG1-AXL-154-M103L-vcMMAE 0.044 IgG1-AXL-183-N52Q-vcMMAE 0.113 IgG1-AXL-733-vcMMAE 0.219
(351) TABLE-US-00030 TABLE 27B Cytotoxicity of MMAE-conjugated AXL antibodies in A431 and MDA-MB-231 cells (EC50 values) EC50 (?g/mL) A431 MDA-MB231 (n = 3) (n = 2) ADC Mean s.d. Mean s.d. IgG1-AXL-107-vcMMAE 0.154 0.066 0.037 0.005 IgG1-AXL-148-vcMMAE 0.070 0.013 0.012 0.004 IgG1-AXL-154-M103L- 0.719 0.091 0.396 0.195 vcMMAE IgG1-AXL-171-vcMMAE 0.206 0.074 0.035 0.006 IgG1-AXL-183-N52Q-vcMMAE 1.157 0.160 0.139 0.028 IgG1-AXL-511-vcMMAE 0.093 0.020 0.052 0.003 IgG1-AXL-613-vcMMAE 0.109 0.078 0.005 0.001 IgG1-AXL-726-M101L- 0.270 0.157 0.022 0.002 vcMMAE IgG1-AXL-733-vcMMAE 1.253 0.228 0.881 0.182
Example 17-Therapeutic Treatment of LCLC-103H Tumor Xenografts in SCID Mice with MMAE-Conjugated Anti-AXL Antibodies
(352) The in vivo efficacy of MMAE-conjugated anti-AXL antibodies was determined in established subcutaneous (SC) LCLC-103H xenograft tumors in SCID mice. 5?10.sup.6 LCLC-103H (large cell lung carcinoma) tumor cells (obtained from Leibniz-Institut DSMZ-Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (DSMZ)) in 200 ?L PBS were injected subcutaneously in the right flank of female SCID mice. Starting 14-21 days after tumor cell inoculation, when the average tumor size was >100-200 mm.sup.3 and distinct tumor growth was observed, a single injection with 1 mg/kg (20 ?g/mouse) IgG1-AXL-vcMMAE antibodies (as described in Supplementary Example 1) or control (unconjugated IgG1-b12) was given intraperitoneally (100 ?L/mouse). Tumor volume was determined at least two times per week. Tumor volumes (mm.sup.3) were calculated from caliper (PLEXX) measurements as: 0.52?(length)?(width).sup.2.
(353) The panel of anti-AXL-vcMMAE antibodies showed a broad range of anti-tumor activity in established SC LCLC-103H tumors. Clones IgG1-AXL-733-vcMMAE, IgG1-AXL-107-vcMMAE and IgG1-AXL-148-vcMMAE induced tumor regression, clones AXL-171-vcMMAE, IgG1-AXL-511-vcMMAE and IgG1-AXL-613-vcMMAE induced tumor growth inhibition, and clones IgG1-AXL-154-M103L-vcMMAE, IgG1-AXL-183-N52Q-vcMMAE, and IgG1-AXL-726-M101L-vcMMAE showed no or only minor tumor growth inhibition.
(354) Statistical analysis on the last day that all groups were intact (day 30) using One Way ANOVA (Dunnett's multiple comparisons test versus control IgG1-b12) indicated a highly significant difference (p<0.0001) in tumor volume between IgG1-b12 versus IgG1-AXL-733-vcMMAE, IgG1-AXL-107-vcMMAE and IgG1-AXL-148-vcMMAE. Treatment with these clones led in some mice within these groups to complete tumor reduction. Treatment with clones IgG1-AXL-171-vcMMAE, IgG1-AXL-511-vcMMAE and IgG1-AXL-613-vcMMAE also showed significant tumor growth inhibition compared to IgG1-b12, but the differences were less pronounced (p<0.05 to p<0.001). The tumor growth of mice treated with clones IgG1-AXL-154-M103L-vcMMAE, IgG1-AXL-183-N52Q-vcMMAE, and IgG1-AXL-726-M101L-vcMMAE was not significant affected compared to the IgG1-b12 control.
(355) Anti-tumor activity of anti-AXL-vcMMAE antibodies was observed in various other in vivo tumor models. In two cell line-derived xenograft models (A431; epidermoid adenocarcinoma, and MDA-MB-231; breast cancer) anti-AXL-vcMMAE antibodies induced tumor growth inhibition, and tumor regression was induced by anti-AXL-vcMMAE antibodies in two patient-derived xenograft models from patients with pancreas cancer and cervical cancer.
Example 18-Anti-Tumor Efficacy of AXL-ADCs in a Pancreas Cancer Patient-Derived Xenograft (PDX) Model with Heterogeneous Target Expression
(356) The anti-tumor activity of IgG1-AXL-107-vcMMAE, IgG1-AXL-148-vcMMAE, and IgG1-AXL-733-vcMMAE was determined in the PAXF1657 pancreas cancer PDX model (experiments performed by Oncotest, Freiburg, Germany). Human pancreas tumor tissue was subcutaneously implanted in the left flank of 5-7 weeks old female NMRI nu/nu mice. Randomization of animals was performed as follows: animals bearing a tumor with a volume between 50-250 mm.sup.3, preferably 80-200 mm.sup.3, were distributed in 7 experimental groups (8 animals per group), considering a comparable median and mean of group tumor volume.
(357) At day of randomization (day 0), the 3 ADCs were dosed intravenously (i.v.) at either 4 mg/kg or 2 mg/kg, and the control group received a single dose of IgG1-b12 (4 mg/kg). Tumor volumes (mm.sup.3) were monitored twice weekly and were calculated from caliper (PLEXX) measurements as: 0.52?(length)?(width).sup.2.
(358) Treatment of mice with 2 mg/kg IgG1-AXL-107-vcMMAE, IgG1-AXL-148-vcMMAE and IgG1-AXL-733-vcMMAE significantly reduced the growth of PAXF1657 tumors compared to the control group. At a dose of 4 mg/kg IgG1-AXL-107-vcMMAE, IgG1-AXL-148-vcMMAE and IgG1-AXL-733-vcMMAE induced tumor regression of PAXF1657 tumors. On day 14 after treatment, the average tumor size in mice that had been treated with 2 mg/kg or 4 mg/kg IgG1-AXL-107-MMAE, IgG1-AXL-148-MMAE or IgG1-AXL-733-MMAE was significantly smaller than in mice that had been treated with an isotype control IgG (IgG1-b12) (p<0.001; Tukey's multiple comparison test).
(359) Treatment of mice with unconjugated IgG1-AXL-148 did not result in anti-tumor activity in the PAXF1657 model. Conjugated IgG1-AXL-148-vcMMAE, however, induced dose-dependent antitumor activity in this model, illustrating that the therapeutic capacity of AXL-ADCs is dependent on the cytotoxic activity of MMAE.
(360) Moreover, treatment of mice with the untargeted ADC IgG1-b12-vcMMAE did not show anti-tumor activity in the PAXF1657 model, illustrating that the therapeutic capacity of AXL-ADCs also depends on specific target binding.
Example 19-AXL Antibodies Binding to the Ig1 Domain
(361) The AXL domain specificity of AXL antibodies IgG1-AXL-061, IgG1-AXL-107, IgG1-AXL-137, and IgG1-AXL-613 was determined using a panel of human-mouse chimeric AXL mutants. The human-mouse cross-reactive monoclonal AXL antibody YW327.6S2 was included to confirm expression of hsAXL-mmECD. IgG1-b12 was included as isotype control antibody. Five different chimeric AXL molecules were generated and expressed in HEK293F. In brief, the human Ig-like domain I (Ig1), the Ig-like domain II (Ig2), the human FNIII-like domain I (FN1) or the human FNIII-like domain II domain (FN2) were replaced with their murine homologs. Binding of 1 ?g/mL anti-AXL antibody to the human-mouse AXL chimeras was determined by flow cytometry . . . .
(362) All anti-AXL antibodies showed binding to human AXL, whereas binding was abrogated when the human AXL ECD was replaced with its murine homolog. As expected, the human-mouse cross-reactive monoclonal AXL antibody YW327.6S2 showed binding to hsAXL-mmECD, confirming proper expression of hsAXL-mmECD.
(363) AXL antibodies IgG1-AXL-061, IgG1-AXL-107, IgG1-AXL-137, and IgG1-AXL-613 showed strongly reduced binding to hsAXL-mmIg1, illustrating recognition of an epitope in the AXL Ig1 domain. In line with this, binding of IgG1-AXL-061, IgG1-AXL-107, IgG1-AXL-137, and IgG1-AXL-613 to hsAXL-mmIg2, hsAXL-mmFN1 or hsAXL-mmFN2 was not affected. The human-mouse cross-reactive monoclonal AXL antibody YW327.6S2 showed binding to all chimeric AXL variants, confirming proper expression of these proteins.
Example 20-AXL Antibodies IgG1-AXL-107 and IgG1-AXL-613 Bind to the Ig1 Domain but do not Compete with Gas6 Binding
(364) It was tested whether the binding of the AXL antibodies IgG1-AXL-061, IgG1-AXL-107, IgG1-AXL-137, or IgG1-AXL-613 interfered with binding of AXL ligand Gas6 to AXL. Therefore, binding of Gas6 to A431 cells that had been pre-incubated with 10 ?g/mL AXL antibodies was tested. Pre-incubation with AXL antibody YW327.6S2, that was described to compete with Gas6 for AXL binding, IgG1-b12 (isotype control) or medium (negative control) were included as controls.
(365) Binding curves were analyzed using non-linear regression (sigmoidal dose-response with variable slope) using GraphPad Prism V5.04 software (GraphPad Software, San Diego, CA, USA).
(366) Table 28 shows that binding of Gas6 to A431 cells that had been pre-incubated with IgG1-AXL-107 and IgG1-AXL-613 antibodies was similar to the IgG1-b12 and medium controls. This illustrates that binding of IgG1-AXL-107 and IgG1-AXL-613 to AXL does not interfere with Gas6 binding, as shown in Example 13. The binding of Gas6 to A431 cells was largely reduced in the presence of IgG1-AXL-061, IgG1-AXL-137 and control AXL antibody YW327.62 compared to the IgG1-b12 and medium controls.
(367) In experiments in which A431 cells were pre-incubated with Gas6, the maximal binding values of IgG1-AXL-107 and IgG1-AXL-613 were comparable to antibody binding in absence of Gas6 (maximal binding after Gas6 pre-incubation was 91-108% of binding without Gas6 pre-incubation) (Table 28). The EC.sub.50 values for IgG1-AXL-107 and IgG1-AXL-613 binding with or without Gas6 pre-incubation were in the same range, or somewhat higher after Gas6 pre-incubation (Table 28), illustrating that IgG1-AXL-107 and IgG1-AXL-613 do not compete with Gas6 binding. Similar to control antibody YW327.6S2, the binding of IgG1-AXL-061 and IgG1-AXL-137 to A431 cells was greatly reduced in the presence of Gas6 compared to binding without Gas6 (maximal binding after Gas6 pre-incubation was 40-43% of binding without Gas6 pre-incubation; Table 28). The EC.sub.50 values for IgG1-AXL-061 and IgG1-AXL-137 could not properly be determined after Gas6 pre-incubation (Table 28). This shows that IgG1-AXL-061 and IgG1-AXL-137 compete with Gas6 for binding to AXL.
(368) These data demonstrate that antibodies binding to the AXL Ig1 domain have differential effect on Gas6 binding.
(369) TABLE-US-00031 TABLE 28 Antibody binding to A431 cells Gas6 binding to A431 cells Maximal Maximal binding in binding in EC50 w/o presence of presence of AXL Gas6 EC50 in Gas6 (% of EC50 in antibodies EC50 presence of binding in presence of (% of binding in (?g/mL) Gas6 absence of AXL antibodies prescence of control mean (?g/mL) Gas6) (?g/mL) antibody) Antibody (s.d.) mean (s.d.) mean (s.d.) mean (s.d.) mean (s.d.) IgG1-AXL-061 0.15 (n.a.) n.a. 43 (28) n.a. 22 (8) IgG1-AXL-107 0.16 (0.17) 0.94 (1.18) 91 (5) 0.78 (0.54) 96 (8) IgG1-AXL-137 0.11 (0.10) n.a. 40 (18) n.a 36 (4) IgG1-AXL-613 0.09 (0.09) 0.10 (0.10) 108 (22) 0.57 (0.36) 100 (11) YW327.6S2 0.09 (0.09) 1.90 (1.04)* 41 (24) 5.53 (7.09)* 17 (10) b12 n.a..sup.a n.a. n.a. 0.40 (0.11) 100 .sup.an.a., not applicable *EC50 values less accurate due to low binding.
Example 21-In Vivo Anti-Tumor Efficacy of AXL-ADCs in Xenograft Models with and without Autocrine (Endogenous) Gas6 Production
(370) Gas6 Production of A431 and LCLC-103H Tumor Cells
(371) It was tested whether A431 cells and LCLC-103H cells produce Gas6. Therefore, cells were grown in complete culture medium for 3 days. Gas6 levels in supernatant were determined using the Quantikine Human Gas6 ELISA (R&D Systems, Minneapolis, MN) according to manufacturer's instructions. This assay uses the quantitative sandwich ELISA technique. A monoclonal Ab specific for human Gas6 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any human Gas6 present is bound by the immobilized Ab. After washing away any unbound substances, an enzyme-linked polyclonal Ab specific for human Gas6 is added to the wells. Following a wash to remove any unbound Ab-enzym reagent, a substrate is added to the wells and color develops in proportion to the amount of human Gas6 bound in the initial step. The color development is stopped and the intensity of the color is measured.
(372) Cell culture medium conditioned by A431 cells was found to contain 2576 ng/ml Gas6, while the concentration of Gas6 in medium conditioned by LCLC-103H cells was more than 20-fold less (Table 29).
(373) TABLE-US-00032 TABLE 29 Gas6 production in tumor cell conditioned medium. Gas6 in supernatant Cell line (ng/mL) LCLC-103H 126 A431 2576
Anti-Tumor Activity of AXL-ADCs In Vivo
(374) The in vivo anti-tumor activity of IgG1-AXL-061-vcMMAE (Ig1 binder), IgG1-AXL-107-vcMMAE (Ig1-binder), IgG1-AXL-137-vcMMAE (Ig1-binder), IgG1-AXL-148-vcMMAE (Ig2-binder), IgG1-AXL-183-vcMMAE (FN1-binder), and IgG1-AXL-726-vcMMAE (FN2-binder) was determined in the A431 (epidermoid carcinoma) tumor model, that produces high levels of Gas6, and the LCLC-103H (large cell lung carcinoma) tumor model, that produces low levels of Gas6.
(375) Tumor induction was performed by subcutaneous injection of 5?10.sup.6 A431 or LCLC-103H tumor cells (both obtained from Leibniz-Institut-Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH (DSMZ)) in 200 ?L PBS in the right flank of female SCID mice. Treatment was started 14-21 days after tumor cell inoculation, when the average tumor size was >100-200 mm.sup.3 and distinct tumor growth was observed. Mice received a single injection or a total of 4 biweekly intraperitoneal injections with IgG1-AXL-vcMMAE ADCs or control antibody (unconjugated IgG1-b12), as indicated. Tumor volume was determined at least two times per week. Tumor volumes (mm.sup.3) were calculated from caliper (PLEXX) measurements as: 0.52?(length)?(width).sup.2.
(376) Results:
(377) Treatment of mice with 3 mg/kg IgG1-AXL-107-vcMMAE, IgG1-AXL-148-vcMMAE and IgG1-AXL-733-vcMMAE induced growth inhibition of A431 tumors.
(378) Treatment of mice with 3 mg/kg IgG1-AXL-148-vcMMAE, IgG1-AXL-183-vcMMAE (FN1 binder) and IgG1-AXL-726-vcMMAE (FN2 binder) induced growth inhibition of A431 tumors. In contrast, clones IgG1-AXL-061-vcMMAE and IgG1-AXL-137-vcMMAE did not show anti-tumor activity in the A431 xenograft model.
(379) Treatment of mice with 3 mg/kg IgG1-AXL-061-vcMMAE, IgG1-AXL-137-vcMMAE, IgG1-AXL-148-vcMMAE, IgG1-AXL-183-vcMMAE and IgG1-AXL-726-vcMMAE induced tumor regression in the LCLC-103H xenograft model. Similarly, treatment of mice with 1 mg/kg IgG1-AXL-107-vcMMAE or 1 mg/kg IgG1-AXL-613-vcMMAE induced regression of LCLC-103H tumors.
(380) In summary, all AXL-ADCs showed anti-tumor activity in the LCLC-103H xenograft model that produces low levels of Gas6. In the A431 xenograft model, that produces high levels of Gas6, anti-tumor activity was only observed for those AXL-ADCs that did not compete with the AXL ligand Gas6.
Example 22-Anti-Tumor Efficacy of AXL-ADCs in an Esophageal Cancer Patient-Derived Xenograft (PDX) Model
(381) The anti-tumor activity of IgG1-AXL-107-vcMMAE was evaluated in the subcutaneous esophageal PDX model ES0195 in BALB/c nude mice (experiments performed by Crown Bioscience. Taicang Jiangsu Province, China). Tumor fragments from donor mice bearing patient-derived esophageal xenografts (ES0195) were used for inoculation into BALB/c nude mice. Each mouse was inoculated subcutaneously at the right flank with one tumor fragment (2-3 mm in diameter) and tumors were allowed to grow until the tumor volume was about 150 mm.sup.3. Randomization of animals was performed as follows: animals bearing a tumor with a volume of about 150 mm.sup.3 were distributed in 5 experimental groups (8 animals per group), considering a comparable median and mean of group tumor volume. The treatment groups were: IgG1-b12, IgG1-b12-vcMMAE, IgG1-AXL-107, IgG1-AXL-107-vcMMAE, and paclitaxel. The antibodies and ADCs were dosed intravenously (i.v.) at 4 mg/kg at day of randomization (day 0) and day 7. Paclitaxel was dosed intra-peritoneally (i.p.) at 20 mg/kg at day 0, 7, and 14. Tumor volumes (mm.sup.3) were monitored twice weekly and were calculated from caliper (PLEXX) measurements as: 0.52?(length)?(width).sup.2.
(382) Treatment of mice with IgG1-AXL-107-vcMMAE induced tumor regression of ES0195 tumors compared to the IgG1-b12 and IgG1-b12-MMAE control groups (p<0.001 at day 23, one-way ANOVA test). Treatment of mice with the untargeted ADC IgG1-b12-vcMMAE did not show anti-tumor activity in this model, illustrating that the therapeutic capacity of AXL-ADCs depends on specific target binding. Mice that were treated with paclitaxel showed tumor growth inhibition, but this was less effective compared to treatment with IgG1-AXL-107-vcMMAE (p<0.05 at day 23, one-way ANOVA test).
Example 23-In Vitro Cytotoxicity Induced by AXL-Specific Antibody Drug Conjugates is Dependent on Target Expression
(383) The in vitro cytotoxicity of IgG1-AXL-107-vcMMAE was tested in human tumor cell lines with different levels of AXL expression.
(384) Cell Culture
(385) LS174T cells (human colorectal adenocarcinoma cell line; ATCC, cat no CL-188) were cultured in Minimum Essential Medium (MEM) with Glutamax, Hepes and Phenol Red (Life Technologies, cat no 42360-024). Components are 10% Donor Bovine Serium with Iron (DBSI) (Life Technologies, cat no 10371-029) and 1% Sodium Pyruvate (100 mM; Lonza, cat no BE13-115E) and 1% Penicillin/Streptomycin (Lonza, cat no DE17-603E).
(386) NCI-H226 cells (human lung squamous cell carcinoma; ATCC, cat no CRL-5826), NCI-H661 cells (human large cell lung cancer; ATCC, cat no HTB-183), and NCI-H1299 cells (human non-small cell lung cancer; ATCC, cat no CRL-5803) were cultured in RPMI 1640 Medium (ATCC Modification; Life Technologies, cat no A10491-01). Components are 10% Donor Bovine Serium with Iron (DBSI; Life Technologies, cat no 10371-029) and 1% Penicillin/Streptomycin (Lonza, cat no DE17-603E).
(387) SKOV-3 cells (human ovarian adenocarcinoma; ATCC, cat no HTB-77) were cultured in McCoy's 5A Medium with L-glutamine and HEPES (Lonza, cat no BE12-168F). Components are 10% Donor Bovine Serium with Iron (DBSI; Life Technologies, cat no 10371-029) and 1% Penicillin/Streptomycin (Lonza, cat no DE17-603E).
(388) Calu-1 cells (human lung epidermoid carcinoma; ATCC, cat no HTB-54) were cultured in McCoy's 5A Medium with Catopeptone, without HEPES (Life Technologies, cat no 26600-023). Components are 10% Donor Bovine Serium with Iron (DBSI; Life Technologies, cat no 10371-029) and 1% L-glutamine (200 nM) in 0.85% NaCl solution (Lonza, cat no BE17-605F) and 1% Penicillin/Streptomycin (Lonza, cat no DE17-603E). Calu-1 cells are resistant to EGFR targeted therapy.
(389) LCLC-103H cells (human large cell lung cancer), A431 cells (human epidermoid adenocarcinoma) and MDA-MB-231 cells (human breast cancer) were cultured as described in Example 16.
(390) Quantification of AXL Expression on the Plasma Membrane of Human Tumor Cell Lines
(391) AXL expression on the plasma membrane of human tumor cell lines was assessed by indirect immunofluorescence using QIFIKIT (DAKO, Cat nr K0078) with mouse monoclonal antibody Z49M (Santa Cruz biotechnology, Cat nr sc-73719). Adherent cells were trypsinized and passed through a cell strainer to obtain single cell suspensions. Cells were pelleted by centrifugation for 5 minutes at 1,200 rpm, washed with PBS and resuspended at a concentration of 1?10.sup.6 cells/mL. The next steps were performed on ice. 100 ?L of the single cell suspensions (100,000 cells per well) were seeded in polystyrene 96-well round-bottom plates (Greiner Bio-One, Cat nr 650101). Cells were pelleted by centrifugation for 3 minutes at 300?g and resuspended in 50 ?L antibody sample or mouse IgG1 isotype control sample (BD/Pharmingen, Cat nr 555746) at a concentration of 10 ?g/mL. After an incubation of 30 minutes at 4? C., cells were pelleted and resuspended in 150 ?L FACS buffer. Set-up and calibration beads were added to the plate according to the manufacturer's instructions. Cells and beads in parallel were washed two more times with 150 UL FACS buffer and resuspended in 50 UL FITC-conjugated goat-anti-mouse IgG (1/50; DAKO, Cat nr K0078). Secondary antibody was incubated for 30 minutes at 4? C. in the dark. Cells and beads were washed twice with 150 ?L FACS buffer and resuspended in 100 ?L FACS buffer. Immunofluorescence was measured on a FACS Canto II (BD Biosciences) by recording 10,000 events within the gate of viable cells. The mean fluorescence intensity of the calibration beads was used to calculate the calibration curve using GraphPad Prism software (GraphPad Software, San Diego, CA, USA). For each cell line, the antibody binding capacity (ABC), an estimate for the number of AXL molecules expressed on the plasma membrane, was calculated using the mean fluorescence intensity of the AXL antibody-stained cells, based on the equation of the calibration curve (interpolation of unknowns from the standard curve, using GraphPad Software).
(392) Cytotoxicity Assay
(393) For LCLC-103H, A431, MDA-MB-231, NCI-H226, NCI-H661, NCI-H1299, LS174T and SKOV-3 cells, the in vitro cytotoxicity assay was performed as described in Example 8. For Calu-1, the cytotoxicity assay was performed as described in Example 16, with the adaptation that the cell cultures were incubated for 11 instead of 5 days. Dose-response curves were generated using Graphpad Prism software, using non-linear regression analysis. The percentage of viable cells at an IgG1-AXL-107-vcMMAE concentration of 1 ?g/mL was interpolated from the dose-response curves.
(394) IgG1-AXL-107-vcMMAE induced the most potent cytotoxicity in cell lines with high AXL expression, whereas cytotoxicity was low or absent in cell lines with low AXL expression. This illustrates that IgG1-AXL-107-vcMMAE is effective in induction of cytotoxicity in cells resistant to EGFR targeted therapy, such as Calu-1.
LIST OF REFERENCES
(395) [1] Paccez et al, Int. J. Cancer: 134, 1024-1033 (2013) [2] Leconet et al, Oncogene, 1-10 (2013) [3] Linger et al, Expert Opin. Ther. Targets, 14 (10): 1073-1090 (2010) [4] Li et al, Oncogene, 28, 3442-3455 (2009) [5] Ye et al, Oncogene, 1-11 (2010) [6] Alley et al, Current Opinion in Chem. Bio., 4, 529-537 (2010) [7] lida et al, Anticancer Research, 34:1821-1828 (2014) [8] WO 2012/175691; INSERM [9] WO 2012/175692; INSERM [10] WO 2013/064685; PF Medicament [11] WO 2013/090776; INSERM [12] WO 2009/063965; Chugai Pharmaceuticals [13] WO 2010/131733 [14] WO9704801 [15] WO9856418 [16] WO02011753 [17] WO02096457 [18] WO03009817 [19] WO03039485 [20] U.S. Pat. No. 8,372,396 [21] WO2004004639 [22] WO2004016286 [23] WO2004055164 [24] WO 2004071439 [25] WO2006014965 [26] WO2006044908 [27] WO2007019232 [28] WO2015075201; Genmab [29] Wakankar A, et al., MAbs. 2011 March-April; 3 (2): 161-72. [30] V?squez-Rey and Lang, 2011, Biotech, Bioeng. 108 (7) p. 1494-1508. [31] Singh et al., AAPS PharmSciTech, Vol. 13, No. 2, 2012. [32] Bruce A. Kerwin, Journal Of Pharmaceutical Sciences, Vol. 97, No. 8, August 2008, 2924-2935. [33] Stephan J P, et al., Bioanalysis. 2011 March; 3 (6): 677-700 [34] Stephen C Alley, Kevin E Anderson, Curr Opin Chem Biol, June 2013, 17 (3), 406-411 [35] WO 2007/059782; Genmab A/S [36] Ward et al., Nature 341, 544 546 (1989) [37] Holt et al; Trends Biotechnol. 2003 November; 21 (11): 484-90 [38] Revets et al; Expert Opin Biol Ther. 2005 January; 5 (1): 111-24 [39] Bird et al., Science 242, 423 426 (1988) [40] Huston et al., PNAS USA 85, 5879 5883 (1988) [41] Lefranc MP. et al., Nucleic Acids Research, 27, 209-212, 1999 [42] Brochet X. Nucl. Acids Res. 36, W503-508 (2008) [36 [43] EP 2 220 131; U3 Pharma [44] WO 2011/159980; Genentech [45] U.S. Pat. No. 5,635,483 [46] U.S. Pat. No. 5,780,588 [47] Senter et al., Proc Am Ass Cancer Res 2004; 45, abstract 623, presented Mar. 28, 2004 [48] US 2005/0238649 [49] WO 2004/010957 (Seattle Genetics, Inc.) [50] U.S. Pat. No. 7,659,241 (Seattle Genetics, Inc.) [51] U.S. Pat. No. 7,851,437 (Seattle Genetics, Inc.) [52] U.S. Pat. No. 829,531 (Seattle Genetics, Inc.) [53] U.S. Ser. No. 11/833,028 (Seattle Genetics, Inc.) [54] U.S. Pat. No. 7,498,298 (Seattle Genetics, Inc.) [55] U.S. Ser. No. 11/833,954 (Seattle Genetics, Inc.) [56] WO 2005/081711 (Seattle Genetics, Inc.)