Edible vaccines expressed in soybeans
10030250 ยท 2018-07-24
Inventors
Cpc classification
C12N15/8258
CHEMISTRY; METALLURGY
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
International classification
C12N15/82
CHEMISTRY; METALLURGY
A61K39/00
HUMAN NECESSITIES
C07K16/00
CHEMISTRY; METALLURGY
Abstract
The present invention relates to vaccines that are made in transgenic soybeans for use in humans, animals of agricultural importance, pets, and wildlife. These vaccines are used as vaccines against viral, bacterial, fungal, parasitic or prion related diseases, cancer antigens, toxins, and autologous or self proteins. The transgenic soybeans of the instant invention also can be used for inducing tolerance to allergens or tolerance to autoimmune antigens, wherein an individual shows hypersensitivity to said allergen or has developed autoimmunity to autologous or self proteins, respectively. The invention also relates to prophylatically treating individuals and/or populations prior to showing hypersensitivity to allergens. Other aspects of the invention include using the transgenic soybeans as an oral contraceptive, and the expression of protein adjuvants in transgenic soybeans.
Claims
1. A soy formulation that induces mucosal and/or systemic tolerance, wherein the soy formulation is functional in an animal model when administered orally, wherein said soy formulation comprises a heterologous protein expressed from an exogenous gene, wherein said exogenous gene codes for a protein selected from the group consisting of acetylcholine receptor, Myelin Basic Protein, and Collagen Type II, and wherein said gene further comprises a sequence that encodes a polypeptide that acts as a targeting domain for epithelial cells, and wherein the exogenous gene is driven by a soybean beta-conglycinin 7S seed specific promoter and comprises a tobacco etch virus translational enhancer element.
2. The soy formulation of claim 1, wherein said soy formulation derives from transgenic soybeans produced by transforming soybeans using a selectable marker that is the bar gene encoding resistance to the herbicide bialophos or the EPSPS gene encoding resistance to glyphosate.
3. The soy formulation of claim 1, wherein the exogenous gene that codes for a protein is Myelin Basic Protein or acetylcholine receptor.
4. The soy formulation of claim 3, wherein said soy formulation results from a transformed soybean that is selected using a selectable marker that is the bar gene encoding resistance to the herbicide bialophos or the EPSPS gene encoding resistance to glyphosate.
5. The soy formulation of claim 3, wherein said soy formulation results from a transformed soybean that is selected using a selectable marker that is the bar gene encoding resistance to the herbicide bialophos.
6. The soy formulation of claim 3, wherein said soy formulation results from a transformed soybean that is selected using a selectable marker that is the EPSPS gene encoding resistance to glyphosate.
7. The soy formulation of claim 1, wherein the soy formulation is present in soy milk or soy powder.
8. The soy formulation of claim 7, wherein the soy formulation is present in soy milk.
9. The soy formulation of claim 7, wherein the soy formulation is present in soy powder.
10. The soy formulation of claim 2, wherein the soy formulation is present in soy milk or soy powder.
11. The soy formulation of claim 3, wherein the soy formulation is present in soy milk or soy powder.
12. The soy formulation of claim 4, wherein the soy formulation is present in soy milk or soy powder.
13. The soy formulation of claim 12, wherein the exogenous ene further comprises a terminator sequence that expresses a CaMV 35S polyadenylation sequence or a nopaline synthase polyadenylation sequence.
14. The soy formulation of claim 5, wherein the soy formulation is present in soy milk or soy powder.
15. The soy formulation of claim 14, wherein the soy formulation is present in soy milk.
16. The soy formulation of claim 14, wherein the soy formulation is present in soy powder.
17. The soy formulation of claim 6, wherein the soy formulation is present in soy milk or soy powder.
18. The soy formulation of claim 17, wherein the soy formulation is present in soy powder.
19. The soy formulation of claim 17, wherein the soy formulation is present in soy milk.
Description
BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWING
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26) The figures in this application have been derived from synthetic FanC targeted to the cytosol. Because of the constitutive nature of the promoter used in this construct, transgenic FanC also fortuitously expresses and accumulates in seeds. A construct targeting FanC to the chloroplast has also been made. Constructs targeting FanC and/or any other antigen in transgenic soybeans directed specifically to the seed (using a seed promoter) and the endoplasmic reticulum (using targeting and retention signals) are also within the scope of the present invention. It is also contemplated and within the scope of the invention that any other cellular organelle can be targeted such as the chloroplast, vacuole, mitochondria or any other plant organelle.
(27) Synthetic constructs LT-A and LT-B that have been targeted to the cytosol are shown in
(28)
(29)
(30)
DETAILED DESCRIPTION OF THE INVENTION
(31) Recombinant techniques using expression cassettes have allowed the incorporation of exogenous genes (as well as endogenous genes) into other organisms. Expression cassettes generally contain a number of regulatory elements. The construction of the expression cassette of the instant invention contains one or more of the following regulatory elements: 1) a promoter to initiate transcription, 2) an enhancer region to enhance transcription and/or translation, dependent upon the promoter used, 3) sequences to target transcription, translation, and/or protein accumulation to specific locations within the plant or cell,) a coding region, which determines the specific protein or proteins that will be expressed in transgenic plants, and 5) a polyadenylation recognition site to determine transcription termination and for mRNA stability. In addition, 6) a selectable marker cassette can be included for selection during transformation and in subsequent generations.
(32) The promoter of the instant invention directs transcription and/or directs protein accumulation in the seed component of the plant. However, it should be understood that protein accumulation can be directed to other parts of the soybean. Seed-specific promoters are available and are known to those of skill in the art. In an exemplary embodiment, beta conglycinin is used as a promoter, which is sometimes referred to as the 7S promoter. The 7S promoter has been used to drive expression of synthetic fanC, synthetic SEB, and synthetic bee venom PLA2. Although the 7S promoter was used in the embodiments of the instant invention, it should be understood that other promoters can be used with the ideal promoter being one which results in the highest accumulation of transgenic protein in the desired region of the soybean (for example in the seed) as determined by assays such as Western analysis, ELISA, or direct plant part (e.g., seed) composition assays. Another embodiment contemplates the used of constitutive promoters, such as 35S. Any of a plurality of constitutive promoters can be used depending on where one wants to drive the accumulation of protein. For example, 35 S drives the accumulation of transgenic protein in soybean seeds and leaves.
(33) An example of a subunit antigen expressed in seed driven by the 35S promoter is synthetic fanC. Other antigens that can be driven by the 35S promoter include wild-type and synthetic LT-A and Lt-B, wild-type and synthetic SEB, and wild-type and synthetic PLA2. A plurality of other subunit antigen species genes that cause known diseases can be incorporated into exogenous systems (such as higher plant systems like soybeans and the like) and driven by the 35S promoter or any of a plurality of promoters. Examples of the diseases (and their associated proteins) include hepatitis A (capsid protein and a non-structural protein), AIDS (gp 120 & gp41 Gag & RT), SARS (Spike glycoprotein nucleocapsid), Genital Herpes (gB and gD scaffolding proteins), Smallpox (membrane protein and core proteins), Encephalitis (nsProtein 1-4 spike proteins) and the like.
(34) It is also contemplated that any of a plurality of enhancers can be used in the present invention. An exemplary embodiment of an enhancer is the tobacco etch virus leader sequence (TEV), which enhances translation. Any of a plurality of enhancers can be used for a plurality of constructs, such as the constructs for synthetic fanC, synthetic LT-A and Lt-B, synthetic SEB, and synthetic PLA2.
(35) The present invention also contemplates the use of targeting sequences. Targeting sequences are used to direct mRNA and/or protein to various cellular locations. The reason for doing this would be to increase/optimize protein accumulation and or to optimize immunogenicity of a particular antigen or allergen in a particular region. It is possible that a protein targeted to one compartment may accumulate to higher levels than the same protein targeted to another location within the cell. It is also possible that proteins targeted to different locations may have different immunogenicities, possibly due to post translational modifications such as phosphorylation, glycosylation, etc. Targeting sequences may be located 5, 3 and/or 5 and 3 to the gene of interest (GOI). Examples of how different areas can be targeted using different targeting sequences are shown in Table 1 (the synFanC gene is discussed in more detail below).
(36) TABLE-US-00001 TABLE 1 Components of the FanC expression cassettes. Trans- N- C- Tar- la- termi- termi- get tional nal nal loca- en- se- se- tion Promote hancer quence Gene quence Terminator Cyto- CaMV- TEV synFanC CaMV-35S sol 35S Endo. CaMV- TEV soy synFanC KDEL CaMV-35S Ret. 35S vspS Chloro- CaMV- TEV pea synFanC CaMV-35S plast 35S rbc-S Seed Soy 7S TEV synFanC CaMV-35S Abbreviations for Table 1: CaMV-35S, cauliflower mosaic virus 35S (promoter and polyadenylation/terminator); TEV, tobacco etch virus leader sequence; synFanC, plant-optimized version of FanC; soy vspS, 21 amino acid leader sequence of the S subunit of soybean vegetative storage protein; KDEL (SEQ ID NO: 54), universal endoplasmic reticulum retention signal; pea rbc-S, 84 amino acid targeting peptide of pea ribulose 1,5 bis-phosphate carboxylase small subunit; soy 7S, soybean beta-conglycinin 7S promoter.
(37) An example of a sequence targeted to the endoplasmic reticulum would contain the alpha subunit of soybean vegetative storage protein located 5 to the coding region, along with an in-frame 3 retention signal such as one coding for the amino acids KDEL (SEQ ID NO:54), HDEL (SEQ ID NO:55), or RDEL (SEQ ID NO:56). An example of a sequence used to target a protein to the chloroplast would be the small subunit of the protein Rubisco derived from Pisum sativum (pea), fused in frame and at the amino terminus of the gene of interest. Thus, the instant invention contemplates the use of any of a plurality of targeting sequences based upon where the GOI is to be accumulated.
(38) The coding region is the nucleotide sequence that when expressed, generates a desired protein. Essentially any soybean gene segment(s) designed to encode a single protein, or part of a protein, multiple proteins, multiple parts of a single protein, or multiple parts of multiple proteins optimized for expression in soybean are contemplated and within the scope of the invention. Modifications from the native gene are also contemplated and are within the scope of the present invention. Examples of modifications or segment would include the following:
(39) Alteration of the codon usage to employ preferred codon usage in Glycine max (soybean)
(40) Alteration of the GC content of the segment to represent similarity to GC content of soybean coding genes
(41) Removal of any AT stretches longer than 5 nucleotides to reduce the potential for cryptic polyadenylation and mRNA instability
(42) Removal of any mRNA processing signals, including splice site recognition and AT content of introns that may destabilize mRNAs
(43) Removal of secondary structures, hairpin loops, etc. that may destabilize mRNA
(44) Addition of sequences to direct mRNA or subsequent pre-proteins to desired locations within cells or plant structures (such as seeds, chloroplasts, mitochondria, cytosol, endoplasmic reticulum, etc.).
(45) In an embodiment of the present invention, a synthetic sequence is optimized for expression in soybean and subcloned in the context of other regulatory elements to allow expression and accumulation in soybean. Examples of segments that have been constructed with these criteria for transformation and expression in soybean include synthetic fanC, synthetic SEB (Staph enterotoxin B), and synthetic bee venom phospholipase A2 (PLA2). It is also contemplated and within the scope of the present invention to have multiple protein segments. Although any of a plurality of multiple protein segments are contemplated, an exemplary embodiment of multiple protein segments expressed simultaneously in soybean include synthetic E. coli heat labile toxin subunit A and subunit B (LT-A and LT-B). Another example of multiple segments from multiple proteins may include immunogenic domains from several of the known allergens in bee venom.
(46) An embodiment of the present invention may also include terminators and/or polyadenylation sequences. These elements provide stability. Exemplary embodiments that can be used in the system of the instant invention include the CaMV 35S polyadenylation sequence, and the Nopaline Synthase polyadenylation sequence. Other terminators and/or polyadenylation sequences are known and are considered to be within the scope of the present invention.
(47) Multiple expression cassettes can be introduced into soybean. However, when one limits the number of redundant sequences, expression tends to proceed more efficiently. Multiple expression cassettes may include for example, the use of different promoters, enhancers, targeting signals, and terminator/polyadenylation elements. Moreover, any antigen or toleragen cassette can be stacked with other cassettes to employ beneficial effects to the seeds, such as increased linolenic acid, herbicide tolerance, pesticide tolerance, drought resistance, stress resistance, etc.
(48) The expression of subunit vaccines in soybeans has significant advantages over previously reported strategies. Due to the relatively high protein content of soybeans when compared to other transgenic plants that have been used for the development of edible vaccines (e.g. potatoes and tomatoes), the soybean system permits the highest expression of immunogen per total weight of plant material. Furthermore, the ease of efficiently converting soybeans into formulations which can be consumed is a significant advantage in developing oral immunization strategies. Accordingly, the use of transgenic soybeans as one of the methods of choice for expression of plant-derived vaccines should be apparent to those of skill in the art when read in light of the instant disclosure.
(49) Mice were allowed to eat whole soybeans coupled with an oral adjuvant. The mice were exposed several times, and serum antibody titers were determined about one month later. Mice fed whole soybeans expressing FanC developed high antibody titers when compared to controls. The results of this study provide compelling evidence to support the practicality of expressing edible vaccines in soybeans.
(50) Thus, any of the plurality of above described regulatory elements can be incorporated or omitted from the expression cassettes. Specific examples of how the expression cassettes can be manipulated to generate transgenic organisms to develop oral vaccines are given below. However, first a general overview of the invention is given, then several examples of an overall strategy (using specific examples) are given that describes how one might develop a strategy for oral vaccines.
(51) Subunit Vaccines Containing a Single Protein
(52) Essentially any protein which is contained within a single open reading frame can be expressed in soybeans for use as a vaccine once a synthetic, plant-compatible gene is made and transformation is performed. An example showing E. coli FanC for use as a vaccine in livestock is described below. Another example is SEB.
(53) It is contemplated and within the scope of the present invention that modifications of the original protein sequence may be made. These modifications include:
(54) a) amino acid changes at specific residues in the original protein sequence which might change the stability of the protein, change the immunogenicity of the protein, change the solubility of the protein, change the glycosylation of the protein, or change the phosphorylation of the protein.
(55) b) conserved amino acid changes at specific residues in the original protein sequence to construct similar, but distinct proteins (e.g. a change from glutamic acid to aspartic acid).
(56) c) non-conserved amino acid changes at specific residues in the original protein sequence to construct similar, but distinct proteins (e.g. a change from glutamic acid to glutamine).
(57) d) addition of amino acids at the N-terminus or C-terminus to target proteins to specific cellular locations (for example, chloroplast, endoplasmic reticulum, seed, mitochondria, etc.).
(58) Subunit Vaccines Containing Multiple Proteins
(59) Essentially any protein which is contained within two or more open reading frames can be expressed in soybeans for use as a vaccine once synthetic, plant-compatible genes are made and transformation is performed. However, there are some additional considerations, including the use of the same or different regulatory elements for each of the proteins to be expressed.
(60) As discussed above in the section pertaining to subunit vaccines containing a single protein, modifications of the original protein sequence are considered to be within the scope of the invention and include:
(61) a) amino acid changes at specific residues in the original protein sequence which might change the stability of the protein, change the immunogenicity of the protein, change the solubility of the protein, change the glycosylation of the protein, or change the phosphorylation of the protein.
(62) b) conserved amino acid changes at specific residues in the original protein sequence to construct similar, but distinct proteins (e.g. a change from glutamic acid to aspartic acid).
(63) c) non-conserved amino acid changes at specific residues in the original protein sequence to construct similar, but distinct proteins (e.g. a change from glutamic acid to glutamine).
(64) d) addition of amino acids at the N-terminus or C-terminus to target proteins to specific cellular locations (for example, chloroplast, endoplasmic reticulum, seed, mitochondria, etc.).
(65) Subunit Toleragens (i.e. Allergens or Autoimmune Antigens) Containing a Single Protein
(66) Essentially any protein which is contained within a single open reading frame can be expressed in soybeans for use as a toleragen once a synthetic, plant-compatible gene is made and transformation is performed.
(67) An example of one of these toleragens, bee venom phospholipase A2 for use in humans is given in detail below. Another example would be grass pollen.
(68) As discussed above in the section pertaining to subunit vaccines containing a single protein and multiple proteins, modifications of the original protein sequence are considered to be within the scope of the invention and include:
(69) a) amino acid changes at specific residues in the original protein sequence which might change the stability of the protein, change the immunogenicity of the protein, change the solubility of the protein, change the glycosylation of the protein, or change the phosphorylation of the protein.
(70) b) conserved amino acid changes at specific residues in the original protein sequence to construct similar, but distinct proteins (e.g. a change from glutamic acid to aspartic acid).
(71) c) non-conserved amino acid changes at specific residues in the original protein sequence to construct similar, but distinct proteins (e.g. a change from glutamic acid to glutamine).
(72) d) addition of amino acids at the N-terminus or C-terminus to target proteins to specific cellular locations (for example, chloroplast, endoplasmic reticulum, seed, mitochondria, etc.).
(73) Subunit Toleragens (i.e. Allergens or Autoimmune Antigens Containing Multiple Proteins)
(74) Essentially any protein which is contained within two or more open reading frames can be expressed in soybeans for use as a toleragen once synthetic, plant-compatible genes are made and transformation is performed. However, there are additional considerations, including the use of the same or different regulatory elements for each of the proteins to be expressed.
(75) As discussed above in the section pertaining to subunit vaccines containing a single protein subunit toleragens, modifications of the original protein sequence are considered to be within the scope of the invention and include:
(76) a) amino acid changes at specific residues in the original protein sequence which might change the stability of the protein, change the immunogenicity of the protein, change the solubility of the protein, change the glycosylation of the protein, or change the phosphorylation of the protein.
(77) b) conserved amino acid changes at specific residues in the original protein sequence to construct similar, but distinct proteins (e.g. a change from glutamic acid to aspartic acid).
(78) c) non-conserved amino acid changes at specific residues in the original protein sequence to construct similar, but distinct proteins (e.g. a change from glutamic acid to glutamine).
(79) Subunit Vaccines or Toleragens Containing a Peptide Segment, or Concatamers of Homologous Peptide Segments, or Concatamers of Heterologous Peptide Segments Representing B Lymphocyte Epitopes
(80) The subunit vaccines of the present invention include concatamers and peptide segments that have been incorporated into transformed soybeans. Concatamers may be a) contiguous or b) separated by a finite number of irrelevant amino acids (e.g., a single glycine residue or a sequence of 6 glycine residues (SEQ ID NO:60)), c) separated by amino acids representing known proteolytic cleavage sites (e.g. trypsin, chymotrypsin, serine protease, caspase, etc.), or d) separated by cysteine residues to allow disulfide bond formation. Generally, these concatamers and peptide segments will present an epitope that can be recognized by B lymphocytes (and thus, serve as a vaccine).
(81) Subunit Vaccines or Toleragens Containing a Peptide Segment, or Concatamers of Homologous Peptide Segments, or Concatamers of Heterologous Peptide Segments Representing CD4+ T Helper Lymphocyte Epitopes
(82) The subunit vaccines of the present invention include concatamers and peptide segments that have been incorporated into transformed soybeans. Concatamers may be a) contiguous or b) separated by a finite number of irrelevant amino acids (e.g., a single glycine residue or a sequence of 6 glycine residues (SEQ ID NO:60)), c) separated by amino acids representing known proteolytic cleavage sites (e.g. trypsin, chymotrypsin, serine protease, caspase, etc.), or d) separated by cysteine residues to allow disulfide bond formation. Generally, these concatamers and peptide segments will present an epitope that can be recognized by CD4+ T lymphocytes (and thus, serve as a vaccine).
(83) Subunit Vaccines or Toleragens Containing a Peptide Segment, or Concatamers of Homologous Peptide Segments, or Concatamers of Heterologous Peptide Segments Representing CD8+ T Lymphocyte Epitopes
(84) The subunit vaccines of the present invention include concatamers and peptide segments of homologous or heterologous protein antigens that have been incorporated into transformed soybeans. Concatamers may be a) contiguous or b) separated by a finite number of irrelevant amino acids (e.g., a single glycine residue or a sequence of 6 glycine residues (SEQ ID NO:60)), c) separated by amino acids representing known proteolytic cleavage sites (e.g. trypsin, chymotrypsin, serine protease, caspase, etc.), or d) separated by cysteine residues to allow disulfide bond formation. Generally, these concatamers and peptide segments will present an epitope that can be recognized by CD8+ T lymphocytes (and thus, serve as a vaccine).
(85) Subunit Vaccines or Toleragens Containing a Peptide Segment, or Concatamers of Homologous Peptide Segments, or Concatamers of Heterologous Peptide Segments Representing Gamma-Delta T Cell Epitopes
(86) The subunit vaccines of the present invention include concatamers and peptide segments of homologous or heterologous protein antigens that have been incorporated into transformed soybeans. Concatamers may be a) contiguous or b) separated by a finite number of irrelevant amino acids (e.g., a single glycine residue or a sequence of 6 glycine residues (SEQ ID NO:60)), c) separated by amino acids representing known proteolytic cleavage sites (e.g. trypsin, chymotrypsin, serine protease, caspase, etc.), or d) separated by cysteine residues to allow disulfide bond formation. Generally, these concatamers and peptide segments will present an epitope that can be recognized by gamma-delta T cells (and thus, serve as a vaccine).
(87) Subunit Vaccines or Toleragens Containing a Peptide Segment or Concatamers of Homologous Peptide Segments, or Concatamers of Heterologous Peptide Segments Representing Pattern Recognition Receptor Epitopes
(88) The subunit vaccines of the present invention include concatamers and peptide segments of homologous or heterologous protein antigens that have been incorporated into transformed soybeans. Concatamers may be a) contiguous or b) separated by a finite number of irrelevant amino acids (e.g., a single glycine residue or a sequence of 6 glycine residues (SEQ ID NO:60)), c) separated by amino acids representing known proteolytic cleavage sites (e.g. trypsin, chymotrypsin, serine protease, caspase, etc.), or d) separated by cysteine residues to allow disulfide bond formation. Generally, these concatamers and peptide segments will present an epitope that can be recognized by pattern recognition receptors (and thus, serve as a vaccine).
(89) Subunit Adjuvants Containing a Single Protein
(90) The present invention also relates to subunit adjuvants containing a single protein. The single protein adjuvant serves the function of increasing the efficacy of the immune response to the vaccine. Essentially, any protein which is contained within a single open reading frame can be expressed in soybeans for use as an adjuvant once a synthetic, plant-compatible gene is made and transformation is performed.
(91) These single protein subunit adjuvants are expressed in soybeans and can either be co-expressed with the protein of the vaccine, or alternatively, the adjuvant can be expressed in separate soybeans and administered to individuals separately from the soybeans that serve as the edible vaccine. Modifications of these single protein subunit adjuvants are contemplated and are within the scope of the present invention. These modifications include:
(92) a) amino acid changes at specific residues in the original protein sequence which might change the stability of the protein, change the immunogenicity of the protein, change the solubility of the protein, change the glycosylation of the protein, or change the phosphorylation of the protein.
(93) b) conserved amino acid changes at specific residues in the original protein sequence to construct similar, but distinct proteins (e.g. a change from glutamic acid to aspartic acid).
(94) c) non-conserved amino acid changes at specific residues in the original protein sequence to construct similar, but distinct proteins (e.g. a change from glutamic acid to glutamine).
(95) d) addition of amino acids at the N-terminus or C-terminus to target proteins to specific cellular locations (for example, chloroplast, endoplasmic reticulum, seed, mitochondria, etc.).
(96) Subunit Adjuvants Containing Multiple Proteins
(97) In addition to the single protein subunit vaccines disclosed above, the present invention also encompasses subunit vaccines that contain multiple proteins. Almost any protein which is contained within two or more open reading frames can be expressed in soybeans for use as an adjuvant once synthetic, plant-compatible genes are made and transformation is performed. However, there are additional considerations, including the use of the same or different regulatory elements for each of the proteins to be expressed that should be considered.
(98) In an embodiment discussed in more detail below, an example of a subunit adjuvant that contains multiple proteins is the E. coli heat labile toxin for use as an adjuvant in humans or livestock.
(99) It should be apparent to those of ordinary skill in the art that the subunit vaccines that contain multiple proteins can encompass modifications of the original protein sequence. These modifications include:
(100) a) amino acid changes at specific residues in the original protein sequence which might change the stability of the protein, change the immunogenicity of the protein, change the solubility of the protein, change the glycosylation of the protein, or change the phosphorylation of the protein.
(101) b) conserved amino acid changes at specific residues in the original protein sequence to construct similar, but distinct proteins (e.g. a change from glutamic acid to aspartic acid).
(102) c) non-conserved amino acid changes at specific residues in the original protein sequence to construct similar, but distinct proteins (e.g. a change from glutamic acid to glutamine).
(103) d) targeting sequences to direct one or both proteins to various cellular locations.
(104) Subunit Vaccines or Toleragens Containing a Peptide Segment, or Concatemers of Homologous Peptide Segments, or Concatemers of Heterologous Peptide Segments Co-Expressed with Proteins or Peptides which Target Binding to Receptors on Epithelial Cells to Facilitate Deliver
(105) Essentially any vaccine or toleragen construct can be co-expressed as a fusion protein with proteins or peptides which target binding to epithelial cells in the gastrointestinal tract. For example, the plant lectin protein, Ulex europaeus agglutinin I can be coupled to vaccines or toleragens to facilitate uptake by specialized epithelial cells called M cells (Vaccine, 2005 23:3836-42 incorporated by reference in its entirety). Thus, the present invention encompasses any of the vaccines or toleragen constructs described generically or specifically herein wherein the vaccine or toleragen is co-expressed as a fusion protein with proteins or peptides, which target binding to epithelial cells.
(106) Subunit Vaccines or Toleragens Containing a Peptide Segment, or Concatemers of Homologous Peptide Segments, or Concatemers of Heterologous Peptide Segments Co-Expressed with Proteins which Function as Adjuvants or Co-Stimulatory Molecules
(107) The present invention also encompasses concatemers and/or peptide segments that are co-expressed with proteins that function as adjuvants or co-stimulatory molecules. Essentially any vaccine or toleragen can be co-expressed as a fusion protein with proteins or peptides which can function as adjuvants. For example, the adjuvant, E. coli heat labile toxin, can be co-expressed with any vaccine or toleragen. For example, the co-stimulatory molecule CD40 can be co-expressed with any vaccine or toleragen. As another example, the cytokine, IL-2, can be co-expressed with any vaccine or toleragen.
(108) The present invention also encompasses mutants of the concatemers and/or peptide segments that are co-expressed with proteins that function as adjuvants or co-stimulatory molecules. The mutants include:
(109) a) amino acid changes at specific residues in the original protein sequence which might change the stability of the protein, change the solubility of the protein, change the glycosylation of the protein, or change the phosphorylation of the protein.
(110) b) conserved amino acid changes at specific residues in the original protein sequence to construct similar, but distinct proteins (e.g. a change from glutamic acid to aspartic acid).
(111) c) non-conserved amino acid changes at specific residues in the original protein sequence to construct similar, but distinct proteins (e.g. a change from glutamic acid to glutamine).
(112) Soybean Formulations for Soybean Based Vaccines and Adjuvants in Humans and Animals
(113) After transformation, selection and growth of the transgenic soybeans containing any of the above discussed embodiments, one can collect the soybeans and process the soybeans for consumption. The soy formulations can be prepared in the following forms:
(114) Soy Protein Powder Formulations:
(115) 1) In the soy protein powder formulation, the formulation involves a process wherein one grinds soybeans, extracts lipids, oils, and carbohydrates using known extractants leaving the soy protein containing the particular antigen or adjuvant of interest (for extracting lipids, oils, and carbohydrates from a solution, see, for example, http://www.fao.org/docrep/t0532e/t0532e04.htm visited on Oct. 12, 2005). Then one dries the soy protein powder using any of a known drying techniques (e.g., rotary evaporation or lyophillization). The optimization of the process for this formulation into soy protein powder of each antigen or adjuvant for human or animal consumption is within the purview of those of skill in the art and should take into account the following factors: a) the stability of antigen or adjuvant b) the suitability for consumption of soy protein powder by humans or animals c) the geographic location for vaccine administration (e.g., third world versus developed countries) which might affect the availability of electricity, storage considerations (e.g., refrigeration), or technical knowledge of the individuals expected to utilize the formulation.
Soy Milk Formulations:
(116) 1) In the soy milk formulation, this process involves grinding soybeans into a powder, solubilizing soy beans in an aqueous suspension containing the particular antigen or adjuvant, and treating the suspension in a manner (e.g. heating) which makes it compatible for human and/or animal consumption. Optionally, the suspension is pressed through a filter and the soy milk is collected in a vessel, which may or may not contain adjuvant. The optimization process of the generating soy milk is within the purview of one of skill in the art. The person of skill in the art in the process for formulation into soy milk of each antigen or adjuvant for human or animal consumption should take into account: a) the stability of antigen or adjuvant b) the suitability for consumption of soy protein powder by humans or animals c) the geographic location for vaccine administration (e.g. third world versus developed countries) which might affect availability of electricity, storage considerations, or technical knowledge of the individuals expected to utilize the formulation.
Dehydrated Soybeans
(117) 1) In the dehydrated soybean formulation, the soybeans follow known dehydration procedures such as rotary evaporating the soy milk or lyophillization procedures, which are well within the purview of those of skill in the art. All of these processes must be performed under GFP conditions if human use is intended.
(118) Human, Veterinary, Agricultural, and Wildlife Applications of Soybean Based Vaccines and Adjuvants
(119) As was discussed briefly above, the soy formulations of the instant invention can be used in a plurality of animals including but not limited to humans and other primates, to veterinary uses such as uses in dogs, cats, horses, and/or birds, in agricultural animals including but not limited to cattle, pigs, sheep, horses (donkeys, mules), goats, chickens, ducks, fish (catfish, trout), and for wildlife including but not limited to deer, elk, moose, waterfowl (ducks, geese), birds (blackbirds), and/or fish.
(120) The soybean formulations that are used for the above enumerated animals can be in the form of Protein Subunit vaccines, which serve a plurality of functions including but not limited to viral vaccines, bacterial vaccines, fungal vaccines, parasite vaccines, prion vaccines, microbial Toxin vaccines, zoonotic disease vaccines to treat wildlife (i.e., rabies vaccine for raccoons, foxes, skunks), anti-vector vaccines to target mosquitoes, ticks, fleas, which spread disease, plant toxin vaccines (i.e., Ricin), cancer vaccines, and/or mutant self protein vaccines (heterologous chromosomal expression).
(121) The soybean formulations that are used for the above enumerated animals can also be in the form of Protein Subunit toleragens (desensitization antigens and autoimmune antigens), which can be used to treat individuals against a number of allergens, including but not limited to plant allergens (e.g., pollen), invertebrate allergens (e.g., dust mite allergens), microbial allergens (e.g., mold spore allergens), or for Fc receptor for IgE molecules on mast cells and basophils.
(122) The soybean formulations that are used for the above enumerated animals can also be in the form of protein subunit self-antigens including but not limited to thyroid antigens targeted to combat hyperthyroidism, agonist sites of growth hormone receptors to treat dwarf/stunted growth syndrome or for example, to make farm animals grow bigger, for antagonist sites of addiction receptors, for IgE molecule as an immunogen to prevent all allergies, for prostate antigens to combat prostatitis, and or for any organ that a surgeon routinely takes out due to inflammation or dysfunction.
(123) The soybean formulations that are used for the above enumerated animals can also be in the form of protein Subunit adjuvants, co-stimulatory molecules, and/or cytokines.
(124) The soybean formulations of the instant invention have uses as vaccines for third world countries that would not be pursued for commercialization by companies due to the limited potential for profits.
(125) The soybean formulations that are used for the above enumerated animals can also be in the form of oral contraceptive vaccines including but not limited to vaccines which target self proteins necessary for completion of the reproductive cycle. (e.g., LHRH, FSH, sperm antigens and oocyte zona pellucida antigens). The formulation can be used to sterilize farm animals by vaccinating against self proteins (e.g., testicular antigens, ovarian antigens). Moreover, the soybean formulations of the present invention can be used for food supplements, in addition to the desired vaccine effect.
(126) Military Applications for Soybean Based Vaccines and Adjuvants
(127) The soybean formulations that are used in the above enumerated animals can also be used for vaccines which can be stockpiled for long periods of time (i.e., in soybeans) for a wide variety of vaccines against known agents of bio-terrorism (e.g., for smallpox, anthrax, etc.). This would limit threat and possible use by terrorists if the terrorists knew of the existence of such vaccine stockpiles.
(128) The soybean formulations of the instant invention have a plurality of advantages that are discussed throughout this disclosure (for example cost). One other advantage is the fact that the storage of soybean seeds containing a desired antigen or toleragen can be done for prolonged periods of time (and eliminate the needs for refrigeration or any cold chain needed during its manufacture). Soybeans can also be grown in regulated greenhouses (versus outdoors), which will increase the number of generations that can be grown within the year, and also contain the GMOs (genetically modified organisms).
(129) In one example, the strategy stimulates protective memory T helper lymphocyte and memory B lymphocyte activity, coupled with an alternative strategy to stimulate protective memory T helper lymphocyte and memory Cytotoxic T lymphocyte activity.
(130) Having described the uses of the instant invention in general, the following passages look at specific embodiments that flush out these general uses. In a first embodiment, a strategy for development of two different oral vaccines against Hepatitis A virus is given:
(131) Development of a Vaccine to Stimulate a Memory T Helper Lymphocyte Response, and Mucosal IgA and Systemic IgG Antibodies (and Memory B Lymphocytes) Against the Surface Antigens of Hepatitis A.
(132) A subunit immunogen is encoded by a synthetic gene optimized for expression in soybean expressing the complete coding region for Hepatitis A structural (capsid) protein, which is given below in the amino acid one letter code.
(133) TABLE-US-00002 SEQIDNO:52 MRPRPILLLLLMFLPMLPAPPPGQPSGRRRGRRSGGSGGGFWGDRVDS QPFAIPHIHPTNPFAPDVTAAAGAGPRVRQPARPLGSAWRDQAQRPAA TSRRRPTTAGAAPLTAVAPAHDTPPVPDVDSRGAILRRQYNLSTSPLT SPVATGTNLVLYAAPLSPLLPLQDGTNTHIMATEASNYAQYRVARATI RYRPLVPNAVGGYAISISFWPQTTTTPTSVDMNSITSTDVRILVQPGI ASELVIPSERLHYRNQGWRSVETSGVAEEEATSGLVMLCIHGLPVNSY TNTPYTGALGLLDFALEFEFRNLTPGNTNTRVSRYSSTARHRLRRGAD GTAELTTTAATRFMKDLYFTSTNGVGEIGRGIALTLFNLADTLLGGLP TELISSAGGQLFYSRPVVSANGEPTVKLYTSVENAQQDKGIAIPHDID LGESRVVIQDYDNQHEQDRPTPSPAPSRPFSVLRANDVLWLSLTAAEY DQSTYGSSTGPVYVSDSVTLVNVATGAQAVARSLDWTKVTLDGRPLST IQQYSKTFFVLPLRGKLSFWEAGTTKAGYPYNYNTTASDQLLIENAAG HRVAISTYTTSLGAGPVAISAVAVLAPHSALALLEDTMDYPARAHTFD DFCPECRPLGLQGCAFQSTVAELQRLKMKVGKTREL
(134) The gene encoding the above Hepatitis A structural (capsid) protein is synthesized using a nucleotide synthesizer. The inventors note that a plurality of possible nucleotide sequence will give the above amino acid sequence. Thus, it is contemplated and within the scope of the present invention to include any of these nucleotide sequences as the sequence that is exogenously expressed in soybean plants. Likewise, it is contemplated and within the scope of the instant invention to include any site directed mutant of the above sequence as an exogenous gene that is incorporated into soybeans. It is noted that conservative amino acid substitutions are preferred for mutants, with one amino acid substitution being preferred, or one deletion or one addition being the preferred mutants. However, it is contemplated that multiple site directed substitutions can be employed, with conservative amino acid substitutions for all of these multiple amino acids being a preferred embodiment. Preferably, any of these mutants should have 90% or more of the above sequence conserved, more preferably 95% or more of the above sequence conserved, even more preferably 98% or more of the above sequence conserved, and most preferably only one amino acid changed.
(135) After the gene is synthesized, it is incorporated into an expression vector (generally cloned into a binary vector which is transferred into Agrobacterium). Soybean plants are transformed with the expression vector and selected transformants expanded.
(136) The transformed soybeans expressing the Hepatitis A structural (capsid) polyprotein are processed to soy protein powder or soymilk for consumption. Although the vaccine is described with reference to humans, it should be understood by those of skill in the art that these vaccines are also readily available to be used by veterinarians for the treatment of animals. Moreover, putative uses for the transgenic soybean products of the instant will be discussed in some detail below.
(137) The soy formulation is combined with an adjuvant (for example, mutant, E. coli heat labile toxin, LT, which is described later) and used for oral vaccine against Hepatitis A. This vaccine targets the development of memory T helper cells and memory B lymphocytes at mucosal and systemic sites. However, it is noted that although an adjuvant greatly enhances the effect that an antigen (for example, the Hepatitis A structural (capsid) protein) has at generating an immune response, it is contemplated and therefore, within the scope of the invention that an adjuvant not be used (although incorporating an adjuvant is the preferred embodiment).
(138) The advantages of employing the above vaccine system over those that are known in the art include that the present system:
(139) 1) Does not require needles, therefore no danger of needle-associated transmission of diseases.
(140) 2) Induces an IgA response. No current vaccine induces an IgA response. Since Hepatitis A enters via a fecal-oral route, this IgA response in the gut could prevent virus from entering the circulatory system. Present vaccines only produce IgG in blood, and therefore rely on viral neutralization after the virus has already entered.
(141) 3) Should be useful for children under the age of 2. Current vaccines are not licensed for children under 2 years of age. Because of the well known safety of soy products, the safety of an oral vaccine could extend the age range eligible for vaccination.
(142) 4) Is inexpensive. Current vaccines are too expensive to prevent most of the 1.5 million cases of hepatitis A in the world today.
(143) Development of a Vaccine to Stimulate T Helper and Cytotoxic T Lymphocyte Responses Against Internal Antigens of Hepatitis A.
(144) In another embodiment, the subunit immunogen is encoded by a synthetic gene optimized for expression in soybean expressing the complete coding region for Hepatitis A non-structural protein:
(145) TABLE-US-00003 SEQIDNO:53 MEAHQFIKAPGITTAIEQAALAAANSALANAVVVRPFLSHQQIEILIN LMQPRQLVFRPEVFWNHPIQRVIHNELELYCRARSGRCLEIGAHPRSI NDNPNVVHRCFLRPVGRDVQRWYTAPTRGPAANCRRSALRGLSAADRT YCFDGFSGCNFPAETGIALYSLHDMSPSDVAEAMFRIIGMTRLYAALH LPPEVLLPPGTYRTASYLLIHDGRRVVVTYEGDTSAGYNHDVSNLRSW IRTTKVTGDHPLVIERVRAIGCHFVLLLTAAPEPSPMPYVPYPRSTEV YVRSIFGPGGTPSLFPTSCSTKSTFHAVPAHIWDRLMLFGATLDDQAF CCSRLMTYLRGISYKVTVGTLVANEGWNASEDALTAVITAAYLTICHQ RYLRTQAISKGMRRLEREHAQKFITRLYSWLFEKSGRDYIPGRQLEFY AQCRRWLSAGFHLDPRVLVFDESAPCHCRTAIRKAVSKFCCFMKWLGQ ECTCFLQPAEGAAGDQGHDNEAYEGSDVDPAESAISDISGSYVVPGTA LQPLYQALDLPAEIVARAGRLTATVKVSQVDGRIDCETLLGNKTFRTS FVDGAVLETNGPERHNLSFDASQSTMAAGPFSLTYAASAAGLEVRYVA AGLDHRAVFAPGVSPRSAPGEVTAFCSALYRFNREAQRHALTGNFWFH PEGLLGLFAPFSPGHVWESANPFCGESTLYTRTWSEVDAVSSPARPDL GFASEPSIPSRAATPTPAALQPSSAPDPFPPPSAPALGEPAPGVTAVA PAITHQTARHRRLLFTYPDGSKVFAGSLFESTCTWLVNASNVDHRPGG GLCHAFYQRYPTSFDAASFVMRDGAAAYTLTPRPIIHAVAPDYRLEHN PKRLEAAYRETCSRLGTAAYPLLGTGIYQVPIGPSFDAWERNHRPGDE LYLPELAARWFEANRPACPTLTITEDAARTANLAIELDSATDVGRACA GCRVTPGVVQYQFTAGVPGSGKSRSITQADVDVVVVPTRELRNAWRRR GFAAFTPHTAARVTQGRRVVIDEAPSLPPHLLLLHMQRAATVHLLGDP NQIPAIDFEHAGLVPAIRPDLAPTSWWHVTHRCPADVCELIRGAYPMI QTTSRVLRSLFWGEPAVGQKLVFTQAAKAANPGSVTVHEAQGATYTET TIIATADARGLIQSSRAHAIVALTRHTEKCVHDAPGLLREVGISDAIV NNFFLAGGEIGHQRPSVIPRGNPDTNVDTLAAFPPSCQISAFHQLAEE LGHRPAPVAAVLPPCPELEQGLLYLPQELTTCDSVVTFELTDIVHCRM AAPSQRKAVLSTLVGRYGRRTKLYNASHSDVRDSLARFIPTIGPVQVT TCELYELVEAMVEKGQDGSAVLELDLCNRDVSRITFFQKDCNKFTTGE TIAHGKVGQGISAWSKTFCALFGPWFRAIEKAILALLPQGVFYGDAFD DTVFSAAVAAAKASMVFENDFSEFDSTQNNFSLGLECAIMEECGMPQW LIRLYHLIRSAWILQAPKESLRGFWKKHSGEPGTLLWNTVWNMAVITH CYDFRDLQVAAFKGDDSIVLCSEYRQSPGAAVLIAGCGLKLKVDFRPI GLYAGVVVAPGLGALPDVVRFAGRLTEKNWGPGPERAEQLRLAVSDFL RKLTNVAQMCVDVVSRVYGVSPGLVHNLIGMLQTVADGKAHFTESVKP VLDLTNSILCRVE
(146) As described above for the Hepatitis A structural (capsid) protein, the gene encoding the above Hepatitis A non-structural protein is synthesized using a nucleotide synthesizer. The inventors note that a plurality of possible nucleotide sequence will give the above amino acid sequence. Thus, it is contemplated and within the scope of the present invention to include any of these nucleotide sequences as the sequence that is exogenously expressed in soybean plants. Likewise, it is contemplated and within the scope of the instant invention to include any site directed mutant of the above sequence as an exogenous gene that is incorporated into soybeans. It is noted that conservative amino acid substitutions are preferred for mutants, with one amino acid substitution being preferred, or one deletion or one addition being the preferred mutants. However, it is contemplated that multiple site directed substitutions can be employed, with conservative amino acid substitutions for all of these multiple amino acids being a preferred embodiment. Preferably, any of these mutants should have 90% or more of the above sequence conserved, more preferably 95% or more of the above sequence conserved, even more preferably 98% or more of the above sequence conserved, and most preferably only one amino acid changed.
(147) After the gene is synthesized, it is incorporated into an expression vector (generally a binary vector which is transferred into Agrobacterium). Soybean plants are transformed with the expression vector and selected transformants expanded.
(148) The Transformed soybeans expressing the structural polyprotein are processed to soy protein powder or soymilk for consumption.
(149) As described above, the soy formulation is combined with an adjuvant (e.g. mutant LT) and used for oral vaccine against Hepatitis A. This vaccine targets the development of memory T helper cells and memory Cytotoxic T lymphocytes at mucosal and systemic sites. As with the Hepatitis A structural (capsid) protein, this methodology has advantages, some of which include:
(150) 1) Needles are not required. Accordingly, there is no danger of needle-associated transmission of diseases.
(151) 2) No current vaccine has been shown to induce a cytotoxic T lymphocyte response against Hepatitis A. Since Hepatitis A enters via a fecal-oral route, and then infects intestinal epithelial cells, the most efficient method for killing these virally infected cells is through the induction of memory cytotoxic T lymphocytes. Present vaccines only produce IgG in blood, and therefore rely on viral neutralization after virus has already entered.
(152) 3) Once a hepatocyte is infected, the infected liver cell must be killed by the immune response so that it does not become a viral factory, producing Hepatitis A to infect other hepatocytes. The induction of a cytotoxic T lymphocyte memory response would allow for such cellular clearance of virally infected cells. Present vaccines only produce IgG in blood, and therefore rely on viral neutralization after virus has already entered.
(153) 4) Current vaccines are not licensed for children under 2 years of age. Accordingly, the present invention is advantageous in that the safety of an oral vaccine extends the age range eligible for vaccination.
(154) 5) The vaccine is inexpensive. Current vaccines are too expensive to prevent most of the 1.5 million cases in the world today.
(155) The nucleotide sequences for Hepatitis A proteins can be found in Rizzetto, M., Purcell, R. H., Gerin, J. L. and Verme, G. (Eds.); Viral Hepatitis And Liver Disease: 313-316; Edizioni Minerva Medica, Torino (1997), which is herein incorporated in its entirety by reference.
(156) Thus, the above proposed methods are a novel common strategy for vaccine development against a variety of microbes. Mucosal and systemic antibody (memory B cell) responses are targeted to the outer proteins (e.g. capsid proteins) of a microbe following expression of these antigens in soybeans. Antibodies bind to the surface of the microbe and prevent binding to cells or target the microbe for destruction by the immune response. It is contemplated and therefore within the scope of the invention that a concomitant (or separate) immunization strategy uses internal proteins (e.g. nonstructural proteins) of a microbe to target development of a memory cytotoxic T lymphocyte response. In this manner, infected cells present these epitopes to Cytotoxic T lymphocytes, which are then targeted for lysis.
(157) Although the above general method is described for hepatitis A proteins and their associated proteins, it should be understood that the above described method is a general method that can apply to a plurality of other viral diseases and their associated proteins. Other viral diseases and their potential targets for memory T helper cell, memory B lymphocyte, and memory Cytotoxic T lymphocyte responses are given in the below Table 2. Moreover, the availability of the sequences for these proteins and/or nucleotide sequences are given below the table.
(158) TABLE-US-00004 TABLE 2 Possible Possible Protein Possible Protein target for Protein target target Memory for Memory T for Cytotoxic helper cell Memory B T cell Viral disease Pathogen response cell response response AIDS HIV gp120 & gp41 gp120 & Gag & RT Gag & RT gp41 SARS SARS Spike Spike nucleocapsid Coronavirus glycoprotein glycoprotein nucleocapsid Genital HSV-2 gB and gD gB and gD Scaffolding herpes scaffolding proteins proteins Smallpox Smallpox Membrane Membrane Core virus protein protein proteins Core proteins Encephalitis Western nsProtein 1-4 Envelope nsProtein 1-4 Equine spike proteins spike encephalitis proteins
(159) One HIV strain protein and/or DNA sequence(s) is described in Fang et al., Recombination following Superinfection by HIV-1, AIDS, 18 (2), 153-159 (2004), which is herein incorporated in its entirety by reference.
(160) The SARS Coronavirus protein and/or DNA sequence(s) is described in He et al., Analysis of multimerization of the SARS coronavirus nucleocapsid protein, Biochem. Biophys. Res. Commun. 316 (2), 476-483 (2004), which is herein incorporated in its entirety by reference.
(161) The Herpes simplex 2 protein and/or DNA sequence(s) is described in McGeoch et al., DNA sequence and genetic content of the HindIII 1 region in the short unique component of the herpes simplex virus type 2 genome: identification of the gene encoding glycoprotein G, and evolutionary comparisons, J. Gen. Virol. 68 (PT 1), 19-38 (1987), which is herein incorporated in its entirety by reference.
(162) The smallpox sequence is not published due to accessibility to terrorists. However, the sequences can be readily obtained by those who need them for legitimate research purposes.
(163) The West Equine Encephalitis protein and/or DNA sequence(s) is described by Netolitzky et al., which involved a direct submission on 8 Dec. 1999 to the Medical Countermeasures Section, Defence Research Establishment Suffield, P.O. Box 4000, Stn Main, Medicine Hat, Alberta T1A 8K6, Canada. All of the above references are incorporated in their entirety by reference.
(164) Other possible subunit vaccines include polio and human ETEC toxins.
(165) Thus, with the above description, it should be apparent that the above described protocol for generating subunit vaccines using higher plants, and in particular, soybeans is a generic method that can be employed on any of a plurality of immunogens associated with viral diseases.
(166) Likewise, similar methodology can be applied on bacterial disease related proteins. One example of an overall strategy to develop oral vaccines that stimulate protective memory T helper lymphocyte and memory B lymphocyte activity against mutant bacterial toxins is given below.
(167) Those of skill in the art will recognize that genes encoding mutant toxins are synthesized to encode proteins which do not have toxicity but still retain their ability to stimulate a protective response against the native toxin. Typically, at least two separate point mutations are made in the mutant toxin. A particular example is given using Staphylococcus Enterotoxin B (SEB) as a prototype, but it should be understood by those of skill in the art that the following protocol is a generic method that can be employed for a plurality of bacterial diseases proteins.
(168) Strategy for Development of an Oral Vaccine Against Mutant Staphylococcus Enterotoxin B (SEB)
(169) The following describes a general protocol for the development of a vaccine to stimulate a memory T helper lymphocyte response, and mucosal IgA and systemic IgG antibodies (and memory B lymphocytes) against mutant Staphylococcus Enterotoxin B (SEB). A more detailed protocol occurs further below. This general procedure is presented to show that the method of incorporating the exogenous gene and expressing bacterial related immunogens is a generic procedure that can be adapted to use any of a plurality of these bacterial related immunogens.
(170) In an exemplary embodiment, a version of mutant SEB is constructed by a gene synthesizer and incorporated into a higher plant (for example, into soybeans). The soybean plants are transformed and selected transformants expanded. The transformed soybeans expressing this mutant SEB is processed to soy protein powder or soymilk for consumption. The soy formulations are combined with an adjuvant (e.g. mutant LT) and used for oral vaccine against mutant SEB. Although the preferred embodiment uses an adjuvant, it should be understood by those of skill in the art that the present invention encompasses embodiments wherein no adjuvant is used.
(171) Vaccine Targeting the Development of Memory T Helper Cells and Memory B Lymphocytes at Mucosal and Systemic Sites
(172) The vaccine, as described above, targets the development of memory T helper cells and memory B lymphocytes at mucosal and systemic sites. This provides several advantages over the vaccines that are currently in use. These advantages include:
(173) 1) There is no need for the use of needles, and therefore there is no danger of needle-associated transmission of diseases.
(174) 2) There is no current vaccine for SEB. Thus, the transgenic soybeans of the instant invention provide a vaccine for SEB that does not exist.
(175) It was noted above that the above process is a generic process that can accommodate a plurality of bacterial related disease. Additional examples of vaccines against mutant bacterial toxins are included in table 3 below.
(176) TABLE-US-00005 TABLE 3 Additional information or Mutant Toxin sequence location E. coli heat labile toxin Synthetic gene optimized for (also know as LT adjuvant) expression in soybean has been made in soy plants and transformed Bacillus anthracis toxins Toxin sequences are sequestered PA toxin from PUBMED due to LF toxin potential for terrorism, but are available EF toxin Clostridium tetani exotoxins Toxin sequences are sequestered from PUBMED but are known Clostridium botulinum toxin Toxin sequences are sequestered from PUBMED but are known
Development of a Vaccine to Stimulate a Memory T Helper Lymphocyte Response, and Mucosal IgA and Systemic IgG Antibodies (and Memory B Lymphocytes) Against the Surface Antigens of Enteropathogenic E. Coli, FanC
(177) In an exemplary embodiment, a version of a subunit immunogen is encoded by a synthetic gene optimized for expression in soybean gene expressing the complete coding region for FanC. Soybean plants are transformed and the selected transformants expanded. The transformed soybeans expressing this surface antigen are processed to soy protein powder or soymilk for consumption. The soy formulation is combined with an adjuvant (e.g., mutant E. coli heat labile toxin, LT) and used as an oral vaccine against E. coli infection. This vaccine targets the development of memory T helper cells and memory B lymphocytes at mucosal and systemic sites.
(178) Similar to the oral vaccine against mutant SEB, the transgenic soybean containing FanC has similar advantages, such as:
(179) 1) There is no need for needles and therefore, there is no danger of needle-associated transmission of diseases.
(180) 2) There are no current vaccines that induce an IgA response against FanC. Thus, this is the first vaccine against FanC.
(181) 3) The current vaccines are more expensive and therefore are not used for agriculture purposes as often as they could be.
(182) The above protocol describes the protocol for how an oral vaccine against mutant SEB is prepared. Similarly, a general protocol is described below that shows the development of a vaccine to stimulate memory T helper lymphocyte responses against internal antigens of Mycobacterium tuberculosis.
(183) Some bacteria are not extracellular pathogens like E. coli, but are intracellular pathogens that can live inside cells (i.e. macrophages). The causative agent for tuberculosis is such a bacterium which can live and hide inside macrophages while the disease develops. An effective immune response against such an intracellular bacterium induces T helper lymphocytes to activate the macrophage response. Therefore, this embodiment of the invention discloses vaccines that combat intracellular bacteria wherein the target is a helper T lymphocyte response.
(184) As described above the requisite gene sequences are synthesized by a gene synthesizer (which is described in more detail below) and incorporated through a vector into the desired higher plant (e.g., soybean). As an example, a subunit immunogen is encoded by a synthetic gene optimized for expression in soybean that expresses Antigen 85 complex (Ag85 A-C) internal antigens expressed by mycobacterium tuberculosis (XX):
(185) The DNA and/or protein sequences for Ag85-A can be found in Cole et al., Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence, Nature 393 (6685), 537-544 (1998), which is herein incorporated in its entirety by reference. The DNA and/or protein sequences for Ag85-B can be found in Matsuo et al., Cloning and expression of the Mycobacterium bovis BCG gene for extracellular alpha antigen, J. Bacteriol. 170 (9), 3847-3854 (1988), which is herein incorporated in its entirety by reference. The DNA and/or protein sequences for Ag85-C can be found in Content et al., The genes coding for the antigen 85 complexes of Mycobacterium tuberculosis and Mycobacterium bovis BCG are members of a gene family: cloning, sequence determination, and genomic organization of the gene coding for antigen 85-C of M. tuberculosis, Infect. Immun. 59 (9), 3205-3212 (1991), which is herein incorporated in its entirety by reference.
(186) After the gene has been synthesized and incorporated into the correct vector, the soybean plants are transformed with the vector and the selected transformants are expanded. The transformed soybeans expressing the Ag85 complex is processed to soy protein powder or soymilk for consumption. The soy formulation is combined with an adjuvant (e.g. mutant LT) and used for oral vaccine against Mycobacterium tuberculosis. As above, this embodiment can be used with or without an adjuvant. However, the presence of the adjuvant is preferred. This vaccine targets the development of memory T helper cells at mucosal and systemic sites.
(187) The vaccine as described has a plurality of advantage over currently available vaccines. These include:
(188) 1) There is no need for needles, and therefore there is no danger of needle-associated transmission of diseases.
(189) 2) No current vaccine has been shown to induce an effective helper T lymphocyte response. BCG (live attenuated Mycobacterium bovis BCG) represents the only vaccine currently available against tuberculosis. It is the most widely administered of all vaccines in the WHO Expanded Programme for Immunization, bin has been estimated to prevent only 5% of all potentially vaccine preventable deaths due to TB. It has been shown to protect against disseminated and meningeal TB in young children, and to provide some protection against leprosy, but its efficacy in preventing adult pulmonary TB, which carries the major burden of morbidity and mortality from this disease, has varied dramatically in carefully conducted studies throughout the worldfrom 77% in the UK to 0% in Chingleput, India. As a result of this variability in efficacy, the impact of BCG on the global TB epidemic has been negligible. Moreover, the use of BCG vaccine is not recommended for use in the US and some northern European countries because of its low efficacy and its interference with skin test screening.
(190) Thus, it should be apparent to those of skill in the art that this general procedure to generate oral vaccines can be used on any of a plurality of bacterial related diseases, including bacterial related diseases that are not enumerated here as long as there is a target antigen that can be used. Similar to bacterial related disease, the instant invention also encompasses the development of vaccines against tumor antigens.
(191) Development of Vaccines to Stimulate a Memory T Helper Lymphocyte Responses, Memory B Lymphocyte Responses, and/or Memory Cytotoxic T Lymphocyte Responses Against Tumor Antigens
(192) The same general procedure as used for the above disclosed viral and bacterial related diseases can be used for tumor antigens. Generally, this procedure involves synthesizing the gene encoded the desired tumor antigen(s), incorporating the gene into an appropriate vector and transforming the higher plant (preferably soybean) with the vector containing the gene of interest. Mutants that have undergone site directed mutagenesis are considered to be within the scope of the present invention. Moreover, mutants that have a plurality of conservative amino acid substitutions are considered within the scope of the present invention. Preferably, these mutants should have 90% or more homology with the wild type, more preferably 95% or more of the above sequence conserved, even more preferably 98% or more of the above sequence conserved, and most preferably only one amino acid changed. The below table 4 enumerates several antigens that are known to be cancer antigens, in what type of cancer they are found, and where the DNA and/or protein sequences for these cancers can be found.
(193) TABLE-US-00006 TABLE 4 Antigen Cancer Sequence information MART-1 melanoma Kawakami et al., Cloning of the gene coding for a shared human melanoma antigen recognized by autologous T cells infiltrating into tumor, Proc. Natl. Acad. Sci. U.S.A. 91 (9), 3515-3519 (1994), which is herein incorporated in its entirety by reference PSMA Prostate Israeli et al., Molecular cloning of a complementary DNA encoding a prostate-specific membrane antigen, Cancer Res. 53 (2), 227-230 (1993), which is herein incorporated in its entirety by reference HER-2/neu Breast Coussens et al. Tyrosine kinase receptor with extensive homology to ovarian EGF receptor shares chromosomal location with neu oncogene, Science 230 (4730), 1132-1139 (1985), which is herein incorporated in its entirety by reference CEA Colon Schrewe et al., Cloning of the complete gene for carcinoembryonic adenocarcinoma antigen: analysis of its promoter indicates a region conveying cell type- specific expression, Mol. Cell. Biol. 10 (6), 2738-2748 (1990), which is herein incorporated in its entirety by reference
(194) It should be apparent to those of skill in the art that the above procedure is a generic procedure for generating vaccines that can be used on any of a plurality of tumor antigens, including those tumor antigens that are known that are not enumerated here (as well as those that are not yet known).
(195) Expression of Allergens or Autoimmune Antigens in Soybeans for Use in the Induction of Mucosal or Systemic Tolerance:
(196) The above describes using transgenic plants (in particular, soybeans) in the formation of vaccines from antigens that are related to viral related diseases, bacterial related diseases and tumor antigens. Transgenic higher plants such as soybeans containing a desired exogenous gene can also be used to induce tolerance in individuals prior to showing hypersensitive sensitivity to allergens. Prior to this invention, this prophylactic approach had not been used for the widespread prevention or treatment of allergic reactions and autoimmune diseases. Presently, immunotherapy may be used once an individual has demonstrated a significant hypersensitivity against a particular allergen or autoimmune disease. However, it has seemed impractical to suggest that one might be able to induce tolerance toward specific allergens and autoimmune antigens in individuals even before they demonstrate hypersensitivity or autoimmune disease. Thus, in another embodiment of the present invention, the widespread induction of tolerance as a viable method for preventing and/or treating the development of potentially life threatening allergic reactions or autoimmune diseases is presented. This embodiment encompasses giving soy protein powder or soy milk formulations derived from transgenic soybeans expressing allergens or autoimmune antigens to individuals prior to showing a hypersensitive reaction.
(197) As an exemplary embodiment, venom phospholipase A2 is illustrated briefly here and discussed in more detail later. Venom phospholipase A2 is one of the antigens present in stings from honey bees. The general procedure is comparable to the procedure outlined above for generating vaccines. The gene of interest (in this instance, venom phospholipase A2) is synthesized on a gene synthesizer and incorporated into an expression vector. Soybeans are transformed with the expression vector, which also contains a selection marker on the plasmid backbone. The soybeans are selected using the selection marker and grown. The soybeans can be processed into soy powder and/or soy milk for consumption. Tolerance is induced by giving small quantities a number of times to the individual. The procedure is a general procedure that can be performed on any of a plurality of allergens and or antigens that may be related to autoimmune diseases. Tables 5 and 6 list a series of the allergens and autoimmune antigens, respectively that can be performed using the above enumerated general procedure. Tables 5 and 6 also contain information as to where the DNA and/or protein sequences can be found for each of the respective allergens and autoimmune antigens.
(198) TABLE-US-00007 TABLE 5 Allergens Additional information or sequence location Ambrosia (ragweed) allergen Rogers et al., Complete sequence of the allergen Amb alpha II. Recombinant expression and reactivity with T cells from ragweed allergic patients, J. Immunol. 147 (8), 2547-2552 (1991), which is herein incorporated in its entirety by reference. Dermatophagoides (dust mite) O'Neil et al., direct submission on 30-MAY-2005 to allergen Molecular Biotechnology, Telethon Institute of Child Health Research, 100 Roberts Road, Subiaco, WA 6008, Australia Juniperus (red cedar) allergen Midoro-Horiuti et al., Identification of mutations in the genes for the pollen allergens of eastern red cedar (Juniperus virginiana), Clin. Exp. Allergy 31 (5), 771-778 (2001), which is herein incorporated in its entirety by reference. Feline (cat) allergen Leitermann et al., Cat allergen 1: Biochemical, antigenic, and allergenic properties, J. Allergy Clin. Immunol. 74 (2), 147-153 (1984), which is herein incorporated in its entirety by reference. Arachis (peanut) allergen Viquez et al., Structure and organization of the genomic clone of a major peanut allergen gene, Ara h 1, Mol. Immunol. 40 (9), 565-571 (2003), which is herein incorporated in its entirety by reference.
(199) TABLE-US-00008 TABLE 6 Autoimmune antigens Disease Additional information or sequence location acetylcholine Myasthenia Elliott et al., Comparative structure of human neuronal alpha 2- receptor gravis alpha 7 and beta 2-beta 4 nicotinic acetylcholine receptor subunits and functional expression of the alpha 2, alpha 3, alpha 4, alpha 7, beta 2, and beta 4 subunits, J. Mol. Neurosci. 7 (3), 217-228 (1996), SEQ ID NOs: 57-65. Myelin basic Multiple Roth et al., Evidence for the expression of four myelin basic protein Sclerosis protein variants in the developing human spinal cord through cDNA cloning, J. Neurosci. Res. 17 (4), 321-328 (1987), SEQ ID NOs: 66-69. Type II Arthritis Cheah et al., Identification and characterization of the human collagen type II collagen gene (COL2A1), Proc. Natl. Acad. Sci. U.S.A. 82 (9), 2555-2559 (1985), SEQ ID NO: 70.
Thus, it should be apparent to those of ordinary skill in the art that any of the above nucleotide sequences of the allergens and/or autoimmune antigens can be incorporated into soybeans, which expresses the correlated protein.
(200) In an embodiment of the invention, minor variants to the protein sequence of allergens and/or autoimmune antigens can be made. A single mutation can be made or alternatively several amino acids can be substituted. Generally, conserved amino substitutions are preferred. Moreover, the mutants should have preferably 90% or more of the wild-type sequence of the above sequence conserved, even more preferably 98% or more of the wild-type sequence conserved, and most preferably only one amino acid changed from the wild-type.
(201) Development of Vaccines to Stimulate a Memory T Helper Lymphocyte, Memory B Lymphocyte, and/or Memory Cytotoxic T Lymphocyte Mucosal and Systemic Responses Against Diseases of Animals of Agricultural Importance
(202) The same general procedure as disclosed above for preparing vaccines to viral and bacterial related diseases, tumor antigen(s) and autoimmune related diseases can also be used for developing vaccines that stimulate responses against diseases in animals of agricultural importance. The process as disclosed above should be followed. The process involves incorporating the gene of interest (after synthesis) into an appropriate vector and transforming the higher plant (preferably soybean) with the vector containing the gene of interest. The transformed soybeans are selected, grown and then collected. The soybean in a purified or unpurified form can be fed to animals in a single dose or in multiple doses to stimulate the desired response.
(203) A series of antigens are known that are important in these animal related diseases and are thus the target of the instant invention. One of skill in the art should note that mutants that have undergone site directed mutagenesis are considered to be within the scope of the present invention. Moreover, mutants that have a plurality of conservative amino acid substitutions are considered within the scope of the present invention. Preferably, these mutants should have 90% or more homology with the wild type, more preferably 95% or more of the above sequence conserved, even more preferably 98% or more of the above sequence conserved, and most preferably only one amino acid changed. Table 7 enumerates several antigens and the microbes that contain the antigen, and where the DNA and/or protein sequences for these antigens can be found.
(204) TABLE-US-00009 TABLE 7 Antigen Microbe Sequence information and comments Envelope Bovine viral Colett et al. Molecular cloning and nucleotide sequence of the pestivirus glycoprotein diarrhea virus bovine viral diarrhea virus, Virology 165 (1), 191-199 (1988), which is E1 and E2 (BVDV) herein incorporated in its entirety by reference. Vaccine targets mucosal IgA, memory B cell, and T helper cell responses Capsid Bovine viral Colett et al. Molecular cloning and nucleotide sequence of the pestivirus protein diarrhea virus bovine viral diarrhea virus, Virology 165 (1), 191-199 (1988), which is herein incorporated in its entirety by reference. Vaccine targets memory cytotoxic T and T helper cell responses Envelope Equine Holloway et al., Identification, sequence analysis and characterization glycoprotein B herpesvirus of equine herpesvirus 5 glycoprotein B, Arch. Virol. 144 (2), 287-307 (1999), which is herein incorporated in its entirety by reference. Vaccine targets mucosal IgA, memory B cell, and T helper cell responses Capsid Equine Telford et al., The DNA sequence of equine herpesvirus-1, Virology protein herpesvirus 189 (1), 304-316 (1992), which is herein incorporated in its entirety by reference. vaccine targets memory cytotoxic T and T helper cell responses FanC E. coli See above and below in the instant written description Fimbrae Pasteurella Saad et al. Direct Submission on 21-OCT-2004 to Pathology and Microbiology Veterinary, Faculty of Veterinary Medicine, Universiti Putra Malaysia, Seri Kembangan, Selangor 434000, Malaysia vaccine targets mucosal IgA, memory B cell, and T helper cell responses leukotoxoid Pasteurella Lo et al., Nucleotide sequence of the leukotoxin genes of Pasteurella haemolytica A1, Infect. Immun. 55 (9), 1987-1996 (1987), which is herein incorporated in its entirety by reference. Vaccine targets systemic IgG, memory B cell, and T helper cell responses V1hA family Mycoplasma Papazisi et al., The complete genome sequence of the avian pathogen Mycoplasma gallisepticum strain R(low), Microbiology (Reading, Engl.) 149 (Pt 9), 2307-2316 (2003), which is herein incorporated in its entirety by reference. vaccine targets memory cytotoxic T and T helper cell responses
Thus, using the above described process of gene synthesis, exogenous gene incorporation into soybeans, selecting transformed soybeans, growing and collecting the soybeans, one can treat BVDV. BVDV has a high prevalence in the cattle population. Currently, it is mandatory that BVDV vaccination be done to decrease potential losses due to BVDV infection. The use of killed or modified-live vaccines is the method currently used and can provide protection by decreasing the consequences of acute infections. However, it is questionable whether killed or modified-live vaccines provide complete fetal protection from the development of in utero fetal infections. Moreover, the vaccine of the present invention will put less stress on cattle because the cattle can simply eat the soybeans rather than having to receive vaccinations.
(205) Likewise, the above described methodology for BVDV can be used for Equine herpesvirus. An inactivated carbomer-adjuvated EHV-1/EHV-4 vaccine (DUVAXYN) is a currently used vaccine. This vaccine has had its efficacy tested for reducing abortions caused by EHV-1 in a small group of mares. Pregnant mares were vaccinated 3 times during pregnancy and control mares were left unvaccinated. At 4 weeks after the third vaccination, the mares were exposed to a strain of EHV-1 that is known to cause abortions in pregnant mares. All of the control mares aborted between days 15 and 16 post infection. Of the vaccinated mares, 20% aborted and 80% maintained their pregnancies and delivered healthy foals. Thus, it was concluded that an inactivated, adjuvant vaccine based on EHV-1 and EHV-4 antigens was safe for pregnant mares and significantly reduces the incidence of EHV-1 induced abortions. The vaccine of the present invention will put less stress on cattle because the cattle can simply eat the soybeans rather than having to receive vaccinations.
(206) Similarly, the above described methodology can be used for Pasteurella. The Pasteurella bacteria, even though they all are derived from the same species, are not all the same. It is know that there are as many as 15 different strains of Pasteurella haemolytica. Thus, a vaccine made with one strain does not always protect against other strains. For these reasons, the popularity of Pasteurella vaccines has decreased in recent years. However, farmers in a particular region may find a Pasteurella vaccine that works for the strain that is in their particular area and use it. The vaccines are currently manufactured with killed bacteria. At least two live avirulent REPLICATING Pasteurella vaccines are on the market. However, objections to their use generally include: 1) high cost; 2) adverse reactions which include injection site pain, swelling or abscesses, and muscle stiffness; 3) the administration of antibiotics or sulfa drugs at the same time as vaccination is thought to kill the live vaccine organisms and cause vaccination failure; and 4) in one case, the vaccine was recommended only for use in calves over three months of age. Since many shipped cattle are routinely administered antibacterial drugs on arrival, the use of these particular vaccines in recently shipped cattle has been questioned. Thus, it should be apparent to those of ordinary skill in the art that the instant invention using transgenic soybeans that have expressed the Pasteurella antigen has many advantages over the vaccines in current use. The cost is less, the cattle do not suffer from adverse reactions from injections (because the vaccine is eaten), and a dosage can be prepared that is very high (still inexpensively) so that even if cattle are treated with antibiotics or sulfa drugs, the vaccine may still be effective. Moreover, cattle younger than 3 months can likely be treated.
(207) Similar to the above-enumerated cattle diseases, Mycoplasma, which affects chickens can also be treated. Mycoplasma infections are intracellular infections and, therefore one must target cell mediated immunity. Mycoplasma infection is a major cause of production loss in chickens all around the world. The currently available vaccines partially protect breeder chickens from clinical disease, but do not eliminate the pathogen. The extensive use of antibiotics has lead to severe resistance problems and utmost care must be given to select the right antibiotic to ensure a successful treatment.
(208) Development of Oral Contraceptive Vaccines for Animals of Agricultural Importance, Pets, and for Wildlife
(209) The above enumerated methods for generating vaccines can also be used in the development of oral contraceptives for animals of agricultural importance, pets and for wildlife. One instance where this might apply is in a given deer population wherein the deer population in a given location is too high. By feeding deer transgenic soybeans that have an antigen that functions as an oral contraceptive, the deer population can be reduced preventing a plurality of problems (such as loss of crops due to mastication by large deer populations, large deer die-offs in the winter, etc.). In this embodiment of the invention, a subunit immunogen will be encoded by a synthetic gene optimized for expression in soybean expressing the complete coding region for proteins expressed on sperm or eggs that are necessary for gametogenesis or fertilization.
(210) The general method involves transforming the Soybean plants, selecting the transformed soybeans, and then expanding the selected transformants. The selected transformants are grown and collected. The Transformed soybeans expressing this protein are processed so they are used as seeds or processed to soy powder, or alternatively, they are left unprocessed. The processed or unprocessed transgenic soybeans can then be fed to animals and used as an oral contraceptive. Alternatively, the soy formulation can be combined with adjuvant seeds or soy powder (e.g. mutant E. coli heat labile toxin, LT) and used with seeds or powder expressing antigen. The vaccine targets the development of memory T helper cells and memory B lymphocytes at systemic sites.
(211) The normal, cellular prion protein (PrP.sup.C) is encoded by the PRNP gene and is found within cells in the central nervous system. However, a variant form of the prion protein referred to as abnormal, scrapie prion (PrP.sup.Sc) can transmit prion-mediated diseases when consumed.
(212) Bovine Spongiform Encephalopathy and Chronic Wasting disease are prion diseases of cattle and free range ruminants (e.g., elk and deer), respectively. It is thought that these diseases are transmitted by eating feed containing prion proteins which can cause disease. Since humans consume these animals, there have been some reports of spread of prion-related diseases following consumption of contaminated meat. The neurological disease which humans get following consumption of contaminated meat is called Variant Creutzfeldt-Jakob Disease. It is thought that approximately 155 humans in the United Kingdom have presented with this disease.
(213) Some investigators have used parenteral immunizations of mice with prion proteins to limit development of prion-like disease in rodent models. However, it is not clear how practical such immunizations would be for wildlife (e.g., elk and deer) since delivery to such animals would be a significant problem. Furthermore, since only a small percentage of cattle (>1%) contract prion related diseases, the cost-effectiveness of such widespread vaccinations would be questioned. An advantage of a soybean-based vaccine against abnormal prion proteins is the ability to deliver vaccine to wildlife or agricultural animals in a cost-effective manner.
(214) Having described the general process and a background of prion based diseases, the following table 8 discloses the antigens and a prion protein that can be expressed by the above method as well as where the gene sequences can be found.
(215) TABLE-US-00010 TABLE 8 Antigen Sequence information and comments Gonadotrophin Wu, S. L., Direct Submission on 29-OCT-1997 to Department of Biochemistry, releasing hormone China Medical College, 91 Hsueh-Shih Road, Taichung, Taiwan 404, R.O.C. (as appears in pig) vaccine targets systemic IgG, memory B cell, and T helper cell responses Zona pellucida Yonezawa, et al., Molecular cloning of bovine zona pellucida glycoproteins ZPA proteins ZPA and and ZPB and analysis for sperm-binding component of the zona, Eur. J. Biochem. ZPB (as appears in 268 (12), 3587-3594 (2001), which is herein incorporated in its entirety by cow) reference. vaccine targets systemic IgG, memory B cell, and T helper cell responses Epididymal protease Gene sequence given at inhibitor (Eppin) (as http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nucleotide&val=61815352 appears in cow) Visited on Oct. 4, 2005. vaccine targets systemic IgG, memory B cell, and T helper cell responses Chorionic Min et al., Nucleotide sequence of eCG a-subunit cDNA and its expression in the gonadotrophin equine placenta, J. Reprod. Dev. 40, 301-305 (1994), which is herein incorporated (as appears in in its entirety by reference. horse) vaccine targets systemic IgG, memory B cell, and T helper cell responses Human prion Kretzschmar et al., Molecular cloning of a human prion protein cDNA, DNA 5 (4), protein (PrP) 315-324 (1986), which is herein incorporated in its entirety by reference.
(216) Although the above antigens in Table 8 are given for a particular species (for example, pig Gonadotrophin releasing hormone), it should be understood by those of ordinary skill in the art that other species also possess the same antigens (for example deer Gonadotrophin releasing hormone). Many of the gene sequences of these antigens are known and are thereby considered to be part of the present invention.
(217) Prophylactic Therapy Using Phospholipase A2
(218) As was mentioned above, general prophylactic therapy is within the scope of the instant invention. As a specific example of prophylactic therapy, the prevention of development of hypersensitivity to the bee venom allergen, phospholipase A2 (Api m1) in neonatal and adolescent mice is disclosed. Generally, to accomplish prophylactic therapy, an allergen can be expressed in soy protein and in soy milk which can be given orally to weanling mice to induce systemic tolerance. Specifically, one can express the bee venom allergen (phospholipase A2) in transgenic soybeans. Soy protein and soy milk preparations from these transgenic soybeans can then be given orally to weanling mice prior to sensitization. The ability to induce allergic reactions in these tolerized animals can then be assessed using the methodology described above for the mice that ingest the fanC transgenic soybeans.
(219) Insertion of Phospholipase A2 into Soybeans
(220) Hypersensitivity to hymenoptera (e.g. bee, wasp, hornet) venom in the human population has been reported to occur in approximately 1% to 5% of the population, with about 1 death per million people attributed to this allergic reaction. Interestingly, studies indicate that as many as 25% to 30% of the population are sensitized to hymenoptera venoms as indicated by the presence of detectable IgE antibodies, though most of these individuals are not classified as being hypersensitive. The risk of bee venom allergy increases with the degree of exposure, so that beekeepers are at a high risk for such hypersensitivity.
(221) In an embodiment of the instant invention, a focus on hypersensitivity to honeybee (Apis mellifera) venom can be studied, as this is the most common insect sting which results in allergic reactions. Honeybee venom is a complex mixture of proteins (Hoffman, D. R. 1996. Hymenoptera venom proteins. Adv Exp Med Biol 391:169, which is herein incorporated by reference in its entirety), however several of these proteins as major allergens can be identified. These include phospholipase A2 (Api m1), hyaluronidase (Api m2), acid phosphatase (Api m3), and melittin (Api m4), as well as other recently identified allergens (Winningham, K. M., C. D. Fitch, M. Schmidt, and D. R. Hoffman. 2004. J Allergy Clin Immunol 114:928; Tavares, B., F. Rordigues, C. Pereira, G. Loureiro, and C. Chieira. 2005. Allerg Immunol (Paris) 37:171, both of which are incorporated by reference in their entirety). In an exemplary embodiment of the present invention, one of the major allergens in honeybee venom, phospholipase A2, can be studied. In addition to this being a major allergen, a significant amount of information about this protein and gene sequence is known. Such information includes its nucleotide sequence (Muller, U. R. 2002. Recombinant Hymenoptera venom allergens. Allergy 57:570. Moreira, L. A., J. Ito, A. Ghosh, M. Devenport, H. Zieler, E. G. Abraham, A. Crisanti, T. Nolan, F. Catteruccia, and M. Jacobs-Lorena. 2002. Bee venom phospholipase inhibits malaria parasite development in transgenic mosquitoes. J Biol Chem 277:40839, both of which are incorporated by reference in their entirety), and an enzymatically inactive mutant (H34Q) which still retains its ability to stimulate a hypersensitivity response in allergic patients (Wymann, D., C. A. Akdis, T. Blesken, M. Akdis, R. Crameri, and K. Blaser. 1998. Enzymatic activity of soluble phospholipase A2 does not affect the specific IgE, IgG4 and cytokine responses in bee sting allergy. Clin Exp Allergy 28:839, which is incorporated in its entirety by reference). In addition, a murine model for hypersensitivity to bee venom phospholipase A2 has been previously used to question the efficacy of various types of immunotherapy (Akdis et al. 1996. Epitope-specific T cell tolerance to phospholipase A2 in bee venom immunotherapy and recovery by IL-2 and IL-15 in vitro. J Clin Invest 98:1676; Astori, et al. 2000. Inducing tolerance by intranasal administration of long peptides in naive and primed CBA/J mice. J Immunol 165:3497. von Garnier, et al. 2000. Allergen-derived long peptide immunotherapy down-regulates specific IgE response and protects from anaphylaxis. Eur J Immunol 30:1638, all of which are incorporated by reference in their entireties). In the present invention, we can express the enzymatically inactive mutant of honeybee venom phospholipase A2 (H34Q) (Wymann, et al. 1998. Enzymatic activity of soluble phospholipase A2 does not affect the specific IgE, IgG4 and cytokine responses in bee sting allergy. Clin Exp Allergy 28:839, which is herein incorporated by reference in its entirety) for use as an allergen in a mouse model of hypersensitivity that has been previously described (Akdis et al. 1996. Astori, et al. 2000. von Garnier, et al. 2000).
(222) For the 1%-5% of the population that have a previous medical history of hypersensitivity to hymenoptera stings, desensitization immunotherapy is presently the only allergen-specific treatment option. For the conventional desensitization treatment, diluted bee venom (ALK Pharmalgen) is injected subcutaneously in patients beginning with a dose (less than 10 micrograms) that is unlikely to cause much of a systemic effect. Typically, this dose is used weekly for one month, followed by an increase in dose for the next several months until a maintenance dose of 100 micrograms is reached. During the next 3 to 5 years, the maintenance dose is given every 3 to 6 months. Such treatments are performed by medical personnel due to the possibility of side effects. In an effort to limit the time required for desensitization, there are also rush and ultrarush treatments where increasing doses of bee venom are given in an accelerated fashion. The risk of side effects from such accelerated desensitization therapy is significant enough that such therapy should be performed under close medical supervision (Birnbaum, et al. 2003. Hymenoptera ultra-rush venom immunotherapy (210 min): a safety study and risk factors. Clin Exp Allergy 33:58. Wenzel, et al. 2003. Safety of rush insect venom immunotherapy. The results of a retrospective study in 178 patients. Allergy 58:1176, both of which are incorporated by reference in their entireties.).
(223) Desensitization immunotherapy is an effective treatment to limit hypersensitivity reactions to bee venom in most patients who receive this treatment (Golden, et al. 1996. J Allergy Clin Immunol 97:579. Ross, et al. 2000. Clin Ther 22:351. Valentine, et al. 1990. N Engl J Med 323:1601. Hunt, et al. 1978. N Engl J Med 299:157, all of which are incorporated by reference in their entireties.). Success rates for desensitization therapy have been reported to be 75% to 85% effective for honeybee immunotherapy when a maintenance dose of 100 micrograms is reached in adults (Golden, D. B. 2005. J Allergy Clin Immunol 115:439, which is herein incorporated by reference in its entirety.). An increase to a maintenance dose of 150 to 250 micrograms of bee venom has been reported to improve efficacy for those adults not protected by 100 microgram doses (Rueff, et al. 2001. J Allergy Clin Immunol 108:1027, which is herein incorporated by reference in its entirety.).
(224) There are side effects and risks associated with this therapy despite reports of the relative safety of such immunotherapies (Golden, D. B. 2005. Birnbaum, et al. 2003, Clin Exp Allergy 33:58, which is incorporated by reference in its entirety). Side effects include: patches on the skin, itching, reddening of the skin's surface, swelling at the site of injection, raised patches on the skin at sites systemic to the injection site, inflammation of the mucosal membranes in the nose, mild or moderate difficulty in breathing, and swelling of the eyes, lips, or tongue. In a small percentage of cases, an anaphylactic reaction has been observed following immunotherapy, which included difficulty in breathing, airway obstruction, facial swelling, etc. which requires medical intervention to reverse these symptoms.
(225) The present day immunotherapy for bee venom allergy have limitations. These limitations can be summarized as follows. 1) Time. Often greater than 20 subcutaneous injections with bee venom allergen preparations (ALK, Pharmalgen) are required over a period of 3 to 5 years in order to establish and maintain the desensitized state. This requires a significant commitment by the patient to travel to an appropriate medical facility on numerous occasions over the course of several years to comply with the particular immunotherapy regimen. 2) Cost. The cost of travel to medical clinics or hospitals, the cost of medical personnel to administer the injections, and the costs of bee venom (ALK, Pharmalgen) for multiple treatments over a period of years is a significant financial commitment for immunotherapy patients. 3) Necessity for medical supervision. As noted above (Section B3), these injections must be performed under medical supervision, and ifultrarush regimens are used, close medical supervision or hospitalization has been recommended. This requirement places significant limitations on where such treatments can be performed. 4) Side effects. While the side effects associated with any single injection is low, the possibility that an individual patient may have one or more side effects during one of the numerous injections over a 3 to 5 year period increases proportionately. 5) Efficacy. Although desensitization using hymenoptera venom injection is one of the most successful applications for specific immunotherapy that is presently practiced with efficacy levels of 75% to 85% for honeybee venom therapy being reported, there is a percentage of patients wherein this therapy is not effective. An increase in the maintenance dose (150 to 250 micrograms) has been suggested in patients who are not desensitized using standard doses (100 micrograms). Furthermore, efficacy in children is not altogether clear. A recent study (Golden, et al. 2004. Outcomes of allergy to insect stings in children, with and without venom immunotherapy. N Engl J Med 351:668, which is herein incorporated by reference in its entirety) demonstrated that children (age 8+3 years) having a mild to severe hypersensitivity to bee sting early in life do not always outgrow such an allergy, but can have symptoms into adulthood. Furthermore, for those children that received venom immunotherapy, it did reduce the risk of having a systemic response when they were stung by a bee with a mean of 21 years later (+5 years). However this protection into adulthood was not complete. So, immunotherapy in children appears somewhat successful, but is not absolute. 6) Unknown hypersensitivities to bee venom. Only those individuals who have already experienced a hypersensitivity reaction to a honeybee sting are indicated for immunotherapy. Diagnostic tests to identify those individuals who might have an adverse reaction to bee venom are limited by the fact that 25% to 30% of the population shows reactivity in a RAST test. Furthermore, some individuals who have a negative RAST or skin test can still have an allergic reaction to a bee sting (Reisman, R. E. 2001. Insect sting allergy: the dilemma of the negative skin test reactor. J Allergy Clin Immunol 107:781, which is herein incorporated by reference in its entirety). More troubling is the fact that about half of the deaths attributed to fatal sting reactions could not have been prevented since there was no previous indication that these individuals had any hypersensitivity (Barnard, J. H. 1973. Studies of 400 Hymenoptera sting deaths in the United States. J Allergy Clin Immunol 52:259. Hoffman, D. R. 2003. Fatal reactions to hymenoptera stings. Allergy Asthma Proc 24:123, both of which are incorporated by reference in their entireties.), and therefore they would not have been candidates for immunotherapy. 7) Noncompliance of patients for which immunotherapy is indicated. Once a patient presents with a hypersensitivity to bee stings, it is not a certainty that the individual will choose to receive such therapy. The reasons for deciding not to participate in immunotherapy are likely some combination of the problems listed above, including cost, inconvenience, the use of needles, and/or side effects associated with such therapy. In one study (Golden, D. B., A. Kagey-Sobotka, P. S. Norman, R. G. Hamilton, and L. M. Lichtenstein. 2004. Outcomes of allergy to insect stings in children, with and without venom immunotherapy. N Engl J Med 351:668, which is incorporated by reference in its entirety), of 345 children that had a moderate to severe systemic reaction to a bee sting, 99 (or 29%) chose not to undergo immunotherapy even though they were advised to do so.
(226) Thus, despite the successes of venom-based immunotherapies, there remain some significant problems with the practicality and safety of performing these treatments. This fact is underscored by recent investigations which have sought technological advances in the field of immunotherapy in an attempt to overcome some of these limitations (Jilek, et al. 2001. J Immunol 166:3612. Muller, et al. 1998. J Allergy Clin Immunol 101:747. Muller, U. R. 2003. Curr Opin Allergy Clin Immunol 3:299. Alexander, et al. 2002. Curr Drug Targets Inflamm Allergy 1:353, which are incorporated by reference in their entirety). Thus, one embodiment of the present invention is to prophylactically apply oral allergen therapy to prevent the development of hypersensitivity in children who have not yet shown clinical symptoms. This can be a cost-effective, safe, and efficacious treatment option.
(227) There is little doubt that high levels of allergen can be expressed in a stable form in transgenic soybeans for pennies a dose. There have been several excellent review articles documenting the successful expression of proteins in transgenic plants and the above studies with transgenic fanC show this. The ability to express foreign proteins in transgenic plants has been demonstrated, and it is clear that the technology exists to transform plants for human use. In fact, proteins that retain their enzymatic activity or functionality have been expressed in a variety of plants, indicating the potential utility of this technology for a variety of applications. The advantages of transgenic plants for production of proteins of importance to human health have also been discussed (Goldstein, et al. 2004. Qjm 97:705. Peterson, et al. 2004. Trends Biotechnol 22:64. Ma, J. K. 2000. Nat Biotechnol 18:1141. Larrick, et al. 2001. Curr Opin Biotechnol 12:411. Giddings, G. 2001. Curr Opin Biotechnol 12:450, all of which are incorporated by reference in their entireties.). The feasibility of expressing foreign proteins (but not allergens) in transgenic soybeans has also been demonstrated (Zeitlin, et al. 1998. Nat Biotechnol 16:1361. Sojikul, et al. 2003. Proc Natl Acad Sci USA 100:2209. Smith, et al. 2002. Biotechnol Bioeng 80:812. Hatic, et al. 2001. Anal Biochem 292:171, all of which are incorporated by reference in their entireties) and the disclosure in the present invention of E. coli FanC shows that subunit allergens can be expressed in soybeans. When targeted to the cytoplasm, expression levels of FanC approaches 0.5% of total protein. Therefore, it is postulated that well over 1% of total protein expression of an antigen can be obtained when it is specifically targeted to expression in soybean seeds (Sato, et al. 2004. Crop Sci 44:646, which is herein incorporated by reference in its entirety.).
(228) Presently, soybean yields are 40 bushels/acre with a typical price of $6 per bushel. Since soybeans contain 38% protein, even with 1% expression of a particular allergen, oral therapy would be pennies a dose. Therefore, the cost of numerous exposures to any particular oral toleragen in a large population of children is not a limitation to using this technology.
(229) As are discussed herein, soy milk formulations for infant and adult consumption are safe to consume and have significant nutritional benefit (Messina, M. J. 1999. Am J Clin Nutr 70:439S. Slavin, J. 1991. J Am Diet Assoc 91:816, both of which are incorporated by reference in their entireties.). In fact, soy milk formulations are so safe that they are routinely fed to infants with little side effects (Motil, K. J. 2000. Curr Opin Pediatr 12:469. Seppo, et al. 2005. Am J Clin Nutr 82:140. Badger, et al. 2002. J Nutr 132:559S, both of which are incorporated by reference in their entireties.). Such safety also seems to apply to transgenic plants in general. In a recent review, it was noted that . . . more than two trillion transgenic plants have been grown between 1999 and 2000 alone, with no overt documented adverse food reactions being reported, indicating that genetic modification through biotechnology will not impose immediate, significant risks such as food allergen sources beyond that of our daily intake of foods from crop plants. (Helm, R. M. 2003. Ann Allergy Asthma Immunol 90:90, which is incorporated by reference in its entirety.). Such safety further supports the notion that widespread therapy with allergen-containing soy milk formulations would not pose any significant risk to the majority of infants or adolescents, even if those individuals might never develop hypersensitivity to that particular allergen.
(230) Making soybeans into forms that are palatable for human consumption are established and are numerous (Friedman, et al. 2001. J Agric Food Chem 49:1069. Lusas, et al. 1995. J Nutr 125:573S, both of which are incorporated by reference in their entireties). Furthermore, novel processing methods are presently being sought to improve existing technologies (Kitts, et al. 2003. Curr Pharm Des 9:1309, which is incorporated by reference in its entirety.).
(231) Tofu is a well known form of soybeans that is generated by the fermenting soy protein. It is contemplated and within the scope of the invention that the transgenic soy of the instant invention can be processed in such a way. It is believed that the fermenting process may proteolize the proteins, yet nevertheless, these proteins may possess the requisite epitopes necessary to elucidate an immune response. Consequently, the instant invention contemplates that transgenic soybean that has been made into tofu is within the scope of the instant invention.
(232) Without fermentation of soy products, a process can be readily identified that maintains allergen structure, and at the same time forms transgenic soybeans into a consumable product. The above disclosure demonstrates that soybeans expressing the bacterial protein, FanC, can be processed into soy powder and soy milk suitable for consumption and still contain intact FanC capable of stimulating a mucosal response. These studies support the notion that formulating soybeans into soy milk maintains allergen structure for use in the induction of oral tolerance.
(233) Recent reviews (Wu, et al. 2003. Immunol Res 28:265. Mayer, L., et al. 2004. Nat Rev Immunol 4:407, both of which are incorporated by reference in their entireties.) summarize the efficacy of inducing tolerance to a variety of antigens following their oral administration. Animal models of autoimmune disease have shown some of the most promising results, especially when oral antigens are given prior to sensitization of animals to the auto-antigen. In addition, feeding of allogeneic cells or MHC proteins has shown efficacy in animal models of transplant rejection (Stepkowski, et al. 1999. Transplant Proc 31:1557. Zavazava, et al. 2000. J Leukoc Biol 67:793, both of which are incorporated by reference in their entireties.).
(234) There have been a few attempts to use autoimmune antigens expressed in transgenic plants to limit the development of autoimmune disease in mouse models. Of note, others have used transgenic tobacco to express a diabetes associated antigen and prevent diabetes in an animal model following oral administration (Ma, et al. 2004. Proc Natl Acad Sci USA 101:5680. Ma, et al. 1997. Nat Med 3:793, both of which are incorporated by reference in their entireties.). Other researchers have used transgenic potatoes expressing a cholera toxin B subunit-insulin fusion protein for oral tolerance induction in a mouse model of diabetes (Arakawa, et al. 1998. Nat Biotechnol 16:934, which is incorporated by reference in its entirety.).
(235) There have also been a few attempts to induce oral tolerance to allergens. There has been some success using increasing doses of food allergens given orally to desensitize patients (Patriarca, et al. 2003. Aliment Pharmacol Ther 17:459, which is incorporated by reference in its entirety.). Unfortunately some patients react to even small doses to oral food allergens, making side effects possible in highly reactive patients. Oral tolerance has also been observed when certain pollen extracts are given to mice (Aramaki, et al. 1994. Immunol Lett 40:21. Kim, et al. 2001. Arch Pharm Res 24:557, which are incorporated by reference in their entireties). However, to the inventors knowledge this is the first studies on using transgenic soybeans to express allergens. Furthermore, the inventors believe that this is the first suggestion that one can prophylactically treat children with plant-derived allergens in an attempt to prevent the development of hypersensitivities.
(236) Thus, the present invention shows that the technology is available to express allergens in soybeans. Furthermore, the efficacy of inducing tolerance by oral administration in pre-sensitized animals is quite compelling. To the inventors knowledge, this is the first time that one has shown that it is not necessary to purify allergens from transgenic soybeans. However, the inventors also note that soy milk formulations from such plants should also be able to be used to induce tolerance when given orally to neonatal or adolescent mice. Widespread consumption of soy formulations containing allergens to induce systemic tolerance should thus be a viable therapy for preventing the development of immediate type hypersensitivity reactions.
(237) There are many advantages to using a preventative therapy utilizing allergens expressed in transgenic soybeans.
(238) As noted above, the low costs of expressing allergens in transgenic soybeans for prophylactic therapy makes such treatments feasible for almost anyone. The high protein content of soybeans makes it possible to express high amounts of allergen per soybean, which is a significant advantage over other plants such as tobacco, bananas, potato and tomato previously used to express antigens.
(239) Also noted above, the safety of soybean formulations for humans, like soy milk, is well recognized. Thus, the purification of soy-derived allergens is not a necessity. For example, previous work (Ma, et al. 2004. Proc Natl Acad Sci USA 101:5680. Ma, et al. 1997. Nat Med 3:793) expressed a diabetes antigen in tobacco to limit autoimmune diabetes in a mouse model. While this was a significant accomplishment, this antigen would have to be purified from such plants for use in humans. Thus, the present invention is advantageous in that the safety of soy formulations permits minimal processing prior to use by humans.
(240) Moreover, due to its safety, the oral delivery of allergens in soy milk formulations does not require medical personnel for such administration. This greatly simplifies treatment and contribute to a low cost. Further, consumption of soy milk formulations would likely be preferable to injections, especially for children. The low cost, safety and ease of administration of soy milk formulations would likely increase compliance with immunotherapeutic regimens that require several years duration to complete. The possibility exists that oral immunotherapy may produce less side effects (Helm, R. M. 2003. Ann Allergy Asthma Immunol 90:90, which is herein incorporated by reference in its entirety.) than those observed with present day injectable immunotherapy. If such a difference exists, it is likely that the route of administration (i.e. systemic versus gastric) would be responsible for the limited side effects.
(241) Soybeans were selected for expression of our oral allergen, bee venom phospholipase A2, for several key reasons. First, soybean has relatively high protein content when compared to other transgenic plants such as tobacco, bananas, potato and tomato previously used to express antigens. The typical composition of a soybean is 38% protein, 30% carbohydrate, 18% oil, and 14% moisture and other components. Therefore, it is possible to express a toleragenic dose of allergen in one or two soybean seeds. Second, procedures for processing soybeans into forms that are palatable for human consumption are established and are numerous:
(242) Production and purification of soybean includes 1) mass production in a factory of soy milk or soy powder containing the appropriate amount of vaccine; 2) individual, disposable vaccine extractors which might be sold over the counter, 3) and other similar systems. A novel processing method is shown in
(243) As pictured, the concept of an extract-a-vac has two essential functions: 1) to produce a single dose of vaccine; and 2) to produce it using a disposable extractor. The extractor can be made so it is reusable. If the extractor is reusable, it should be made of a material that can withstand thorough cleaning (and possibly even being autoclaved). Alternatively, the extract-a-vac can be used for a single vaccine dose followed by disposing of the extract-a-vac. As an extracting solution one would preferably use an aqueous solution that might contain some excipients such as sucralose or some other sugar to add palatability the extraction product. The extract generally should be heated to an appropriate temperature in order to maximize the solubility of the immunogen in the aqueous extraction solvent yet not so high as to cause the degradation of the immunogen (e.g. 75 C., or that temperature empirically determined for each immunogen to be optimal for extraction). Once heated the tab as shown in
(244) The extract-a-vac shows a process that can readily be used that maintains antigenicity, while formulating transgenic soybeans into a consumable product.
(245) Many food products made for human consumption already contain soy protein suggesting that adverse reactions to orally administered soy formulations would be limited. Stated simply, immunogens would not have to be purified from soy preparations because tolerance to soy proteins would be maintained when edible immunogens derived from these plants are used.
(246) The presence of immunogens in seeds of crop plants is advantageous due to antigen stability in seeds and transportability of these crops. Soybean seeds are likely to be stable to antigens.
(247) The following experimental section and the associated results demonstrate several important points regarding the advantages of using transgenic soybeans to express allergens. These include: 1) the ability to obtain high levels of antigen expression; 2) the ability to formulate soybeans into consumables while still maintaining antigenicity; and 3) the stability of antigen expression in soybean formulations even after processing or long term storage.
(248) Expression of an Enzymatically Inactive Form of Bee Venom Phospholipase A2 (Api m1) in Transgenic Soybeans
(249) An enzymatically inactive mutant of bee venom phospholipase A2, with the histidine at position 34 changed to a glutamine (H34Q), has been described. This mutant has essentially no enzymatic activity, yet retains its ability to stimulate a hypersensitivity response in allergic patients. To assure that the phospholipase activity did not cause any unforeseen problems for expression in plants, the inventors have made a plant-compatible version of the H34Q mutant for expression in soybeans.
(250) To construct a plant-compatible version of bee venom phospholipase A2 (H34Q) several factors had to be considered. Considerations for constructing a plant-compatible version of phospholipase A2 (H34Q) included: 1) increasing the GC content to resemble plant systems; 2) removing AT-rich regions which could affect mRNA stability; 3) altering codon usage to resemble plant biases; and 4) removing the N-terminal targeting sequence. In addition, all AT-rich regions greater than five nucleotides in length were eliminated to avoid introduction of potential cryptic polyadenylation signals. Once the synthetic, plant-compatible version of bee venom phospholipase A2 (H34Q) had been designed, the actual gene was created by annealing large synthetic oligonucleotides with 30-bp overlapping regions of homology, to create a template for PCR amplification. A similar strategy is shown elsewhere in this invention disclosure wherein a construct was made to express a plant-compatible version of the E. coli antigen, FanC (Piller, et al. 2005. Planta 222:6, which is herein incorporated by reference.), and a mutant form of the heat labile bacterial toxin, LT (R03 A1-061102).
(251) Transformation of Plants
(252) A common means of transforming higher order plants is through the use of Agrobacterium species. An exemplary embodiment of a particular species that can be used to transform higher order plants and soybeans in particular is Agrobacterium tumefaciens. Other species that are contemplated and within the scope of the present invention include A. radiobacter, which is an avirulent species, A. rhizogenes, which is known to cause hairy root disease, and A. rubi. When multiple cassettes are used, the expression efficiency tends to decrease. Accordingly, a preferred embodiment limits the number of T-DNA insertions.
(253) Particular soybean strains can be used in transformations that are tolerant to different conditions. For example, one might use elite soybean germplasm for transformation, which is resistant to rust. Alternatively, different soybean varieties can be used that are suited to a geographical region around the world for transformation (e.g. one might select a variety that is resistant to heat or drought conditions that grow well in Africa).
(254) Soybean Transformation and T.sub.0 Plant Growth
(255) Soybean transformations are performed to generate 25 transgenic events. The pKP43 vector is mobilized into Agrobacterium tumefaciens strain EHA101 by triparental mating, and transconjugants resistant to antibiotic selection are used to transform soybean as described elsewhere in this disclosure. Seeds are surface sterilized and germinated for 5 days, at which time cotyledonary explants are isolated, immersed in A. tumefaciens inoculum, and cultivated for 3 days. Following washing and culturing on shoot induction medium for 4 weeks, the differentiating node are separated from the cotyledons, and sub-cultured on shoot elongation medium biweekly until shoots reach a length of greater than or equal to three cm. To select for transformants, the shoot initiation and elongation medium contains 5 mg/ml and 3 mg/ml glufosinate, respectively. Elongated shoots are transferred to rooting medium and allowed to grow into plantlets. The plantlets are grown and then are transferred to soil, grown to maturity, and allowed to set T.sub.1 seeds in the greenhouse.
(256) T.sub.1 seeds can then be screened to determine which lines expressing the gene encoding bee venom phospholipase A2 (H34Q) is selected for T.sub.1 plant growth and T.sub.2 seed formation.
(257) Selection for Transformed Plants
(258) Selectable Marker Cassettes are also contemplated and within the scope of the present invention. A cassette encoding a selectable marker can be included on the plant binary vector. An exemplary embodiment of a selectable marker is the bar gene encoding resistance to the herbicide bialophos. Another example is the EPSPS gene (Monsanto) encoding resistance to glyphosate. The selectable marker may impart an advantage to the soybean plant, as do the bar and glyphosate cassettes by offering resistance to herbicides. Although antibiotic selection markers are contemplated, there is some resistance from segments of the population to put antibiotic resistant strains of plants into the environment. For this reason, the herbicide resistant selection markers are preferred.
(259) Bialophos produced by Streptomyces hygroscopicus is a tripeptide consisting of two L-alanine residues and an analogue of glutamic acid (phosphinothricin (PPT)). Upon cleavage of bialophos, PPT is released and acts as an inhibitor of glutamine synthesis in plants, and hence functions as a potent herbicide. A gene (bar) coding for PPT acetyltransferase has been isolated from S. hygroscopicus and is widely used as a selective marker for the transformation of higher plants. See DeBlock et al. 1987 EMBO J. 6:2513-2518 Avalos et al. 1989 Curt. Genet. 16:369-327; and Pall, 1993 Fungal Genet. Newsl. 40:58, which are hereby incorporated in their entirety by reference.
(260) Expression of FanC in Transgenic Soybeans
(261) FanC antigen has been successfully expressed in transgenic soybeans. The synthetic fanC gene targeting expression to the cytosol of plant cells (pKP7) (
(262) A western blot is shown in
(263) The immunogenicity of soybean-derived FanC was also demonstrated. Mice immunized with soybean-derived FanC not only had significant antibody titers, but also had antigen-specific CD4+ T cell responses against this antigen.
(264) Analysis and Screening of T1 Plants Containing FanC Targeted to the Chloroplast
(265) FanC was also targeted to the chloroplast to examine expression, accumulation, and immunogenicity of the antigen. Soybean plants were transformed with pKP8 (
(266) Processing or Purification of FanC from Soybean Seeds is not Required for Immunogenicity.
(267) Two whole transgenic soybean seeds expressing FanC were given to mice to consume (
(268) Stability of Expression of FanC in Soy Powder and Soy Milk Formulations Made from Transgenic Soybean Seeds
(269) In the present invention, soy powder and soy milk can be formulated from transgenic seeds expressing the allergen. The stability of antigens within such soybean formulations once processed was tested.
(270) The stability of FanC in soybean seeds after storage at room temperature for 18 months was tested. The storage of transgenic soybean seeds for long periods of time at room temperature while still maintaining the stability of FanC was shown.
(271) Lone Term Stability of FanC in Soybean Leaves and Seeds
(272)
(273)
(274) Expression of Heat Labile Toxin of E. coli, LT(R192G) in Transgenic Soybeans
(275) In another embodiment, the A and B subunits of a mutant form of LT in transgenic soybeans were expressed (
(276) Prophylactic Therapy Approach
(277) In an embodiment of the invention, prophylactic therapy to prevent the development of hypersensitivity to the bee venom allergen, phospholipase A2 (Api m1) in neonatal and adolescent mice is likely to be successful. To accomplish this task, allergen(s) in a soy powder or soy milk formulations are expressed which can be administered orally to weanling mice to induce systemic tolerance which lasts into adulthood. Specifically, the bee venom allergen (phospholipase A2) is expressed in transgenic soybeans. Soy protein or soy milk preparations from these transgenic soybeans is then given orally to weanling mice prior to sensitization. The ability to induce allergic reactions in these tolerized animals is then assessed.
(278) The plantlets are grown and then transferred to soil, grown to maturity, and allowed to set T.sub.1 seed in the greenhouse. In short, the T.sub.1 seeds derived from T0 plant lines are screened to determine whether the gene encoding bee venom phospholipase A2 (H34Q) is expressed in seeds of the surviving, herbicide-resistant transgenic plants.
(279) When T.sub.1 seeds become available, the transgenic events expressing high levels of bee venom phospholipase A2 (H34Q) are identified. The best T1 seeds are then propagated to obtain T.sub.2 seeds. The T.sub.1 seeds are harvested from all herbicide resistant lines. The seeds are earmarked for possible future propagation to T.sub.1 plant growth, and the remainder of the seeds are processed for DNA and RNA. Genomic DNA isolated from T.sub.1 seeds and from control seeds is used in duplex PCR to verify stable integration of the bee venom phospholipase A2 (H34Q) expression cassette. For those DNA samples which are positive, the RNA is subjected to RT-PCR to demonstrate the presence of message expression and confirm the results of the DNA analyses. A Southern analysis is performed to determine copy number and locus number of the bee venom phospholipase A2 (H34Q) expression cassette. The genomic DNA is isolated from transgenic and control tissues, digested with a restriction enzyme that cleaves once within the T-DNA (such as BamHI), electrophoresed in agarose gels, denatured, and mobilized onto membranes that undergoes hybridization with a 32P-labelled bee venom phospholipase A2 (H34Q) probe. Autoradiography is then used to visualize the number of bee venom phospholipase A2 (H34Q) loci within each event. Events that accumulate the greatest levels of bee venom phospholipase A2 (H34Q) are propagated. If both, high complexity and low complexity events show similar accumulation of PLA2 (H34Q), the preference is to move the low complexity events forward.
(280) T.sub.1 Plant Growth and T.sub.2 Seed Screening
(281) Using information from the T.sub.1 seed screens, the three lines with the best molecular profile and which express the greatest levels of bee venom phospholipase A2 (H34Q) are propagated for T.sub.1 plant growth. The T.sub.2 seeds are collected and screened to: 1) identify transgenic lines in a segregating population; 2) verify stable inheritance of the bee venom phospholipase A2 (H34Q) gene and bee venom phospholipase A2 (H34Q) expression; 3) increase the number of transgenic soybean seeds available for subsequent studies; and 4) identify lines that may have reached homozygosity for the transgenic locus. These screens employ duplex PCR, ELISA, Western, and Southern analyses as described above. Bee venom phospholipase A2 (H34Q) levels of >1.0% of seed TSP are expected when bee venom phospholipase A2 (H34Q) is targeted specifically to the seed.
(282) Recombinant Bee Venom Phospholipase A2 (H34Q) Expression in E. coli.
(283) For use in ELISAs, Western blot analyses, and as an immunogen for making antibodies, bee venom phospholipase A2 (H34Q) in E. coli is cloned and expressed. Expression of recombinant proteins, their purification, and characterization is routine. Synthetic bee venom phospholipase A2 (H34Q), optimized for expression in prokaryotes, is synthesized using overlapping primers and PCR. A histidine tag (or possibly a GST tag or some other tag) is incorporated into the synthetic gene to facilitate purification of the recombinant protein for subsequent use.
(284) Polyclonal Antibody Production Against Recombinant Bee Venom Phospholipase A2 (H34Q)
(285) For use in ELISAs and Western blot analyses, polyclonal antibodies are made against the E. coli-derived bee venom phospholipase A2 (H34Q) in rabbits using procedures known in the art. (See 86-89 for making polyclonal and monoclonal antibodies, purifying immunoglobulins, and developing immunoassays using antibodies).
(286) Bee Venom Phospholipase A2 (H34Q) Stability in Soy Formulations:
(287) Once T.sub.2 seeds have been screened to demonstrate the lines that need to be expanded for T.sub.2 plant growth, some of the T.sub.2 seeds are used to demonstrate, and confirm, the stability of bee venom phospholipase A2 (H34Q) in the soy protein and soy milk formulations. For these studies, soy protein and soy milk formulations are made using transgenic T.sub.2 seeds as described below. Western blot analyses are used to demonstrate intact allergen present in the two formulations. ELISAs are used to quantify the amount of allergen present in seeds and in each soybean formulation on a per-weight basis and per total protein. As is shown for FanC (see
(288) T.sub.2 Plant Growth and T.sub.3 Seed Screening
(289) Using the information from the T.sub.2 seed screens, selected lines are expanded as T.sub.2 plants which provides T.sub.3 transgenic soybean seeds. Screening of the T.sub.3 seeds and quantification of each plant line's ability to express bee venom phospholipase A2 (H34Q) protein is determined by ELISA and Western blot as described above for T.sub.2 seeds.
(290) Treatment of Weanling Mice with a Soy Protein Formulation from Transgenic Seeds Expressing Bee Venom Phospholipase A21 (H34Q) as a Prophylactic Therapy for Hypersensitivity.
(291) Treatment of weanling mice with a soy protein formulation derived from transgenic seeds expressing bee venom phospholipase A2 (H34Q) is tested to see if the development of hypersensitivity against this allergen is established.
(292) Weanling mice are allowed to consume soy protein powder made from transgenic soybeans expressing bee venom phospholipase A2 (H34Q). At an age of 44 days, sensitization by weekly subcutaneous injections of recombinant allergen in alum is begun. At an age of 93 days, mice are challenged with an intraperitoneal injection of recombinant allergen. Groups of mice are taken for analyses at the indicated days.
(293) The Treatment of Weanling Mice
(294) A soy protein formulation from T.sub.3 transgenic seeds expressing bee venom phospholipase A2 (H34Q) (experimental) or from transgenic seeds expressing E. coli FanC (control) is made as follows. Transgenic seeds are dried at room temperature to a water content of approximately 10% and then hulls are removed. The dehulled seeds are ground to a powder and defatted using solvent extraction (5 parts hexane) and gentle stirring for 20 minutes. Removal of hexane by filtration and air drying is followed by solvent extraction with 100% ethanol at room temperature to reduce the carbohydrate content. The soy protein powder is then exposed to dry heat (90 C. for 10 minutes). Soy protein powder sufficient to complete an entire experimental protocol is prepared and stored, in aliquots, at 20 C. for use. Each lot of soy protein powder is assayed to quantify protein content and the amount of transgenic protein expressed per mg of powder.
(295) Because mice readily eat whole soybean seeds, it is not necessary to make a soy protein powder for their consumption. However, this is to show the feasibility of translating such prophylactic therapy to children. While enumerable methods for preparing soy protein exist, the above outlined procedure produces a soy protein powder of 70%-80% protein. This formulation is considered a medium to high grade formulation and is acceptable for human consumption.
(296) Consuming Soy Protein Formulation Containing Bee Venom Phospholipase A2 (H34Q):
(297) At 22 days of age, CBA/J mice are weaned and housed individually. Starting at day 23, regular chow is taken from the mice, and the appropriate amount of soy protein powder is added to a rodent feeding bowl with an inverted lip. Such vessels allow mice access to the soy powder, but virtually eliminate loss of any powder from the bowl. Mice eat at their leisure and at the end of the day an accurate record can be kept of the amount consumed by each mouse. This treatment continues every other day up to day 41 of age, for a total of 9 treatments.
(298) Prophylactic treatment of children with soybean-derived oral allergens should be a safe and efficacious method for preventing the development of hypersensitivity. The studies on mice that are young, and particularly on mice weanlings give results that are likely translatable results to children. Two previous studies have suggested that intragastric administration of antigen to neonates within the first 10 days of life is not an effective method of tolerance induction (Miller, et al. 1994. Eur J Immunol 24:1026. Strobel, et al. 1984. Pediatr Res 18:588, both of which are incorporated in their entirety by reference.). Therefore, in the instant invention, mice are studied that are not still suckling as suckling mice may not be an optimal age for tolerance induction.
(299) Sensitization to Bee Venom Phospholipase A2 (H34Q):
(300) At 44 days of age, CBA/J mice receive 0.1 microgram of E. coli-derived bee venom phospholipase A2 (H34Q) in 1 milligram of alum subcutaneously. This sensitization continues every other week for a total of five treatments. This regimen results in the induction of high levels of allergen-specific IgE and, therefore, the sensitization of normal CBA/J mice to bee venom phospholipase A2 (Astori, et al. 2000. J Immunol 165:3497. von Gamier, et al. 2000. Eur J Immunol 30:1638., Jilek, et al. 2001. J Immunol 166:3612., Seeger, et al. 1998. Eur J Immunol 28:2124. Von Gamier, et al. 2002. Clin Exp Allergy 32:401, all of which are incorporated by reference in their entireties).
(301) Challenge with Bee Venom Phospholipase A2 (H34Q)
(302) Three weeks after the final sensitization injection, CBA/J mice at 121 days of age are challenged with allergen by injecting 30 micrograms of E. coli-derived bee venom phospholipase A2 (H34Q) intraperitoneally. This exposure induces an anaphylactic response in sensitized mice.
(303) Table 1 shows the number of mice per group, the treatment groups, and the number of mice to be taken for each of the assay groups. A low dose (1 mg per day) and a high dose (5 mg per day) of soy protein powder expressing bee venom phospholipase A2 (H34Q) is used in this experimental protocol.
(304) A 500 microgram dose represents the amount of bee venom phospholipase A2 (H34Q) that is expressed in approximately 1 transgenic soybean seed, assuming that allergen expression is 1% of the total seed protein. Soybean seeds from this strain weigh about 150 milligrams and about 130 milligrams following dehulling. Therefore at 1% expression, each seed contains just over 500 micrograms of allergen. When processing to soy powder most of the fat and carbohydrates are lost, which accounts for about half of the weight of the dehulled seed. Therefore approximately 70 milligrams of soy protein powder are fed to obtain a 500 microgram dose. Based on these calculations, the amount of material needed is easy to obtain after isolating T3 seeds. In addition, this amount of material is easily consumed by weanling mice during the course of the treatment days.
(305) For control groups, mice are allowed to consume soy protein powder expressing E. coli FanC (Piller et al. Planta, 222, 6) or normal laboratory chow (which contains soy protein but no FanC) for comparison.
(306) TABLE-US-00011 TABLE 9 Groups of mice to be treated with soybean-derived bee venom phospholipase A2 (H34Q). Table 9: Groups of mice to be treated with soybean-derived bee venom phospholipase A2 (H34Q). Number of Number of mice Number of mice Total Treatment mice taken for taken for taken for number of (amount of allergen in soy Group #1 Group #2 Group #3 mice treated protein formula per day) analyses analyses analyses 12 Soy protein powder 4 4 4 containing phospholipase (1 mg) 12 Soy protein powder 4 4 4 containing phospholipase (5 mg) 12 Soy protein powder 4 4 4 containing FanC (5 mg) 12 None 4 4 4 (regular laboratory chow) 4 E. coli-derived 4 0 0 phospholipase in CFA given intraperitoneally
The relevant question is: does consumption of soy protein powder containing bee venom phospholipase A2 (H34Q), by itself, result in sensitization of mice? At day 44 when mice have completed their consumption of soy protein powder containing bee venom phospholipase A2 (H34Q), four mice each from the experimental and control groups are sacrificed to determine if allergen specific antibodies or if antigen-specific CD4+ T cell responses are present. To investigate the presence of any anti-bee venom phospholipase A2 antibody responses, ELISA, ELISpot and antigen-specific proliferation analyses are performed. This entire experimental design is performed twice to assure data reproducibility.
(307) ELISA for allergen-specific serum and mucosal antibodies: For ELISA, E. coli-derived allergen is coated onto ELISA plates. Sera and fecal samples collected from the euthanized mice are used to quantify serum IgG1, IgG2a, and IgE and mucosal IgA antibody levels against bee venom phospholipase A2. Fecal IgA antibodies are isolated as previously described (Takahashi, et al. 1996. J Infect Dis 173:627, which is herein incorporated by reference in its entirety.).
(308) ELISpot Analyses for Quantification of Allergen-Specific Antibody Forming Cells
(309) To quantify numbers of allergen-specific antibody forming cells, mononuclear leukocytes are isolated from the spleens and mesenteric lymph nodes of mice. Triplicate limiting dilutions (510.sup.5 to 10.sup.4 cells per well) are plated onto MultiScreen-IP microtiter plates (Millipore, Inc.) that have been previously coated with E. coli-derived recombinant bee venom phospholipase A2 (H34Q). After 48 hours at 37 C. in a CO2 incubator, wells are washed, and alkaline phosphatase-conjugated anti-mouse isotype specific (IgG1, IgG2a, IgA, and IgE, respectively) antibodies are added. After washing, substrate is added to visualize spot forming cells. An automated ImmunoSpot Reader (Cellular Technologies, Ltd., Becton Dickinson) with dedicated software can be used to facilitate data acquisition and analysis.
(310) ELISpot Analyses for Quantification of Allergen-Specific CD4+ T Cell Responses:
(311) To investigate the presence of any CD4+ T cell responses in mice who have been allowed to consume soy protein powder containing bee venom phospholipase A2 (H34Q), ELISpot analyses are performed. Mononuclear leukocytes are isolated from the spleens of mice, followed by positive magnetic separation (MACS, Miltenyi, Inc.) for CD4+ lymphocytes as previously described (Peacock, et al. 2001. Immunology 104:109., Elhofy, et al. 2000. J Immunol 165:3324., Lin, et al. 2004. Biochem Biophys Res Commun 321:828. Elsawa, et al. 2003. J Immunol 170:2605, all of which are incorporated by reference in their entireties.). The MACS procedure for isolation of CD4+ T lymphocyte subpopulations routinely gives greater than 93% purification as indicated by FACS analysis. Triplicate limiting dilutions of the appropriate T cell subpopulations (110.sup.5 to 10.sup.3 cells per well) are plated onto MultiScreen-IP microtiter plates (Millipore, Inc.) that have been previously coated with a capture monoclonal antibody against mouse IFN-g, IL-4 or IL-10 (BD Pharmingen). To serve as antigen presenting cells, 10.sup.5 bone marrow-derived dendritic cells per well, that have been pulsed with E. coli-derived bee venom phospholipase A2 (H34Q) (10 micrograms per 10.sup.5 cells), are added. Bone marrow derived dendritic cells are used as antigen presenting cells in the ELISpot re-stimulation assays, and these antigen presenting cells are generated as previously described (Nelson, et al. 2004. J Neuroimmunol 155:94. Son, et al. 2002. J Immunol Methods 262:145, both of which are incorporated by reference in their entireties.). After 48 hours of re-stimulation, ELISpot analyses are performed for production of IFN-gamma, IL-4, and/or IL-10 (BD Pharmingen ELISPOT kits). An ImmunoSpot Reader (Cellular Technologies, Ltd., Becton Dickinson) with dedicated computer and software for analysis of spot size distribution facilitates data acquisition and analysis.
(312) CD4+ T Cell Proliferation Assays
(313) To investigate the ability of CD4+ T cells to proliferate in response to allergen, tritiated thymidine incorporation assays are performed. Mononuclear leukocytes are isolated from the spleens of mice, followed by positive magnetic separation for CD4+ lymphocytes as previously described (Peacock et al. 2001. Immunology 104:109, Elhofy, et al. 2000. J Immunol 165:3324., Lin, et al. 2004. Biochem Biophys Res Commun 321:828. Elsawa, et al. 2003. J Immunol 170:2605, all of which are incorporated by reference in their entireties.). Triplicate limiting dilutions of the CD4+ T cell subpopulations (110.sup.5 to 10.sup.4 cells per well) are plated into round bottom 96 well plates. To serve as antigen presenting cells, 10.sup.5 bone marrow-derived dendritic cells per well, that have been pulsed with E. coli-derived bee venom phospholipase A2 (H34Q) (10 micrograms per 10.sup.5 cells), are added. Bone marrow derived dendritic cells are used as antigen presenting cells in the proliferation assays, and these antigen presenting cells are generated as previously described (Nelson, et al. 2004. J Neuroimmunol 155:94. Son, et al. 2002. J Immunol Methods 262:145). Plates are cultured at 37 C. in a CO.sub.2 incubator for 72 hours with the final 24 hours being in the presence of 0.5 microcurries per well of tritiated thymidine. Cells are harvested (PHD Cell Harvester, Brandel) and incorporation of radioactivity determined.
(314) Statistical Analyses
(315) Statistical analyses are performed on the results from ELISA, ELISpot, and proliferation analyses by one-way ANOVA using a Bonferroni post hoc test for comparison of means (GraphPad, San Diego, Calif.).
(316) To serve as positive controls for these assays (see Table 9), four additional mice are immunized intraperitoneally with 200 micrograms of E. coli-derived bee venom phospholipase A2 emulsified in complete Freund's adjuvant (CFA). Sera and cells from these immunized mice are taken 14 days later, to coincide with the euthanasia of the other mice that are 44 days of age.
(317) To determine if weanling mice that have consumed soy protein powder containing bee venom phospholipase A2 (H34Q) are tolerant to a sensitization regimen the following experiment can be performed. At 114 days of age, two weeks after mice have received their last sensitization injection, four mice each from the experimental and control groups (see Table 9) are sacrificed to determine the level of allergen-specific antibodies or antigen-specific CD4+ T cell responses which are present. Analyses to be performed include: 1) ELISA for allergen-specific serum and mucosal antibodies; 2) ELISpot analyses for quantification of allergen-specific antibody forming cells; 3) ELISpot analyses for quantification of allergen-specific CD4+ T cell responses; and 4) CD4+ T cell proliferation assays, using the methods described above.
(318) Mice that have been allowed to consume soy protein powder containing bee venom phospholipase A2 (H34Q) should have: 1) a reduced allergen-specific IgG1 and IgE antibody levels, with a possible skewing toward an IgG2a and IgA response; 2) reduced numbers of IgG1 and IgE allergen-specific antibody spot forming cells, with a possible skewing toward an IgG2a and IgA response; 3) a reduced number of allergen-specific CD4+ T cells secreting IL-4, with an increased number of IFN-gamma and IL-10 spot forming cells; and 4) a decrease in the allergen-induced proliferation of CD4+ T lymphocytes; when compared to mice who have been allowed to consume soy protein powder containing E. coli FanC or regular laboratory chow.
(319) To determine if weanling mice, that have consumed soy protein powder containing bee venom phospholipase A2 (H34Q), are tolerant to challenge with an anaphylactic dose of allergen the following experiment can be performed.
(320) At 121 days of age, three weeks after mice have received their last sensitization injection, four mice each from the experimental and control groups (see Table 9) are challenged with an anaphylactic dose of allergen. The primary goal of this challenge is to determine whether mice can survive the anaphylactic response. Mice are treated and observed individually. When it is clear that a particular mouse succumbs to this systemic hypersensitivity reaction, they are euthanized. Following challenge, tissues from all mice, regardless of clinical response, are taken to determine the level of allergen-specific antibodies or antigen-specific CD4+ T cell responses which are present. Analyses performed include: 1) ELISA for allergen-specific serum and mucosal antibodies; 2) ELISpot analyses for quantification of allergen-specific antibody forming cells; 3) ELISpot analyses for quantification of allergen-specific CD4+ T cell responses; and 4) CD4+ T cell proliferation assays, using the methods described above.
(321) Mice treated orally with soybean-derived FanC or allowed to consume regular laboratory chow should succumb to anaphylactic shock when given the intraperitoneal injection. In contrast, mice treated orally with soybean-derived bee venom phospholipase A2 (H34Q) should survive. For the antibody and cellular analyses, similar results should occur as observed for the analyses of weanling mice that have consumed soy protein powder containing bee venom phospholipase A2 (H34Q). In fact, these studies should indicate that the effects of prophylactic treatment with oral allergen can last well into adulthood of these mice.
(322) These results would strongly support the notion that it is possible to prevent the development of an allergic phenotype by prophylactic therapy in weanling animals.
(323) Treatment of Weanling Mice with a Soy Milk Formulation from Transgenic Seeds Expressing Bee Venom Phospholipase A2 (H34Q) as a Prophylactic Therapy for Hypersensitivity
(324) In an embodiment, an additional set of studies are performed to assess the efficacy of continuous feeding soy milk derived from transgenic seeds expressing bee venom phospholipase A2 (H34Q). There is some indication that continuous feeding of an antigen is an efficacious method for the induction of oral tolerance (Faria, et al. 2003. J Autoimmun 20:135, which is herein incorporated by reference in its entirety.). This supports the notion of prophylactic therapy of children to limit the development of hypersensitivities.
(325) A soy milk formulation from T.sub.3 transgenic seeds expressing bee venom phospholipase A2 (H34Q) (experimental) or from transgenic seeds expressing E. coli FanC (control) is made as follows. T.sub.3 transgenic soybean seeds are placed into an automated processor (SoyQuick Soy Milk Maker) to make soy milk. Typically, the concentration of soy protein in such aqueous formulations is approximately 40 milligrams per milliliter of milk. Therefore, assuming that allergen expression in transgenic seeds is 1% of total protein, each milliliter of milk contains approximately 400 micrograms of allergen. The exact concentration of allergen in each batch of soy milk is determined per milliliter and per concentration of protein using an ELISA assay. Aliquots of soy milk are stored at 20 C. until given to mice.
(326) Consuming Soy Milk Containing Bee Venom Phospholipase A2 (H34Q)
(327) At 22 days of age, CBA/J mice are weaned and housed individually. Starting at day 23, water is replaced with soy milk in a graduated tube which allows the amount of milk consumed to be recorded each day. Fresh soy milk is given daily through 41 days of age.
(328) The sensitization to bee venom phospholipase A2 (H34Q and the challenge with bee venom phospholipase A2 (H34Q) is similar to the procedure described above.
(329) Table 10 shows the number of mice per group, the treatment groups, and the number of mice to be taken for each of the assay groups. For control groups, mice allowed to drink soy milk expressing E. coli FanC (Piller et al. 2005 Planta, 222, 6) or water are used as controls for comparison.
(330) TABLE-US-00012 TABLE 10 Groups of mice to be treated with soybean-derived bee venom phospholipase A2 (H34Q). Number of Number of mice Number of mice mice taken for taken for taken for Total Treatment Group #1 Group #2 Group #3 number of (amount of allergen in soy analyses analyses analyses mice treated milk formula per milliliter) 44 days 114 days 121 days 12 Soy milk (approximately 350 4 4 4 micrograms/ml phospholipase) 12 Soy milk (approximately 350 4 4 4 micrograms/ml FanC) 12 None (water) 4 4 4 4 E. coli-derived 4 0 0 phospholipase in CFA given intraperitoneally
Group #1 Analyses: Does Consumption of Soy Milk Containing Bee Venom Phospholipase A2 (H34Q), by Itself Result in Sensitization of Mice?
(331) At day 44 when mice have completed their consumption of soy milk containing bee venom phospholipase A2 (H34Q), four mice each from the experimental and control groups are sacrificed to determine if allergen specific antibodies or if antigen-specific CD4+ T cell responses are present. To investigate the presence of any anti-bee venom phospholipase A2 antibody responses, ELISA, ELISpot and antigen-specific proliferation analyses are performed. This entire experimental design is performed twice to assure reproducibility of the data obtained. Furthermore, the methods are identical to those described above.
(332) Group #2 Analyses: Are Weanling Mice, that have Consumed Soy Milk Containing Bee Venom Phospholipase A2 (H34Q), Tolerant to the Subsequent Sensitization Regimen?
(333) At 114 days of age, two weeks after mice have received their last sensitization injection, four mice each from the experimental and control groups (see Table 10) are sacrificed to determine the level of allergen-specific antibodies or antigen-specific CD4+ T cell responses which are present. Analyses performed include: 1) ELISA for allergen-specific serum and mucosal antibodies; 2) ELISpot analyses for quantification of allergen-specific antibody forming cells; 3) ELISpot analyses for quantification of allergen-specific CD4+ T cell responses; and 4) CD4+ T cell proliferation assays, using methods described above. Furthermore, the methods are identical to those described above.
(334) Group #3 Analyses: Are Weanling Mice, that have Consumed Soy Milk Containing Bee Venom Phospholipase A2 (H34Q) Tolerant to Challenge with a Anaphylactic Dose of Allergen?
(335) At 121 days of age, three weeks after mice have received their last sensitization injection, four mice each from the experimental and control groups (see Table 10) are challenged with an anaphylactic dose of allergen. The primary goal of this challenge is to determine whether mice survive the anaphylactic response. Mice are treated and observed individually. When it is clear that a particular mouse succumbs to this reaction, they are euthanized to determine the level of allergen-specific antibodies or antigen-specific CD4+ T cell responses which are present. Analyses performed include: 1) ELISA for allergen-specific serum and mucosal antibodies; 2) ELISpot analyses for quantification of allergen-specific antibody forming cells; 3) ELISpot analyses for quantification of allergen-specific CD4+ T cell responses, and 4) CD4+ T cell proliferation assays, using methods described above.
(336) It is likely that the processing of soybeans to protein powder or to soy milk does not destroy the bee venom phospholipase A2 (H34Q) expressed in seeds. The stability of FanC, of similar size (see above and below) has already been demonstrated. An advantage of the present invention is that allergen does not need to be purified, but only goes through a simple, and relatively gentle processing of the soybeans to obtain soy protein powder or soy milk, which can be readily consumed by humans. Therefore, it is likely that the mild processing does not destroy the allergen.
(337) Degradation of allergen in the gastrointestinal tract is also not likely to be a limiting factor because the present invention gives a very high allergen load. Furthermore, the soy formulations contain high levels of protein that likely provide stability. Even if there is some degradation of the bee venom phospholipase A2 (H34Q), peptide fragments also might be able to contribute to tolerance induction as epitopes may still be present on these peptide fragments.
(338) Construction of Synthetic fanC and Plant Transformation Vectors
(339) A synthetic plant-optimized version of fanC was created by sequential pair-wise annealing and extension of 70- to 100-bp-long complimentary oligonucleotides. Four 20-l reactions, each containing 10 pmol of the complementary oligonucleotide pairs indicated, were assembled on ice: reaction A contained FanC-1
(340) TABLE-US-00013 SEQIDNO:1 (TCATGAATACAGGCACTATCAACTTTAACGGAAAGATTACTTCCGCG ACGTGCACAATCGACCCCGAGGTGAACGGAAATCG)
plus FanC-8
(341) TABLE-US-00014 SEQIDNO:8 (CTTGAGCTTAAAGTCTACAACCGTGCCGTGTCCACTGATCGCGGCC TGGCCCAGGTCGATAGTGGATGTGCGATTTCCGTTCACCTCGGGGTC GATTGTG);
reaction B contained FanC-2
(342) TABLE-US-00015 SEQIDNO:2 (CACGGCACGGTTGTAGACTTTAAGCTCAAGCCAGCCCCTGGCTCTA ACGACTGCTTGGCCAAGACAAACGCTCGGATTGACTGGTCGGGCTCG ATGAACT)
plus FanC-7
(343) TABLE-US-00016 SEQIDNO:7 (GCAGCGGTATTGCCGCTAGCAGTGTTATTGAATCCAAGCGAGTTC ATCGAGCCCGACCAGTCAATCCGA);
reaction C contained FanC-3
(344) TABLE-US-00017 SEQIDNO:3 (CAATAACACTGCTAGCGGCAATACCGCTGCCAAAGGGTATCACAT GACCCTACGTGCGACTAACGTGGGA)
plus FanC-6
(345) TABLE-US-00018 SEQIDNO:6 (AGTGTGGGTGTATTCCGCCGTGGTGAATGAAGTGTTGATGTTCGC ACCACCACTACCGTTTCCCACGTTAGTCGCACGTAGGGTCATGTG),
and reaction D contained FanC-4
(346) TABLE-US-00019 SEQIDNO:4 (TCATTCACCACGGCGGAATACACCCACACTTCGGCTATACAGTCCT TCAACTATTCCGCCCAACTTAAGAAAGACGATAGGGCACCTTCTAAC GGAGGGT)
plus FanC-5
(347) TABLE-US-00020 SEQIDNO:5 (TCTAGAGCTCGTCCTWCATATAGGTCACGAGGAATGACGCGCTGGT CGTGAAGACTCCCGCCTTATACCCTCCGTTAGAAGGTGCCCTATCGT CTT).
Because the gene oligosequences were synthesized on a gene machine, it should be understood by those of skill in the art that modifications to protein sequences (for example, site directed mutagenesis) can be easily accomplished by modifying the nucleotide sequence. Each of the above reactions also contained 50 mM NaCl, 10 mM Tris-HCl (pH 7.9), 10 mM MgCl2, 1 mM dithiothreitol (DTT), 1 mM dNTPs, and 0.1 mg/ml bovine serum albumin (BSA). Reactions were heated to 94 C. for 5 min and then annealed at 60 C. for 5 min. Three units of T4 DNA polymerase were then added to each reaction, and extensions proceeded for 15 min at 14 C. The above heating-annealing-extension cycle was repeated a second time with the addition of 3 units of fresh T4 DNA polymerase before the extension step. Reactions A and B, and reactions C and D were combined to make reactions E and F, respectively. Heating, annealing, and extension of reactions E and F were carried out for two cycles as described above with fresh enzyme added prior to the extension. Reactions E and F were combined to make reaction G, which was again subjected to the cycle regimen described above. The template in reaction G was further amplified using primers FanC-9 (GCCCTTTCATGAAT ACAGGCAC) SEQ ID NO: 9 and FanC-10 (GCTCTAGAGCTCGTCCTTCATATAGG) SEQ ID NO: 10.
(348) PCR reactions (50 l) contained 50 pmol of primer (FanC-9 and FanC-10), 5 l of template G, 0.2 mM dNTPs, and 5 units of Pfu DNA polymerase (Stratagene, LaJolla, Calif., USA) in buffer recommended by the manufacturer. Reactions were denatured at 94 C. for 3 min, and then cycled 25 times (94 C. denaturation for 45 s, 60 C. annealing for 30 s, 72 C. extension for 1 min) in a Stratagene Robocycler.
(349) Following PCR, 5 units of Taq DNA polymerase (Promega, Madison, Wis., USA) was added to each tube and reactions were incubated at 72 C. for 10 min to allow 3 terminal addition of A residues to PCR-amplified products. The products were subcloned into pCR2.1-TOPO using the TOPO TA cloning kit (Invitrogen, Carlsbad, Calif., USA) creating the intermediate plasmid pKP3. SynfanC was isolated from pKP3 as a BspHI-XbaI fragment, and ligated into pRTL2 (Carrington et al. 1990 J Virol 64:1590-1597, which is herein incorporated by reference in its entirety) digested with NcoI and XbaI to create the intermediate plasmid pKP5. The synFanC plant expression cassette was isolated from pKP5 as a HindIII fragment and ligated into the binary vector pPTN200, a derivative of pPZP202 (Hajdukiewicz et al. 1994 Plant Mol Biol 25:989-994, which is herein incorporated by reference in its entirety) that harbors a bar gene (Thompson et al 1987 EMBO J 6:2519-2523, which is herein incorporated by reference in its entirety), to create pKP7. Plasmid DNA was isolated and purified using Qiagen Plasmid Isolation kits (Qiagen, Valencia, Calif., USA), and the integrity of pKP7 was verified by double-stranded sequencing (Davis Sequencing, LLC, Davis, Calif., USA).
(350) Soybean Transformations
(351) The binary vector pKP7 was mobilized into Agrobacterium tumefaciens strain EHA101 (Hood et al. 1986 J Bacteriol 168:1291-1301, which is herein incorporated by reference in its entirety) by triparental mating (Ditta et al. 1980 Proc Natl Acad Sci USA 77:7347-7351, which is herein incorporated by reference in its entirety). Soybean (Glycine max Merr) genotype Thorne (Ohio State University) was used for transformation with the above resultant transconjugant as previously described (Clemente et al. 2000, Crop Sci 40:797-803; Zhang et al. 1999, Plant Cell Tissue Organ Cult 56:37-46, both of which are incorporated by reference in their entireties). Glufosinate was used as the selective agent at concentrations of 5 mg/ml and 3 mg/ml during shoot initiation and elongation steps, respectively. Following regeneration, young plantlets were transplanted to soil and maintained in a greenhouse. After approximately 4 weeks in soil, a leaf trifoliate was isolated for use in nucleic acid and protein characterizations.
(352) Molecular Characterization of Transgenic Plants
(353) Soybean leaf tissue and seeds were frozen in liquid nitrogen and ground to a fine powder using a mortar and pestle. Genomic DNA was isolated using DNEasy Plant Kit (Qiagen). For duplex PCR reactions, approximately 1 g of genomic DNA was mixed with FanC-9, FanC-10, VSP-1 (5-GCTTCCACACATGGGAGCAG-3) SEQ ID NO: 17, and VSP-2 (5-CCTCTGTGGTCTCCAAGCAG3) SEQ ID NO: 18. Reactions were denatured at 95 C. for 5 min, followed by 32 cycles of denaturation (95 C. for 30 s), annealing (58 C. for 1 min), and extension (72 C. for 1 min), and visualized in 1.5% agarose gels. For Southern analysis, genomic DNA was digested with BamHI, separated by agarose gel electrophoresis, and transferred onto a nitrocellulose membrane. Membranes were then probed with a 32 P-labeled FanC probe for 16 h, washed, and exposed for autoradiography as previously described (Sato et al. 2004, Crop Sci 44:646-652, which is incorporated by reference in its entirety). For Western analysis, soluble protein was extracted from ground tissue using soybean extraction buffer (SEB, 25 mM Tris-HCl [pH 8.0], 1 mM EDTA, 5 mM DTT; 5 m1/g ground tissue) and sonication (10-s pulses for a total of 1 min at 4 C.). Sonicated samples were clarified by centrifugation at 16,000 ref for 30 min at 4 C., and quantified with the Bradford reagent (Bio-Rad) against a BSA standard. Proteins were separated in 10% SDS-PAGE gels, and transferred in 10 mM CAPs buffer (pH 11) to Immobilon-P membrane (Millipore, Bedford, Mass., USA). Following an overnight blocking reaction at room temperature in PBS containing 5% non-fat powdered milk, rabbit anti-K99 serum (1:2,000) was added to fresh block solution, and incubations were carried out for 1-2 h at room temperature. Membranes were washed twice in PBS containing 0.02% Tween (PBST) for 15 min each at room temperature, and then incubated for 1 h with a goat anti-rabbit immunoglobulin antibody conjugated with horseradish peroxidase (Cell Signaling Technology) in blocking solution. Following two additional washes with PBST, immunodetection was carried out using the SuperSignal West Pico Chemiluminescent Substrate kit (Pierce, Rockford, Ill., USA), and bands were visualized with a BioMax film (Kodak, Rochester, N.Y., USA).
(354) Purification of Recombinant FanC
(355) Recombinant FanC was produced and purified as a MalE-FanC fusion protein. The plasmid harboring the fusion protein was created by PCR amplification of native fanC (Ascon et al. 1998, Infect Immun 66:5470-5476, which is incorporated by reference in its entirety) with the primers FanC-11 (5-ATGGATCCAATACAGGTACTATTAAC-3) SEQ ID NO:61 and FanC-12 (5-ATTCTAGACATATAAGTGACTAAGAAGGA-3) SEQ ID NO:62, digestion of the PCR product with BamHI and XbaI, and ligation into the pMAL-c2 expression vector (New England Biolabs) creating pMalE-FanC. Bacteria harboring pMalE-FanC were grown in LB at 37 C. to a density of OD600=0.5. Expression of the fusion protein was induced with 1 mM isopropyl-b-D-thiogalactoside (IPTG), and bacterial cells were grown for an additional 2 h at 37 C. Recombinant MalE-FanC fusion protein was isolated in accordance with the manufacturer's protocol.
(356) Immunohistochemistry and Histochemical Staining
(357) Leaf tissue was fixed in 100 mM potassium phosphate containing 1.5% paraformaldehyde, and 0.2% glutaraldehyde (pH 7.0) overnight at 4 C. The fixed tissue was processed by dehydration with increasing concentrations of ethanol [50%, 70%, 80%, 95% (.Math.2), and 100% (.Math.3)] for 30 min each, followed by treatment with Citrisolv (30 min.Math.3) and paraffin (45 min.Math.2). The tissue was then embedded in paraffin blocks, sectioned at 10-m thickness, and placed onto glass slides. Slides were heated to 60 C. for 20 min to melt paraffin and then passed through a Citrisolv clearing agent (3.Math. for 5 min each). The tissues were rehydrated by incubation with decreasing concentrations of ethanol (100%, 95%, 80%, and 70%) for 5 min each, followed by a rinse with PBS containing 3% BSA. Following an overnight block in PBS supplemented with 3% BSA and 50 l/ml goat sera, the tissue was incubated with rabbit anti-K99 serum (1:100 dilution) for 3 h at RT, followed by an Alexaflour goat anti-rabbit IgG-HRP conjugated secondary antibody (1:500) for 1 h at RT. Cover slips were added to the sections using Gel/Mount aqueous mounting media, and sections were viewed at 20.Math. using confocal imaging. For standard histochemical staining, the tissue was fixed and processed as described above. Slides were then stained with Gills hematoxylin for 15 min, rinsed in dH20, and immersed in 0.25% ammonium hydroxide for 1 min. Slides were then stained with eosin for 1 min followed by 1-min incubations with increasing concentrations of ethanol (80, 95, and 100%). Finally, slides were washed three times for 1 min each in Citrisolv.
(358) Immunization of Mice with Soybean-Derived K99 Protein Lysates
(359) Groups of C57BL/6 mice (Jackson Laboratories) were untreated or were immunized intraperitoneally with transgenic protein lysate containing 382 ng of synFanC emulsified in complete Freund's adjuvant. Ten days following immunization, mice received a second equivalent immunization of transgenic protein lysate emulsified in incomplete Freund's adjuvant. Twenty-one days after the initial immunization, mice were euthanized and sera and splenic leukocytes isolated for quantification of antibody titers and CD4+ T-cell responses against FanC. For comparison, an additional group of mice was immunized in an identical manner with rFanC fusion protein purified from E. coli lysates as described above. These mice received 300 ng of rFanC emulsified in complete Freund's adjuvant, and 10 days later received a booster of 300 ng rFanC emulsified in incomplete Freund's adjuvant. Twenty one days after the initial immunization, mice were euthanized and sera collected.
(360) Quantification of Antibody Titers Against K99
(361) Serum antibody titers against synFanC in groups of immunized mice were determined using an ELISA. For these studies, rFanC fusion protein, purified from E. coli as described above, was adsorbed to 96-well ELISA plates (Corning) overnight in 0.1 M bicarbonate buffer (pH 9.0). ELISA wells were blocked with phosphate-buffered saline containing 1% BSA for 2 h, followed by the incubation of serial 1:2 dilutions of sera taken from immunized and control mice. After washing, a goat antimouse immunoglobulin antibody conjugated with horseradish peroxidase (Southern Biotechnology, Birmingham, Ala., USA) was added. Following a 1-h incubation, the unbound antibody was washed off, and bound antibody was detected by addition of TMB substrate (BioFX Inc). Enzymatic reactions were stopped by the addition of 1 M H.sub.2SO.sub.4, and optical absorbances at 450 nm determined. Antibody titers in immunized mice were defined as the highest dilution of sera that still had an absorbance value twice that of values obtained from non-immunized mice.
(362) Quantification of CD4+ T-Lymphocyte Responses Against K99
(363) The ability of CD4+ T lymphocytes from immunized mice to respond to synFanC was determined using an in vitro restimulation assay. Following euthanasia, CD4+ T lymphocytes were isolated from splenic leukocytes using magnetic activated cell sorting (Miltineyi Biotech, Auburn, Calif., USA) as previously described (Elhofy et al. 2000, J Immunol 165:3324-3332; Peacock and Bost 2001, Immunology 104:109-117, both of which are incorporated by reference in their entireties). CD4+ T lymphocytes isolated from non-immunized mice, or from mice immunized with transgenic soybean protein lysates containing synFanC, were plated at 10.sup.6 cells per well in 96-well round bottom tissue culture plates (Corning).
(364) To serve as antigen presenting cells, bone-marrow derived dendritic cells were isolated as previously described (Son et al. 2002, J Immunol Methods 262:145-157, which is incorporated by reference in its entirety). Briefly, femurs of C57BL/6 mice were flushed with RPMI-1640 containing 2% FCS to collect total bone marrow cells. Any spicules or bone matrix were allowed to settle and were removed. The total bone marrow cells were washed once, and resuspended in RPMI-1640 containing 12% FCS and 1,000 U/ml GM-CSF (BD Biosciences, Chicago, Ill., USA). Cells were fed every 2 days by adding 50% fresh media. After 5 days in culture, non-adherent cells were removed, washed, and resuspended in RPMI-1640 containing 12% FCS and 1,000 U/ml GM-CSF. After 3 days, the non-adherent dendritic cells were removed from the flask and washed. Recombinant FanC, purified from E. coli as described above, was added to the dendritic cells (450 ng per 10.sup.6 cells), and these 5.Math.10.sup.5 antigen-pulsed cells per well were added to the 96-well plates already containing the isolated CD4+ T lymphocytes. Following a 4-day incubation of CD4+ T lymphocytes with FanC pulsed dendritic cells, culture supernates were removed to quantify interferon gamma secretion using an ELISA procedure that has been previously described (Elhofy et al. 2000). To assure that interferon gamma secretion was antigen specific, control cultures containing CD4+ T lymphocytes and dendritic cells but without FanC antigen, or CD4+ T lymphocytes and FanC antigen but without dendritic cells were also prepared concomitantly.
(365) Anti-FanC Serum Titers in Mice Immunized with Transgenic Soybeans Expressing FanC.
(366) Mice readily consume soybean seeds. When food is withheld overnight, the mice consume 1-2 seeds in 10 minutes.
(367) C57BL/6 mice were given two transgenic soybean seeds (derived from lines 485-1 and 485-10), while control mice were given two non-transgenic, wild type soybean seeds. A dose of two seeds weighed approximately 250 mg. Both transgenic and wild type seeds had been stored for more than a year at 4 C. Mice readily consume soybean seeds and most of the seed material was consumed within 10 minutes. However, mice were allowed 1 hour per feeding, followed by gavage with 25 g of cholera toxin adjuvant. Similar feedings and gavages took place on days 7, 15, and 22 for a total of four feedings. On day 29, serum was collected, and an ELISA was performed to examine anti-FanC titers in control and test mice. As shown in
(368) Previous studies to compare the above results are few because plant-derived immunogens are often concentrated or purified before being given to individuals (and they are usually given parenterally or intranasally). A study by Arntzen and colleagues (1995, Science, 268:714-716) showed IgG titers of less than 1:1000 after allowing mice to eat 5,000 mg of transgenic potato on 4 separate occasions (see
(369) The transgenic seeds used in the instant invention contained cytosol-targeted FanC, which resulted in accumulated antigen of 0.25% of the total seed protein. Such levels can likely be increased 4 fold or more with a seed-targeted antigen construct, which is within the purview of a person of skill in the art.
(370) Antibody Titers in Mice Orally Immunized with Soybean Formulations Containing rFanC
(371) The efficacy of FanC as a mucosal antigen following oral administration of a soybean-derived formulation in mice was studied. FanC model antigen is immunogenic when administered orally, and a dose of 150 g of antigen is sufficient to stimulate humoral and cellular immune responses. Preliminary data demonstrated that FanC was indeed immunogenic when administered intraperitoneally, and stimulated production of significant anti-FanC antibody titers and antigen-specific CD4+ T lymphocytes in spleens of immunized mice. In the instant invention, it was shown that mice immunized orally with soybean protein formulations containing 50-450 g FanC also produce significant anti-FanC antibody titers and stimulate formation of antigen-specific CD4+ T lymphocytes. This demonstrates the immunogenicity of the FanC model antigen when administered via an oral route, and also supports the dosage formulations outlined above.
(372) Groups of mice were orally gavaged with 10 g soybean leaf protein containing 50, 150, or 450 g of rFanC antigen and adjuvant (25 g CT). For controls, groups of mice were orally gavaged with formulations containing soybean extract plus adjuvant or FanC antigen plus adjuvant. Mice were given booster formulations on days 21 and 35, and on day 53 serum and spleen tissues were collected. To determine whether immunized animals developed significant anti-FanC antibody titers, an ELISA was performed. Dilutions (1:2) of serum were incubated in wells coated with rFanC antigen, and a goat anti-mouse Ig-HRP-conjugated secondary antibody was used to detect the presence of anti-FanC antibodies. The titer of each animal was defined as the highest dilution of sera that still had an absorbance value twice that of background, and was plotted as a histogram for comparison.
(373)
(374) FanC-Specific CD4+ T Lymphocyte Responses in Orally Immunized Mice.
(375) To characterize the cellular immune responses in the orally immunized mice, a re-stimulation assay was performed. CD4+ T lymphocytes were isolated from splenic leukocytes using magnetic activated cell sorting, and plated in 96-well round bottom tissue culture plates. To serve as antigen presenting cells, bone marrow-derived dendritic cells were pulsed with rFanC antigen and added to the wells containing the CD4+ T lymphocytes. Following incubation of the T lymphocytes with rFanC-pulsed dendritic cells, interferon gamma secretion was measured using an ELISA. To assure that interferon gamma secretion was antigen specific, control cultures containing CD4+ T lymphocytes and dendritic cells but without rFanC antigen, or CD4+ T lymphocytes and FanC antigen but without dendritic cells, were also done concomitantly.
(376)
(377) The present invention has been described generally and with an emphasis on particular embodiments. It should be apparent to those of ordinary skill in the art that modifications can be made to the above disclosure and still fit within the scope and spirit of the invention. It is intended, contemplated, and therefore within the scope of the invention to combine any of the plurality of different elements in each of the embodiments in the above disclosure with any other embodiment. Moreover, the list of references that are mentioned in the disclosure are herein incorporated by reference in their entirety. The invention is not to be limited by the disclosure above but rather is defined by the claims below.