Use of lambda interferons in the treatment of obesity-related disorders and related diseases
12121564 ยท 2024-10-22
Assignee
- BIOMEDICAL RESEARCH FOUNDATION OF THE ACADEMY OF ATHENS (Athens, GR)
- Andreakos; Evangelos (Athens, GR)
- Salagianni; Maria (Athens, GR)
Inventors
Cpc classification
A61K45/06
HUMAN NECESSITIES
A61K8/64
HUMAN NECESSITIES
A61P9/10
HUMAN NECESSITIES
A61P7/02
HUMAN NECESSITIES
International classification
A61P7/02
HUMAN NECESSITIES
Abstract
The invention relates to the field of treatment or prevention of obesity-related disorders, atherosclerosis or a coagulation disorder. In particular, the present invention relates to the use of an activator of IFN receptor for the treatment or prevention of such disorders or conditions, and corresponding methods of treatment.
Claims
1. A method of treating an obesity-related disorder, atherosclerosis or a coagulation disorder, the method comprising administering to a subject in need thereof an effective amount of an activator of a lambda interferon (IFN) receptor, wherein the activator of the IFN receptor is an IFN polypeptide or a polynucleotide encoding the IFN polypeptide, and wherein the IFN polypeptide is a type III IFN.
2. The method of claim 1, wherein the obesity-related disorder, atherosclerosis or the coagulation disorder is selected from the group consisting of obesity, hyperphagia, prediabetes, type 2 diabetes, gestational diabetes, insulin resistance, metabolic disease, metabolic syndrome, coronary heart disease, carotid artery disease, myocardial infarction, stroke, thrombosis, dyslipidemia, hyperlipidemia, hypercholesterolemia, atheromatic plaque formation, and atheromatic plaque rupture.
3. The method of claim 1, comprising the therapeutic reduction of body weight or overweight in the subject.
4. The method of claim 1, wherein the subject is a mammalian subject.
5. The method of claim 4, wherein the subject is a human subject.
6. The method of claim 1, wherein the activator of the IFN receptor is administered in combination with one or more further therapeutic agents.
7. The method of claim 6, wherein the one or more further therapeutic agents are selected from the group consisting of insulin, metformin, meglitinides, sulfonylureas, glyburide, glipizide, glimepiride, canagliflozin, dapagliflozin, thiazolidinediones, pioglitazone, acarbose, pramlintide, exenatide, liraglutide, long-acting exenatide, albiglutide, dulaglutide, DPP-IV inhibitors, sitagliptin, saxagliptin, linagliptin, phentermine, diethylpropion, phendimetrazine, benzphetamine, oxyntomodulin, fluoxetine hydrochloride, topiramate, phentermine, bupropion, zonisamide, bupropion, naltrexone, xenical, cetilistat, GT 389-255, statins, cholesterol lowering drugs, proprotein convertase subtilisin kexin type 9 (PCSK9) inhibitors, ACE inhibitors, aldosterone inhibitors, angiotensin II receptor blockers, beta-blockers, calcium channel blockers, antiplatelets, aspirin, clopidogrel, dipyridamole, anti-coagulants, warfarin, heparin, direct factor Xa inhibitors, direct thrombin inhibitors, hydralazine, diuretics, corticosteroids, and non-steroidal anti-inflammatory drugs.
8. The method of claim 1, wherein the IFN polypeptide is a human IFN.
9. The method of claim 8, wherein the IFN polypeptide is selected from the group consisting of IFN1, IFN2, IFN3 and IFN4.
10. The method of claim 1, wherein the IFN polypeptide is homologous to the subject.
11. The method of claim 1, wherein the IFN polypeptide is pegylated.
12. The method of claim 11, wherein the IFN polypeptide is a monopegylated IFN polypeptide or an IFN polypeptide conjugated with a polyalkyl oxide moiety.
13. The method of claim 1, wherein the activator of the IFN receptor is administered via intravenous, intraperitoneal, subcutaneous or intramuscular injection; via oral, topical or transmucosal administration; via nasal or pulmonary inhalation; or via gene-therapy.
14. The method of claim 1, wherein the activator of the IFN receptor is administered (i) weekly, (ii) every two weeks, or (iii) twice a week.
15. The method of claim 1, wherein the activator of the IFN receptor is administered at a dose selected from (i) 10 g to 10 mg, 100 g to 9 mg, 500 g to 8 mg, 1 mg to 7 mg, 2 mg to 6 mg, and 5 mg; or (ii) 0.1-150 g/kg body weight, 0.5-100 g/kg body weight, 1-90 g/kg body weight, 10-80 g/kg body weight, 20-70 g/kg body weight, and 60 g/kg body weight.
16. The method of claim 1, wherein the activator of the IFN receptor is administered as a pharmaceutical composition comprising the activator of the IFN receptor and a pharmaceutically acceptable excipient.
17. The method of claim 1, wherein the activator of the IFN receptor is the IFN polypeptide.
18. The method of claim 1, wherein the IFN polypeptide comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, or SEQ ID NO: 5.
19. The method of claim 18, wherein the IFN polypeptide comprises the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, or SEQ ID NO: 5.
20. A non-therapeutic method of reducing body weight or overweight in a subject, the method comprising administering a non-therapeutically effective amount of an activator of IFN receptor to the subject, wherein the activator of the IFN receptor is an IFN polypeptide or a polynucleotide encoding the IFN polypeptide, and wherein the IFN polypeptide is a type III IFN, and optionally wherein the non-therapeutic reduction of body weight or overweight involves suppression of appetite and/or the suppression of overeating.
21. A method for determining susceptibility of a subject to treatment with an activator of IFN receptor, wherein the subject is suffering from an obesity-related disorder, atherosclerosis or a coagulation disorder, and wherein the method comprises administering the activator of IFN receptor to the subject and determining the effect of administering activator of IFN receptor to the subject on the obesity-related disorder, atherosclerosis or the coagulation disorder, wherein the activator of the IFN receptor is an IFN polypeptide or a polynucleotide encoding the IFN polypeptide, and wherein the IFN polypeptide is a type III IFN.
Description
DESCRIPTION OF THE FIGURES
(1)
(2) 10-week old Apoe.sup./ mice were treated intravenously with vehicle (PBS), 510.sup.8 mock (Ad0) or 510.sup.8 IFN2-expressing adenovirus (AdIFN) at day 0 and day 21. Sera were collected and analyzed at day 24. Total levels of IFN (A) and insulin (B) in the sera of experimental animals are shown. Data are expressed as meanSEM of n=3 mice per group. *p<0.05
(3)
(4) 10-week old Apoe.sup./ mice were treated without or with recombinant IFN3 (5 g/mouse), intraperitoneally twice per week for a total of 16 weeks. Control groups received saline. Sera were then collected and analyzed for the presence of insulin (A) and leptin (B). Data are expressed as meanSEM of n=10-14 mice per group. **p<0.01, ***p<0.001
(5)
(6)
(7) 10-week old Apoe.sup./ mice were treated with recombinant IFN3 (5 g/mouse) twice per week for a total of 16 weeks. Control mice received saline. Weight was measured weakly from week 10 until week 26. Data are expressed as meanSEM of n=3-5 mice per group. *p<0.05, **p<0.01
(8)
(9) 10-week old Apoe.sup./ mice were treated with recombinant IFN3 (5 g/mouse) twice per week for a total of 16 weeks. Control mice received saline. Metabolic measurements were performed using an Oxymax indirect calorimetry system according to standard protocols. Food consumption (A), metabolic rate (B), respiratory exchange rate (C) and oxidation rate activity (D) were evaluated over a 48 h period. Data are expressed as meanSEM of n=3-4 mice per group. *p<0.05
(10)
(11) 10-week old Apoe.sup./ mice were treated intravenously with vehicle (PBS), 510.sup.8 mock (Ad0) or 510.sup.8 IFN2-expressing adenovirus (AdIFN) over 3-week intervals and analyzed for the development of atherosclerosis at 22-weeks. (A) Representative light photomicrographs of ORO-stained sections at the level of the aortic valve and morphometric analysis of lesion size are shown. (B) Representative fluorescence photomicrographs of CD68 and DAPI-stained sections at the level of the aortic valve and morphometric analysis are shown. Data are expressed as meanSEM of n=4-6 mice per group.*p<0.05
(12)
(13) 10-week old Apoe/ mice were treated without or with recombinant IFN3 (5 g/mouse), intraperitoneally twice per week for a total of 12 weeks. Control mice received saline. Mice were analyzed for the development of atherosclerosis at 22-weeks. (A) Representative light photomicrographs of ORO-stained sections at the level of the aortic valve and morphometric analysis of lesion size are shown. (B) Representative fluorescence photomicrographs of CD68 and DAPI-stained sections at the level of the aortic valve and morphometric analysis are shown. Data are expressed as meanSEM of n=10-14 mice per group. ***p<0.001
(14)
(15) 10-week old Apoe.sup./ mice were treated without or with recombinant IFN3 (5 g/mouse), intraperitoneally twice per week for a total of 12 weeks. Control groups received saline. Mice were analyzed for the development of atherosclerosis at 22-weeks by examining macroscopically the aortic arch following staining with Sudan IV. Data are expressed as meanSEM of n=7-8 mice per group.***p<0.001
(16)
(17) Highly purified neutrophils from wild type C57BL/6 mice were exposed to 100 ng/ml of recombinant IFN3 for 8 h and transcriptional analysis was performed by RNA sequencing. Relative expression levels of tissue factor (TF), Cathepsin G (CTSG), elastase (ELANE), peptidyl arginine deiminase type IV (PADI4) and IL-1ra are shown. Data are expressed as meanSEM of n=3 independent experiments. *p<0.05, **p<0.01
(18)
(19) 6-week old wild type C57BL/6 mice fed with high fat diet (HFD) from week 6 onwards were treated with recombinant IFN3 (5 g/mouse) twice per week for a total of 12 weeks. Control mice received saline. Sera were collected at week 18 and analyzed for the presence of proinsulin C-peptide (A) and leptin (B). Data are expressed as meanSEM of n=7-8 mice per group. *p<0.05 **p<0.01,
(20)
(21) 6-week old wild type C57BL/6 mice fed with high fat diet (HFD) from week 6 onwards were treated with recombinant IFN3 (5 g/mouse) twice per week for a total of 12 weeks. Control mice received saline. Sera were collected at week 18 and analyzed for the presence of TNF (A) and MCP-1 (B). Data are expressed as meanSEM of n=7-8 mice per group. *p<0.05 **p<0.01,
(22)
(23) 6-week old wild type C57BL/6 mice fed with high fat diet (HFD) from week 6 onwards were treated with recombinant IFN3 (5 g/mouse) twice per week for a total of 12 weeks. Control mice received saline. Weight was measured weekly from week 6 until week 18. Data are expressed as meanSEM of n=7-8 mice per group. ***p<0.001
(24)
(25) 10-week old wild type C57BL/6 mice fed with high fat diet (HFD) from week 6 onwards were treated therapeutically with recombinant IFN3 (5 g/mouse, arrow) twice per week for a total of 8 weeks. Control mice received saline. Sera were collected at week 18 and analyzed for the presence of proinsulin C-peptide (A) and leptin (B). Data are expressed as meanSEM of n=4 mice per group.*p<0.05
(26)
(27) 10-week old wild type C57BL/6 mice fed with high fat diet (HFD) from week 6 onwards were treated therapeutically with recombinant IFN3 (5 g/mouse, arrow) twice per week for a total of 8 weeks. Control mice received saline. GTT was performed following an overnight fast. Mice received an intraperitoneal injection of 10% D-glucose (1 g/kg body weight) for GTT and an intraperitoneal injection of human regular insulin at a dose of 0.75 U/kg body weight for ITT. Tail vein blood (5-10 al) for OTT was assayed for glucose at 0, 20, 40, 60, 90 and 120 minutes (B) and for ITT at 0, 20, 40, 60 and 120 minutes (A) with Bayer's Contour Next Meter. Data are expressed as mean #SEM of n=3-5 mice per group. #p<0.05, *** p<0.001
(28)
(29) 10-week old wild type C57BL/6 mice fed with high fat diet (HFD) from week 6 onwards were treated therapeutically with recombinant IFN3 (5 g/mouse, arrow) twice per week for a total of 8 weeks. Control mice received saline. Weight was measured weakly from week 6 until week 18. Data are expressed as meanSEM of n=4 mice per group. ***p<0.001
(30)
(31) 6-week old wild type C57BL/6 mice fed with high fat diet (HFD) from week 6 onwards were treated with recombinant IFN3 (5 g/mouse) twice per week for a total of 4 weeks. Control mice received saline. Food consumption in gr/week was measured weakly from week 7 until week 10. Data are expressed as meanSEM of n=4 mice per group. *p<0.05, **p<0.01
(32)
(33) Wild type (WT) C57BL/6 mice, global IFNR.sup./ mice and CD11c.sup.+ cell-specific IFNR.sup./ mice were fed a normal chow diet (NCD). Sera were collected at week 10 and analyzed for the presence of proinsulin C-peptide (A) and leptin (B). Data are expressed as meanSEM of n=4 mice per group.*p<0.05, **p<0.01
(34)
(35) Wild type (WT) C57BL/6 mice, global IFNR.sup./ mice and CD11c.sup. cell-specific IFNR.sup./ mice were fed a normal chow diet (NCD) and their weight measured at week 10 and week 26. Data are expressed as meanSEM of n=10-12 mice per group. ***p<0.001
(36)
(37) Neutrophils from wild type (WT) C57BL/6 mice and IFNR.sup./ mice were isolated and subjected to 100 ng/ml IFN3 or IFN2 for 4h. Cells were then collected, RNA extracted, cDNA obtained and analyzed for the expression of ISGI5 (A) and OAS1 (B) by qPCR. Data are expressed as meanSEM of n=2 experiments per group.
DETAILED DESCRIPTION OF THE INVENTION
Definitions
(38) As used herein, the term activator of IFN receptor refers to any substance, compound or molecule activating IFN receptor. IFN receptor comprises subunits IL10R2 (CRF2-4) and IFNR1 (IL28RA, CRF2-12). Activation of IFN receptor triggers Janus kinase activation (Jak1 and Tyk2) and phosphorylation and activation of the transcription factors STAT1, STAT2 and STAT3, and interferon-regulated transcription factors IRFs. Upon phosphorylation, STATs translocate into the nucleus to induce hundreds of genes altogether termed IFN-stimulated genes or ISGs. Accordingly, an activator of IFN receptor is any substance, compound or molecule triggering these (or other) signaling events via the IFN receptor. For example, the activator of IFN receptor may be a small molecule, an antibody or an antibody fragment, a peptide, a polynucleotide expressing IFN, IFN or an IFN derivative. An activator of IFN receptor may also be an agent that triggers an increase of endogenous IFN in a subject after administration of the agent to the subject.
(39) An activator of the IFN receptor can also be defined as any substance, compound or molecule activating IFNR1. This can be tested in cells expressing or lacking IFNR1 (IL28RA, CRF2-12), the unique alpha subunit of the IFN receptor providing ligand specificity and discriminating it from any other receptor complex. For example, this can be tested in human embryonic kidney cells 293 that express IL-10R/CRF2-4 but lack IFNR1 (HEK293; ATCC) (Hamming O J et al. EMBO J 2013) untransfected or transfected with a plasmid constitutively expressing IFNR1 (e.g. plasmid with catalogue number RC221789 from OriGine Technologies Inc, MD, USA). Specific response to the IFN receptor activator can be determined by examining the activation of downstream signaling such as the phosphorylation of STAT1 by western blotting at 15 and 30 min upon stimulation and/or the induction of Isg15 and Oas1 by qPCR at 6 h upon stimulation. This should be present only in IFNR1 transfected cells but completely absent in untransfected or mock plasmid-transfected cells.
(40) Whether or not a compound is an activator of the IFN receptor can be tested in HEK293-derived cells that stably express the Lucia luciferase secreted reporter gene under the control of the interferon (IFN)-inducible promoter (consisting of the IFN-stimulated genes (ISG) 54 promoter enhanced by a multimeric IFN-stimulated response elements), known as HEK-Lucia Null cells (Catalogue code hkl-null; Invivogen, CA, USA). HEK-Lucia Null cells can be left untransfected or transfected with a plasmid constitutively expressing IFNR1 and examined for the induction of luciferase activity at 6 h following stimulation with the IFN receptor activator.
(41) Alternatively, an activator of the IFN receptor can be examined in THP1-Lucia ISG cells expressing the secreted luciferase reporter gene under the control of an IRF-inducible promoter (consisting of five IFN-stimulated response elements fused to an ISG54 minimal promoter) (Catalogue code thpl-isg; Invivogen, CA, USA). THP1-Lucia ISG cells do not express IFNR1 and do not respond to IFN unless transfected with IFNR1. THP1-Lucia ISG cells, untransfected or transfected with a plasmid constitutively expressing IFNR1, can be assessed for the induction of luciferase activity at 6 h following stimulation with the IFN receptor activator. Only IFNR1-expressing THP1-Lucia ISG cells should respond to the IFN receptor activator.
(42) As used herein, the term IFN refers to lambda interferons, also known as type III IFNs or IL-28/29. The IFN family currently comprises four known members in humans (IFN1/IL-29, IFN2/IL-28A, IFN3/IL-28B and IFN4) and two in mice (IFN2/IL-28A, IFN3/IL-28B). In a preferred embodiment, human IFN1 has the amino acid sequence depicted in SEQ ID NO: 1. In a preferred embodiment, human IFN2 has the amino acid sequence depicted in SEQ ID NO: 2. In a preferred embodiment, human IFN3 has the amino acid sequence depicted in SEQ ID NO: 3 or the amino acid sequence depicted in SEQ ID NO: 4. In a more preferred embodiment, human IFN3 has the amino acid sequence depicted in SEQ ID NO: 4. In a preferred embodiment, human IFN4 has the amino acid sequence depicted in SEQ ID NO: 5. In a further preferred embodiment, human IFN1 comprises the amino acid sequence depicted in SEQ ID NO: 1. In a further preferred embodiment, human IFN2 comprises the amino acid sequence depicted in SEQ ID NO: 2. In a further preferred embodiment, human IFN3 comprises the amino acid sequence depicted in SEQ ID NO: 3 or the amino acid sequence depicted in SEQ ID NO: 4. In a more preferred embodiment, human IFN3 comprises the amino acid sequence depicted in SEQ ID NO: 4. In a further preferred embodiment, human IFN4 comprises the amino acid sequence depicted in SEQ ID NO: 5.
(43) The term IFN further comprises variants and functional equivalents of IFN1/IL-29, IFN2/IL-28A, IFN3/IL-28B and IFN4. By variants substantially similar amino acid sequences are intended. The IFN polypeptides in accordance with the present invention may be altered in various ways including amino acid substitutions, deletions, truncations and insertions. They may also undergo posttranslational modification. Novel proteins having properties of interest may be created by combining elements and fragments of IFN proteins or their receptors, as well as with other proteins. Methods for such manipulations are generally known in the art. The IFN proteins encompass naturally occurring proteins as well as variations and modified forms thereof. Such variants will continue to possess the desired IFN activity. Obviously, the mutations that will be made in the DNA encoding the variant must not place the sequence out of reading frame and should preferably not create complementary regions that could produce secondary mRNA structure. Variants of a particular protein sequence will have generally at least about 90%, preferably at least about 95% and more preferably at least about 98% sequence identity to that particular protein sequence as determined by sequence alignment programs. In calculating percent identity, the sequences being compared are typically aligned in a way that gives the largest match between the sequences. One example of a computer program that can be used to determine percent identity is the GCG program package, which includes GAP (Devereux et al., 1984, Nucl. Acid Res. 12:387; Genetics Computer Group, University of Wisconsin, Madison, WI). The computer algorithm GAP is used to align the two polypeptides or polynucleotides for which the percent sequence identity is to be determined. The sequences are aligned for optimal matching of their respective amino acids (the matched span, as determined by the algorithm). A gap opening penalty (which is calculated as 3 the average diagonal, wherein the average diagonal is the average of the diagonal of the comparison matrix being used; the diagonal is the score or number assigned to each perfect amino acid match by the particular comparison matrix) and a gap extension penalty (which is usually 1/10 times the gap opening penalty), as well as a comparison matrix such as PAM 250 or BLOSUM 62 are used in conjunction with the algorithm.
(44) TABLE-US-00001 Interferonlambda-1[Homosapiens] Accession:NP_742152.1 SEOIDNO:1 MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELAS FKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALT LKVLEAAAGPALEDVLQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHH WLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHP EST Interferonlambda-2[Homosapiens] Accession:NP_742150.1 SEQIDNO:2 MKLDMTGDCTPVLVLMAAVLTVTGAVPVARLHGALPDARGCHIAQFKSL SPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMAL EAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTA GPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASG DLCV Interferonlambda-3isoform1[Homosapiens] Accession:NP_001333866.1 SEQIDNO:3 MKLDMTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSL SPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVAL EAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTA GPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASG DLCV Interferonlambda-3isoform2[Homosapiens] Accession:NP_742151.2 SEQIDNO:4 MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQE LQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAEL ALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRT RGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV Interferonlambda-4[Homosapiens] Accession:NP_001263183.2 SEQIDNO:5 MRPSVWAAVAAGLWVLCTVIAAAPRRCLLSHYRSLEPRTLAAAKALRDR YEEEALSWGQRNCSFRPRRDPPRPSSCARLRHVARGIADAQAVLSGLHR SELLPGAGPILELLAAAGRDVAACLELARPGSSRKVPGAQKRRHKPRRA DSPRCRKASVVFNLLRLLTWELRLAAHSGPCL
(45) As used herein, the term IFN receptor refers to a receptor complex comprising subunits IL10R (IL10R2, CRF2-4) and IFNR (IFNR1, IL28RA, CRF2-12). For the activation of the IFN receptor, an activator of IFN receptor binds IFNR which subsequently associates with IL10R3. Accordingly, the IFN receptor complex forms sequentially in a two-step binding event. First, the IFNR subunit binds to IFN with high affinity, which in the second step assemble to the IL-10R subunit, forming the ternary complex at a 1:1:1 IFN/IFNR/IL-10R stoichiometry. The assembled complex transmits the signal by Janus kinase activation (Jak1 and Tyk2) and phosphorylation and activation of the transcription factors STAT1, STAT2 and STAT3, and interferon-regulated transcription factors IRFs.
(46) As used herein, the term obesity-related disorders refers to any disease or condition directly or indirectly linked to overweight and/or obesity. Obesity-related disorders may be inherited or acquired. Preferred, although non-limiting, examples for obesity-related disorders in the sense of the present invention are obesity, hyperphagia, prediabetes, diabetes, insulin resistance, metabolic disease, metabolic syndrome, atherosclerosis, coronary heart disease, carotid artery disease, myocardial infarction, stroke, hyperglycemia, impaired glucose tolerance, beta cell deficiency, non-alcoholic steatotic liver disease, steatosis of the liver, polycystic ovarian syndrome, dyslipidemia, hyperlipidemia, hypercholesterolemia, hyperketonemia, hyperglucagonemia, pancreatitis, pancreatic neoplasms, cardiovascular disease, hypertension, coronary artery disease, renal failure, neuropathy, diabetic retinopathy, cataracts, endocrine disorders, sleep apnea, polycystic ovarian syndrome, neoplasms of the breast, colon, prostate, rectum and ovary, osteoarthritis, hyperuricemia heart failure and cerebrovascular disease.
(47) As used herein, the term atherosclerosis refers to a disease affecting arterial blood vessels, involving the hardening (calcification) of arteries, the development of atheromatous plaques within the arteries and the formation of thrombi, triggering thrombotic or thromboembolytic events. Atherosclerosis can be viewed as a problem of wound healing and chronic inflammation. It results in inward or outward remodeling causing blood vessel stenosis and infarction or blood vessel enlargement and aneurysm, respectively. In either case, atherosclerotic plaques can erode or rupture and trigger acute clinical complications such as brain strokes, heart attacks and peripheral artery occlusive diseases in the lower extremities. The pathophysiology of atherosclerosis comprises various important steps, including enhanced endothelial focal adhesiveness, permeability and pro-coagulation (endothelial dysfunction), expression of adhesion molecules, monocyte adhesion and immigration, formation of foam cell and fatty streaks, smooth muscle cell (SMC) migration from the tunica media into the tunica intima, plaque formation and finally, plaque rupture and thrombus formation. A prevalent theme in atherosclerosis is thus the presence of oxidative stress and inflammation, due to the oxidation of LDL and other lipid-rich material.
(48) As used herein, the term coagulation disorder refers to conditions wherein increased blood clotting (hypercoagulation) occurs. Increased blood clotting may result in the formation of thrombi, e.g., formation of thrombi in veins, arteries or cardiac chambers. Thrombi can block blood flow at the site of formation. Thrombi can also detach and block distant blood vessels. The coagulation cascade involves>50 mediators with pro- or anti-coagulant activities and is triggered through the activation of platelets and or the induction of tissue factor that activate the contact (intrinsic) and tissue factor (extrinsic) pathways, respectively. Coagulation disorder may be the result of predisposing factors, e.g., genetic mutations. Coagulation disorder may also be a consequence of, e.g., surgery or trauma, prolonged immobilization, medication, obesity or atherosclerosis.
(49) As used herein, the term obesity means obese according to any classification system of body weight. Such systems include, but are not limited to, the body mass index (BMI), BMI prime or equivalents. BMI, for example, is an analytical tool used to compare a person's height with their weight, as a rough measure of adiposity. BMI is calculated by dividing a person's mass (in kg) by the height (in m) squared. A human individual is classified as obese, when the BMI value is greater than or equal to 30 (kg/m.sup.2). The term obesity includes morbid obesity (i.e. BMI greater than or equal to 40 (kg/m.sup.2)), childhood obesity and any other kind of obesity in which the subject's BMI is greater than or equal to 30 (kg/m.sup.2). Obesity occurs as a result of complex interactions between genes and the environment regulating energy balance, linked pathophysiological processes, and weight. Through a coordinated network of central mechanisms and peripheral signals including sensory nervous system inputs, neuroendocrine axes, and multiple cells and processes within adipose tissue, stomach, pancreas and liver, food intake and energy expenditure are controlled and can lead to excess adiposity, weight gain and diverse metabolic and physiological effects.
(50) As used herein, the term overweight means overweight according to any classification system of body weight. An individual is classified as overweight, per BMI for example, when their BMI value is equal to or greater than 25.
(51) As used herein, the term diabetes refers to any disease characterized by a high concentration of blood glucose (hyperglycemia). For example, diabetes is diagnosed by demonstrating any one of the following: (i) a fasting plasma glucose level at or above 126 mg/dL (7.0 mmol/I), (ii) a plasma glucose at or above 200 mg/dL (11.1 mmol/I) two hours after a 75 g oral glucose load as in a glucose tolerance test or (iii) symptoms of hyperglycemia and casual plasma glucose at or above 200 mg/dL (11.1 mmol/I). As used herein, the term diabetes refers to type 1 diabetes also known as childhood-onset diabetes, juvenile diabetes and insulin-dependent diabetes. As used herein, the term diabetes also refers to type 2 diabetes also known as adult-onset diabetes, obesity-related diabetes and non-insulin-dependent diabetes. As used herein, the term diabetes also refers to other forms of diabetes including gestational diabetes, insulin-resistant type 1 diabetes (or double diabetes), latent autoimmune diabetes of adults and maturity onset diabetes of the young, which is a group of several single gene (monogenic) disorders with strong family histories that present as type 2 diabetes before 30 years of age.
(52) As used herein, the term insulin resistance refers to a condition wherein the cells of the body, in particular muscle, fat and liver cells, fail to effectively respond to insulin. Accordingly, the pancreas increases insulin production. Excess weight also contributes to the development of insulin resistance, as excess fat interferes with the body's ability to use insulin. Lack of exercise further reduces the body's ability to use insulin. Further risk factors for developing insulin resistance include genetic factors, hypertension, age and lifestyle.
(53) As used herein, the term metabolic syndrome or metabolic disease refers to the physiological condition in mammals that is typically characterized by obesity, insulin resistance, hyperlipidemia and hypertension. It may further encompass vascular abnormalities such as endothelial dysfunction, vascular pro-inflammatory condition and vascular pro-coagulative and pro-thrombotic conditions. Metabolic syndrome also refers to syndromes accompanied by health risk factors such as hypertriglyceridemia, hypertension, carbohydrate metabolism disorders, blood coagulation disorders and obesity. Metabolic syndrome may also include glucose intolerance, dyslipidemia with elevated triglycerides, low HDL-cholesterol, microalbuminuria, predominance of small dense LDL-cholesterol particles, endothelial dysfunction, oxidative stress, inflammation and related disorders of polycystic ovarian syndrome, fatty liver disease and gout. Metabolic disease or metabolic syndrome is a suspected precursor to a wide range of diseases, including type 2 diabetes, cardiovascular disease, stroke, cancer, polycystic ovary syndrome, gout and asthma.
(54) As used herein, the term dyslipidemia refers to abnormal levels of lipids (e.g., triglycerides, cholesterol and/or fat phospholipids) in the blood. Dyslipidemia in the sense of the present invention is in particular hyperlipidemia.
(55) As used herein, the term hyperlipidemia refers to abnormally elevated levels of any or all lipids and/or lipoproteins in the blood. Hyperlipidemias may basically be classified as either familial (also called primary) caused by specific genetic abnormalities, or acquired (also called secondary) when resulting from another underlying disorder that leads to alterations in plasma lipid and lipoprotein metabolism. Also, hyperlipidemia may be idiopathic, that is, without known cause. Hyperlipidemias are also classified according to which types of lipids are elevated, that is hypercholesterolemia, hypertriglyceridemia or both in combined hyperlipidemia. Elevated levels of Lipoprotein (a) may also be classified as a form of hyperlipidemia.
(56) As used herein, hypercholesterolemia refers to the presence of abnormally high levels of cholesterol in the blood. It is a form of high blood lipids and hyperlipoproteinemia (elevated levels of lipoproteins in the blood). Elevated levels of non-HDL cholesterol and LDL in the blood may be a consequence of diet, obesity, inherited (genetic) diseases (such as LDL receptor mutations in familial hypercholesterolemia), or the presence of other diseases such as diabetes and an underactive thyroid.
(57) As used herein, cardiovascular disorder or cardiovascular disease refers to conditions involving the heart and/or blood vessels. Cardiovascular disease includes, but is not limited to, coronary artery diseases, stroke, heart failure, hypertensive heart disease, rheumatic heart disease, cardiomyopathy, heart arrhythmia, congenital heart disease, valvular heart disease, carditis, aortic aneurysms, peripheral artery disease, and venous thrombosis.
(58) As used herein, coronary heart disease refers to is a group of diseases that includes: stable angina, unstable angina, myocardial infarction, and sudden cardiac death. It belongs to the group of cardiovascular diseases. Risk factors for developing coronary heart disease include: high blood pressure, smoking, diabetes, lack of exercise, obesity, high blood cholesterol, poor diet, and excessive alcohol.
Medical Uses and Methods of Treatment or Prevention
(59) In one embodiment of the invention, an activator of IFN receptor for use in the treatment of obesity-related disorders is provided. Further provided is a method of treating an obesity-related disorder comprising administering a therapeutically effective amount of an activator of IFN receptor to a subject in need of such treatment. In another embodiment, an activator of IFN receptor for use in the prevention of obesity-related disorders is provided. Further provided is a method for preventing an obesity-related disorder comprising administering a therapeutically effective amount of an activator of IFN receptor to a subject in need of such prevention.
(60) In one embodiment, the obesity-related disorder is obesity, hyperphagia, prediabetes, diabetes (including type 1 diabetes, type 2 diabetes, and gestational diabetes), insulin resistance, metabolic disease, metabolic syndrome, atherosclerosis, coronary heart disease, carotid artery disease, myocardial infarction, stroke, thrombosis, coagulation, dyslipidemia, hyperlipidemia or hypercholesterolemia.
(61) The Present Invention Inter Alia Encompasses the Following Items: 1. An activator of IFN receptor for use in the prevention or treatment of an obesity-related disorder in a subject. 2. A method of preventing or treating an obesity-related disorder in a subject comprising administering a therapeutically effective amount of an activator of IFN receptor to the subject in need of such treatment or prevention. 3. The activator of IFN receptor for the use or the method of item 1 or item 2, wherein the obesity-related disorder is selected from the group consisting of obesity, hyperphagia, prediabetes, diabetes (including type 1 diabetes, type 2 diabetes, and gestational diabetes), insulin resistance, metabolic disease, metabolic syndrome, coronary heart disease, carotid artery disease, myocardial infarction, stroke, thrombosis, dyslipidemia, hyperlipidemia or hypercholesterolemia. 4. The activator of IFN receptor for the use or the method of item 3, wherein the obesity-related disorder is obesity. 5. The activator of IFN receptor for the use or the method of item 3, wherein the diabetes is type 1 diabetes or type 2 diabetes. 6. An activator of IFN receptor for use in the therapeutic reduction of body weight in a subject. 7. A method for therapeutic reduction of body weight in a subject comprising administering an activator of IFN receptor to the subject. 8. An activator of IFN receptor for use in the therapeutic reduction of overweight in a subject. 9. A method for therapeutic reduction of overweight in a subject comprising administering an activator of IFN receptor to the subject. 10. Use of an activator of IFN receptor for the non-therapeutic reduction of body weight in a subject, optionally wherein the non-therapeutic reduction of body weight involves the suppression of appetite and/or the suppression of overeating. 11. A method for non-therapeutic reduction of body weight in a subject comprising administering an activator of IFN receptor to the subject, optionally wherein the non-therapeutic reduction of body weight involves the suppression of appetite and/or the suppression of overeating. 12. Use of an activator of IFN receptor for the non-therapeutic reduction of overweight in a subject, optionally wherein the non-therapeutic reduction of overweight involves the suppression of appetite and/or the suppression of overeating. 13. A method for non-therapeutic reduction of overweight in a subject comprising administering an activator of IFN receptor to the subject, optionally wherein the non-therapeutic reduction of overweight involves the suppression of appetite and/or the suppression of overeating. 14. The activator of IFN receptor for the use, the use, or the method of any one of items 1-13, wherein the subject is a mammalian subject. 15. The activator of IFN receptor for the use, the use, or the method of any one of items 1-13, wherein the subject is a human. 16. The activator of IFN receptor for the use, the use, or the method of any one of items 1-15, wherein the activator of IFN receptor is administered in combination with one or more further therapeutic agent(s). 17. The activator of IFN receptor for the use, the use, or the method of item 16, wherein the further therapeutic agent(s) is/are selected from the group consisting of insulin, metformin (Glucophage), meglitinides (Prandin and Starlix), sulfonylureas (glyburide/DiaBeta, glipizide/Glucotrol and Glimepiride/Amaryl), canagliflozin (Invokana) and dapagliflozin (Farxiga), thiazolidinediones, such as pioglitazone (Actos), acarbose (Precose), pramlintide (Symlin), exenatide (Byetta), liraglutide (Victoza), long-acting exenatide (Bydureon), albiglutide (Tanzeum), dulaglutide (Trulicity), DPP-IV inhibitors (sitagliptin, saxagliptin, linagliptin), phentermine, diethylpropion, phendimetrazine, benzphetamine, oxyntomodulin, fluoxetine hydrochloride, qnexa (topiramate and phentermine), excalia (bupropion and zonisamide), contrave (bupropion and naltrexone), xenical (Orlistat), cetilistat, and GT 389-255, statins, cholesterol lowering drugs such as proprotein convertase subtilisin kexin type 9 (PCSK9) inhibitors, ACE inhibitors, aldosterone inhibitors, angiotensin II receptor blockers, beta-blockers, calcium channel blockers, antiplatelets such as aspirin, clopidogrel (Plavix) or dipyridamole (Persantine), anti-coagulants such as warfarin (Coumadin), heparin, direct factor Xa inhibitors, direct thrombin inhibitors, hydralazine, diuretics, corticosteroids, non-steroidal anti-inflammatory drugs, anti-TNF, anti-IL-1 and anti-IL-6. 18. The activator of IFN receptor for the use, the use, or the method of any one of items 1-17, wherein the activator of IFN receptor is a small molecule, an antibody or an antibody fragment, a peptide, a polynucleotide expressing IFN, IFN or an IFN derivative. 19. The activator of IFN receptor for the use, the use, or the method of item 18, wherein the activator of IFN receptor is IFN. 20. The activator of IFN receptor for the use, the use, or the method of item 19, wherein the IFN is human IFN. 21. The activator of IFN receptor for the use, the use, or the method of item 20, wherein the IFN is selected from the group consisting of IFN1, IFN2, IFN3 and IFN4. 22. The activator of IFN receptor for the use, the use, or the method of item 21, wherein the IFN is IFN1. 23. The activator of IFN receptor for the use, the use, or the method of item 21, wherein the IFN is IFN2. 24. The activator of IFN receptor for the use, the use, or the method of item 21, wherein the IFN is IFN3. 25. The activator of IFN receptor for the use, the use, or the method of item 21, wherein the IFN is IFN4. 26. The activator of IFN receptor for the use, the use, or the method of any one of items 19-25, wherein a mammal is treated with homologous IFN. 27. The activator of IFN receptor for the use, the use, or the method of any one of items 19-26, wherein the IFN is pegylated, in particular monopegylated or conjugated with a polyalkyl oxide moiety. 28. The activator of IFN receptor for the use, the use, or the method of any one of items 19-27, wherein the IFN is administered via intravenous, intraperitoneal, subcutaneous or intramuscular injection; via oral, topical or transmucosal administration; or via nasal or pulmonary inhalation. 29. The activator of IFN receptor for the use, the use, or the method of any one of items 19-27, wherein the IFN is administered via gene-therapy. 30. The activator of IFN receptor for the use, the use, or the method of any one of items 19-29, wherein the IFN is administered weekly. 31. The activator of IFN receptor for the use, the use, or the method of any one of items 19-29, wherein the IFN is administered every two weeks. 32. The activator of IFN receptor for the use, the use, or the method of any one of items 19-29, wherein the IFN is administered twice a week. 33. The activator of IFN receptor for the use, the use, or the method of any one of items 19-32, wherein the IFN is administered at a dose of 10 g to 10 mg. 34. The activator of IFN receptor for the use, the use, or the method of item 33, wherein the IFN is administered at a dose of 100 g to 9 mg. 35. The activator of IFN receptor for the use, the use, or the method of item 34, wherein the IFN is administered at a dose of 500 g to 8 mg. 36. The activator of IFN receptor for the use, the use, or the method of item 35, wherein the IFN is administered at a dose of 1 mg to 7 mg. 37. The activator of IFN receptor for the use, the use, or the method of item 36, wherein the IFN is administered at a dose of 2 mg to 6 mg. 38. The activator of IFN receptor for the use, the use, or the method of item 37, wherein the IFN is administered at a dose of 5 mg. 39. The activator of IFN receptor for the use, the use, or the method of any one of items 19-32, wherein the IFN is administered at a dose of 0.1-150 g/kg body weight. 40. The activator of IFN receptor for the use, the use, or the method of item 39, wherein the IFN is administered at a dose of 0.5-100 g/kg body weight. 41. The activator of IFN receptor for the use, the use, or the method of item 40, wherein the IFN is administered at a dose of 1-90 g/kg body weight. 42. The activator of IFN receptor for the use, the use, or the method of item 41, wherein the IFN is administered at a dose of 10-80 g/kg body weight. 43. The activator of IFN receptor for the use, the use, or the method of item 42, wherein the IFN is administered at a dose of 20-70 g/kg body weight. 44. The activator of IFN receptor for the use, the use, or the method of item 43, wherein the IFN is administered at a dose of 60 g/kg body weight. 45. A method of determining susceptibility of a subject suffering from an obesity-related disorder to treatment with an activator of IFN receptor, wherein the method comprises administering the activator of IFN receptor to the subject and determining the effect on the obesity-related disorder. 46. An activator of IFN receptor for use in determining susceptibility of a subject suffering from an obesity-related disorder to treatment with the activator of IFN receptor, wherein the activator of IFN receptor is administered to the subject and the effect on the obesity-related disorder is determined. 47. A pharmaceutical composition comprising an activator of IFN receptor and a pharmaceutically acceptable excipient for use in the treatment of an obesity-related disorder.
(62) In one embodiment of the invention, an activator of IFN receptor for use in the treatment of atherosclerosis is provided. Further provided is a method of treating atherosclerosis comprising administering a therapeutically effective amount of an activator of IFN receptor to a subject in need of such treatment. In another embodiment, an activator of IFN receptor for use in the prevention of atherosclerosis is provided. Further provided is a method for preventing atherosclerosis comprising administering a therapeutically effective amount of an activator of IFN receptor to a subject in need of such prevention.
(63) In one embodiment, the atherosclerosis is atherosclerosis, Mnckeberg's arteriosclerosis or arteriolosclerosis.
(64) In one embodiment of the invention, an activator of IFN receptor for use in the treatment of coagulation disorders is provided. Further provided is a method of treating a coagulation disorder comprising administering a therapeutically effective amount of an activator of IFN receptor to a subject in need of such treatment. In another embodiment, an activator of IFN receptor for use in the prevention of coagulation disorders is provided. Further provided is a method for preventing coagulation disorders comprising administering a therapeutically effective amount of an activator of IFN receptor to a subject in need of such prevention.
(65) In one embodiment, the coagulation disorder is thrombosis, venous thrombosis, deep vein thrombosis, arterial thrombosis, limb ischemia, stroke or myocardial infarction.
(66) In a preferred embodiment, an activator of IFN receptor for use in the treatment of obesity is provided.
(67) In another preferred embodiment, an activator of IFN receptor for use in the treatment of prediabetes or diabetes (including type 1 diabetes, type 2 diabetes, and gestational diabetes) is provided.
(68) In another preferred embodiment, an activator of IFN receptor for use in the treatment of metabolic disease or metabolic syndrome is provided.
(69) In another preferred embodiment, an activator of IFN receptor for use in the treatment of coronary heart disease is provided.
(70) In another preferred embodiment, an activator of IFN receptor for use in the treatment of stroke is provided.
(71) In another preferred embodiment, an activator of IFN receptor for use in the treatment of thrombosis is provided.
(72) In another preferred embodiment, an activator of IFN receptor for use in the treatment of hypercholesterolemia is provided.
(73) In a preferred embodiment, an activator of IFN receptor for use in the prevention of obesity is provided.
(74) In another preferred embodiment, an activator of IFN receptor for use in the prevention of prediabetes or diabetes (including type 1 diabetes, type 2 diabetes, and gestational diabetes) is provided.
(75) In another preferred embodiment, an activator of IFN receptor for use in the prevention of metabolic disease or metabolic syndrome is provided.
(76) In another preferred embodiment, an activator of IFN receptor for use in the prevention of coronary heart disease is provided.
(77) In another preferred embodiment, an activator of IFN receptor for use in the prevention of stroke is provided.
(78) In another preferred embodiment, an activator of IFN receptor for use in the prevention of thrombosis is provided.
(79) In another preferred embodiment, an activator of IFN receptor for use in the prevention of hypercholesterolemia is provided.
(80) Also provided in a preferred embodiment of the present invention is an activator of IFN receptor for use for the reduction of atheromatic plaque formation and rupture.
(81) Also provided in a preferred embodiment of the present invention is an activator of IFN receptor for use for the prevention of atheromatic plaque formation and rupture.
(82) Further conditions that can be treated or prevented with an activator of IFN receptor in accordance with the invention include, but are not limited to, hyperglycemia, impaired glucose tolerance, beta cell deficiency, non-alcoholic steatotic liver disease, steatosis of the liver, hyperlipidemia, dyslipidemia, hyperketonemia, hyperglucagonemia, pancreatitis, pancreatic neoplasms, cardiovascular disease, hypertension, coronary artery disease, renal failure, neuropathy, diabetic retinopathy, cataracts, endocrine disorders, sleep apnea, polycystic ovarian syndrome, neoplasms of the breast, colon, prostate, rectum and ovary, osteoarthritis, hyperuricemia heart failure and cerebrovascular disease.
(83) Also, according to the present invention an activator of IFN receptor can be used in regulating insulin responsiveness in a patient. In one embodiment, an activator of IFN receptor restores insulin sensitivity or responsiveness. In a further embodiment, an activator of IFN receptor generates insulin sensitivity or responsiveness. In another embodiment, an activator of IFN receptor increases glucose uptake by a cell.
(84) Further provided in accordance with the present invention is the use of an activator of IFN receptor for the non-therapeutic reduction of body weight. Such reduction of weight may be achieved by the suppression of appetite. Also, such reduction of weight may be achieved by the reduction of overeating. In one embodiment, a use of an activator of IFN receptor for the reduction of weight in an individual is provided. In a further embodiment, a use of an activator of IFN receptor for maintaining a certain weight in an individual is provided. Weight maintenance may be desirable after weight loss.
(85) Also provided in accordance with the present invention is an activator of IFN receptor for use in the therapeutic reduction of body weight. Such reduction of weight may be achieved by the suppression of appetite. Also, such reduction of weight may be achieved by the reduction of overeating. In one embodiment, an activator of IFN receptor for use in the therapeutic reduction of weight in an individual is provided. In a further embodiment, an activator of IFN receptor for use in maintaining a certain weight in an individual is provided. Weight maintenance may be desirable after weight loss.
(86) Also provided is a method for the reduction of body weight in a subject, comprising administering an effective amount of an activator of IFN receptor to the subject. Such reduction of weight may be achieved by the suppression of appetite. Also, such reduction of weight may be achieved by the reduction of overeating. In one embodiment, a method for the reduction of weight in an individual is provided, comprising administering an effective amount of an activator of IFN receptor to the subject. Further provided is a method for maintaining weight in an individual, comprising administering an effective amount of an activator of IFN receptor to the subject. Weight maintenance may be desirable after weight loss.
(87) The patients or subjects to be treated, analyzed or diagnosed in accordance with the methods and uses of the present invention may be any kind of mammals, such as mice, rats, hamsters, guinea pigs, cats, dogs, horses, monkeys, camels, lamas, lions, tigers and elephants. In a preferred embodiment, the patient or subject is a human.
(88) In one embodiment, the activator of the IFN receptor is a small molecule. In a further embodiment, the activator of the IFN receptor is an antibody or an antibody fragment. In another embodiment, the activator of the IFN receptor is a peptide. In yet another embodiment, the activator of the IFN receptor is a polynucleotide expressing IFN. Further, the activator of the IFN receptor may be IFN or an IFN derivative. In one embodiment, the activator of the IFN receptor is an agent that triggers an increase of endogenous IFN.
(89) In one embodiment, the activator of the IFN receptor binds to the IFN receptor and triggers Jak1 and Tyk2 activation. In a further embodiment, the activator of the IFN receptor binds to the IFN receptor and mediates STAT1, STAT2 and/or STAT3 phosphorylation. In another embodiment, the activator of the IFN receptor binds to the IFN receptor and mediates STAT1, STAT2 and/or STAT3 translocation into the nucleus. In another embodiment, the activator of the IFN receptor binds to the IFN receptor and mediates gene transcription.
(90) In one embodiment, the activator of IFN receptor is IFN. The IFN may be human IFN. In one embodiment, the IFN is IFN1, in particular human IFN1. In a further embodiment, the IFN is IFN2, in particular human IFN2. In another embodiment, the IFN is IFN3, in particular human IFN3. In yet another embodiment, the IFN, is IFN4, in particular human IFN4.
(91) The IFN to be used or administered in accordance with the present invention may be derived from any mammalian species. In a preferred embodiment, the IFN is homologous with respect to the mammal, i.e., it represents IFN from the same species as the mammal to be treated. For example, in one embodiment where the patient or subject is a mouse, murine IFN is administered. Further, where the patient or subject is a human, the IFN that is used or administered in connection with the treatment or prevention of the present invention is human IFN.
(92) IFN may be prepared from a number of different sources. For example, recombinant IFN can be expressed in a cell using a number of different expression systems (both prokaryotic or eukaryotic) and isolated. Optionally, IFN may be fused to a protein tag. Recombinant IFN may be expressed, secreted into the supernatant, and IFN may then be purified from the supernatant. Methods by which recombinant polypeptide can be expressed and purified from cells are well known in the art. Such methods are disclosed, e.g., in Sambrook et al, Molecular Cloning: A Laboratory Manual. 2001. 3rd edition. IFN may also be synthetically synthesized in a cell-free in vitro system. This may use purified RNA polymerase, ribosomes, tRNA and ribonucleotides.
(93) In one embodiment, the IFN is conjugated to PEG. In one embodiment, the IFN is monopegylated. PEGylation is a method wherein a polypeptide or peptidomimetic compound is modified such that one or more polyethylene glycol (PEG) molecules are covalently attached to the side chain of one or more amino acids or derivatives thereof. It is one of the most important molecule altering structural chemistry techniques (MASC). Other MASC techniques may be used as well. Such techniques may improve the pharmacodynamic properties of the IFN, for example increasing the half-life in vivo. A PEG-protein conjugate may be formed by first activating the PEG moiety so that it will react with, and couple to, the protein or peptidomimetic compound. PEG moieties can vary considerably in molecular weight and conformation. PEG2 involves coupling of a 30 kDa (or less) PEG to a lysine amino acid (although PEGylation can be extended to the addition of PEG to other amino acids) that is further reacted to form a branched structure that behaves like a linear PEG of much greater molecular weight (Kozlowski et al., (2001), Biodrugs 15, 419-429). Methods that may be used to covalently attach the PEG molecules to polypeptides are further described in Roberts et al., (2002) Adv. Drug Deliv Rev 54, 459-476, Bhadra et al., (2002) Pharmazie 57, 5-29, Kozlowski et al., (2001) J Control Release 72, 217-224, and Veronese (2001) Biomaterials, 22, 405-417 and references referred to therein. Pegylated IFN can also be prepared as described in, e.g., WO 2013028233.
(94) IFN may be conjugated to any other suitable moiety. For example, the IFN may be conjugated with a polyalkyl oxide moiety.
(95) Diagnostic Uses and Methods
(96) In one embodiment, an activator of IFN receptor for use in determining susceptibility of a patient suffering from an obesity-related disorder to treatment with the activator of IFN receptor is provided, wherein the activator of IFN receptor is administered to the patient and the effect on the obesity-related disorder is determined. Also provided is a method of determining susceptibility of a patient suffering from an obesity-related disorder to treatment with an activator of IFN receptor, wherein the method comprises administering the activator of IFN receptor to the patient and determining the effect on the obesity-related disorder.
(97) An improvement of the obesity-related disorder indicates that the patient is susceptible to treatment with an activator of IFN receptor. Improvement of the obesity-related disorder may be measured using established means, such as determining levels of metabolic compounds in a subject or determining weight loss in a subject.
(98) In one embodiment, an activator of IFN receptor for use in determining susceptibility of a patient suffering from atherosclerosis to treatment with the activator of IFN receptor is provided, wherein the activator of IFN receptor is administered to the patient and the effect on the atherosclerosis is determined. Also provided is a method of determining susceptibility of a patient suffering from atherosclerosis to treatment with an activator of IFN receptor, wherein the method comprises administering the activator of IFN receptor to the patient and determining the effect on the atherosclerosis.
(99) An improvement of the atherosclerosis indicates that the patient is susceptible to treatment with an activator of IFN receptor.
(100) In one embodiment, an activator of IFN receptor for use in determining susceptibility of a patient suffering from a coagulation disorder to treatment with the activator of IFN receptor is provided, wherein the activator of IFN receptor is administered to the patient and the effect on the coagulation disorder is determined. Also provided is a method of determining susceptibility of a patient suffering from a coagulation disorder to treatment with an activator of IFN receptor, wherein the method comprises administering the activator of IFN receptor to the patient and determining the effect on the coagulation disorder.
(101) An improvement of the coagulation disorder indicates that the patient is susceptible to treatment with an activator of IFN receptor.
(102) Modes of Administration
(103) The activator of IFN receptor may be formulated as a pharmaceutical composition comprising the activator of IFN receptor and a pharmaceutically acceptable excipient. The activator of IFN receptor, or the composition comprising the activator of IFN receptor, may be employed alone or in combination with further therapeutic agents (combination) for the treatment or prevention of the conditions, or for the diagnostic purposes, described or claimed herein. The further therapeutic agent(s) may be one or more agents that exhibit therapeutic activity in one or more of the metabolic disorders described herein, or the pathological conditions associated therewith. Further therapeutic agents that can be administered in combination with the activator of IFN receptor include, but are not limited to, insulin, metformin (Glucophage), meglitinides (Prandin and Starlix), sulfonylureas (glyburide/DiaBeta, glipizide/Glucotrol and Glimepiride/Amaryl), canagliflozin (Invokana) and dapagliflozin (Farxiga), thiazolidinediones such as pioglitazone (Actos), acarbose (Precose), pramlintide (Symlin), exenatide (Byetta), liraglutide (Victoza), long-acting exenatide (Bydureon), albiglutide (Tanzeum), dulaglutide (Trulicity), DPP-IV inhibitors (sitagliptin, saxagliptin, linagliptin), phentermine, diethylpropion, phendimetrazine, benzphetamine, oxyntomodulin, fluoxetine hydrochloride, qnexa (topiramate and phentermine), excalia (bupropion and zonisamide), contrave (bupropion and naltrexone), xenical (Orlistat), cetilistat, and GT 389-255, statins, cholesterol lowering drugs such as proprotein convertase subtilisin kexin type 9 (PCSK9) inhibitors, ACE inhibitors, aldosterone inhibitors, angiotensin II receptor blockers, beta-blockers, calcium channel blockers, antiplatelets such as aspirin, clopidogrel (Plavix) or dipyridamole (Persantine), anti-coagulants such as warfarin (Coumadin), heparin, direct factor Xa inhibitors, direct thrombin inhibitors, hydralazine, diuretics, corticosteroids, non-steroidal anti-inflammatory drugs, anti-TNF, anti-IL-1 and anti-IL-6.
(104) In some embodiments, the compounds or compositions provided herein and the further therapeutic agent or agents are administered together, while in other embodiments, the compounds or compositions provided herein and the additional therapeutic agent or agents are administered separately. When administered separately, administration may occur simultaneously or sequentially, in any order.
(105) The amounts of the compounds or compositions provided herein and the other therapeutic agent(s) and the relative timing of administration will be selected by the skilled artisan in order to achieve the desired combined therapeutic effect. The administration in combination of a compound or composition provided herein with other treatment agents may be in combination by administration concomitantly in a unitary composition including both therapeutic agents or in separate compositions each including one of the therapeutic agents. Alternatively, the combination may be administered separately in a sequential manner wherein one treatment agent is administered first and the other second or vice versa. Such sequential administration may be close in time or remote in time.
(106) The activator of IFN receptor, the composition comprising the activator of IFN receptor and the combinations can be administered by any route, including intravenous, intraperitoneal, subcutaneous, and intramuscular injection; via oral, topical, transmucosal administration; or via nasal or pulmonary inhalation. Depot injection may likewise be employed. Methods for formulating and delivering polypeptides for various routes of administration are known in the art. See, for example, Pharmaceutical Formulation Development of Peptides and Proteins, Second Edition, Lars Hovgaard, Sven Frokjaer, Marco van de Weert; Nov. 14, 2012 by CRC Press.
(107) Peptides activating IFN may be administered via gene therapy. In one embodiment, IFN or an IFN derivative is administered via gene therapy. A nucleic acid molecule encoding IFN or an IFN derivative is administered to a patient so that it is delivered into the patient's cells, where the nucleic acid is transcribed and translated into IFN polypeptide. Such delivery may be achieved by viral and non-viral methods.
(108) In one embodiment, the compounds and combinations of the invention may be delivered via a miniature device such as an implantable infusion pump which is designed to provide long-term continuous or intermittent drug infusion. Such devices can be used to administer an activator of IFN receptor via intravenous, intra-arterial, subcutaneous, intraperitoneal, intrathecal, epidural or intraventricular routes.
(109) Dosing
(110) The activator of the IFN receptor may be administered according to any suitable dosing scheme.
(111) The activator of IFN receptor, the compositions comprising the activator of IFN receptor and the combinations can be administered at various intervals. The dosing intervals are selected in order to achieve the desired therapeutic effect. In case of non-therapeutic uses and methods, the dosing interval is selected in order to achieve the desired effect on weight loss or weight maintenance. In a preferred embodiment, the activator of IFN receptor, the compositions comprising the activator of IFN receptor and the combinations are administered at a weekly dosing interval.
(112) In a further embodiment, the activator of IFN receptor, the compositions comprising the activator of IFN receptor and the combinations are administered twice per week. In another embodiment, the activator of IFN receptor, the compositions comprising the activator of IFN receptor and the combinations are administered every two days. In yet another embodiment, the activator of IFN receptor, the compositions comprising the activator of IFN receptor and the combinations are administered daily.
(113) In a further embodiment, the activator of IFN receptor, the compositions comprising the activator of IFN receptor and the combinations are administered every other week. In another embodiment, the activator of IFNF receptor, the compositions comprising the activator of IFN receptor and the combinations are administered every three weeks. In yet another embodiment, the activator of INF receptor, the compositions comprising the activator of IFN receptor and the combinations are administered once per month.
(114) The amount of the activator of IFN receptor administered is selected in order to achieve the desired therapeutic effect. In case of non-therapeutic uses and methods, the amount of the activator of IFN receptor administered is selected in order to achieve the desired effect on weight loss or weight maintenance. The activator of IFN receptor may be administered as a fixed dose or as a weight-based dose.
(115) In one embodiment, a fixed dose of 10 g to 10 mg IFN is administered. In a further embodiment, a fixed dose of 100 g to 9 mg IFN is administered. In another embodiment, a fixed dose of 500 g to 8 mg IFN is administered. In yet another embodiment, a fixed dose of 1 mg to 7 mg IFN is administered. In a preferred embodiment, a fixed dose of 2 mg to 6 mg IFN is administered. In a more preferred embodiment, a fixed dose of 5 mg IFN is administered.
(116) In one embodiment, a dose of IFN of 0.1 g/kg body weight to 150 g/kg body weight is administered. In a further embodiment, a dose of IFN of 0.5 g/kg body weight to 100 g/kg body weight is administered. In another embodiment, a dose of IFN of 1 g/kg body weight to 90 g/kg body weight is administered. In a preferred embodiment, a dose of IFN of 10 g/kg body weight to 80 g/kg body weight is administered. In another preferred embodiment, a dose of IFN of 20 g/kg body weight to 70 g/kg body weight is administered. In a more preferred embodiment, a dose of IFN of 60 g/kg body weight is administered.
(117) In one embodiment, a dose of 10 g to 10 mg IFN is administered at a weekly dosing interval. In a preferred embodiment, a fixed dose of 2 mg to 6 mg IFN is administered at a weekly dosing interval. In a more preferred embodiment, a fixed dose of 5 mg IFN is administered at a weekly dosing interval.
(118) In another embodiment, a dose of IFN of 0.1 g/kg body weight to 150 g/kg body weight is administered at a weekly dosing interval. In a preferred embodiment, a dose of IFN of 10 g/kg body weight to 80 g/kg body weight is administered at a weekly dosing interval. In a more preferred embodiment, a dose of IFN of 60 g/kg body weight is administered at a weekly dosing interval.
Formulations
(119) The activator of the IFN receptor may be present or administered in any suitable formulation.
(120) The IFN and the compositions comprising IFN provided herein can be lyophilized for storage and reconstituted in a suitable liquid prior to use. The liquid may be sterile water or a suitable sterile solution. Any suitable lyophilization method (e.g., spray drying, cake drying) and/or reconstitution techniques can be employed. In a particular embodiment, the invention provides a composition comprising a lyophilized (freeze dried) IFN.
(121) In one embodiment, the lyophilized IFN or the lyophilized composition comprising IFN is provided together with a liquid suitable for reconstitution and a syringe for injection.
(122) In a further embodiment, a liquid formulation of IFN is provided. The liquid formulation may comprise one or more stabilizers. In one embodiment, the liquid formulation is stabilizer-free. According to one aspect, the liquid formulation is stable for a time period of 3 months, preferably 6 months and more preferably 12 months upon storage at 4 C. According to a further aspect, the liquid formulation is stable for a time period of 3 months, preferably 6 months and more preferably 12 months upon storage at room temperature.
(123) In one embodiment, the formulation comprises a carrier protein. The carrier protein may be albumin. The role of albumin as a carrier molecule and its inert nature are desirable properties for use as a carrier and transporter of polypeptides in vivo. In one embodiment, the carrier protein is fused to IFN. For example, IFN may be fused to albumin. Fusion of the carrier protein, such as albumin, to IFN may be achieved by genetic manipulation, such that the DNA coding for the carrier protein, e.g., albumin, or a fragment thereof, is joined to the DNA coding for IFN.
(124) In one embodiment, a slow release formulation is provided. Such formulations allow for therapeutically effective amounts of the IFN or the composition comprising IFN to be delivered into the bloodstream over many hours or days following injection or delivery.
(125) The compounds or compositions may also be administered in an in situ gel formulation. Such formulations typically are administered as liquids which form a gel either by dissipation of the water miscible organic solvent or by aggregation of hydrophobic domains present in the matrix. Non-limiting examples include the FLUID CRYSTAL technology (Camurus) and the SABER technology (Durect), and the formulations described in U.S. Pat. Nos. 5,714,159, 6,413,539, 6,004,573 and 6,117,949.
(126) The present invention also inter alia comprises the following items: 1. An activator of IFN receptor for use in the prevention or treatment of atherosclerosis in a subject. 2. A method of preventing or treating atherosclerosis in a subject comprising administering a therapeutically effective amount of an activator of IFN receptor to the subject in need of such treatment or prevention. 3. The activator of IFN receptor for the use or the method of item 1 or item 2, wherein said treatment or prevention is reduction or prevention of atheromatic plaque formation and rupture, respectively. 4. The activator of IFN receptor for the use, the use, or the method of any one of items 1-3, wherein the subject is a mammalian subject. 5. The activator of IFN receptor for the use, the use, or the method of any one of items 1-3, wherein the subject is a human. 6. The activator of IFN receptor for the use, the use, or the method of any one of items 1-5, wherein the activator of IFN receptor is administered in combination with one or more further therapeutic agent(s). 7. The activator of IFN receptor for the use, the use, or the method of item 6, wherein the further therapeutic agent(s) is/are selected from the group consisting of insulin, metformin (Glucophage), meglitinides (Prandin and Starlix), sulfonylureas (glyburide/DiaBeta, glipizide/Glucotrol and Glimepiride/Amaryl), canagliflozin (Invokana) and dapagliflozin (Farxiga), thiazolidinediones, such as pioglitazone (Actos), acarbose (Precose), pramlintide (Symlin), exenatide (Byetta), liraglutide (Victoza), long-acting exenatide (Bydureon), albiglutide (Tanzeum), dulaglutide (Trulicity), DPP-IV inhibitors (sitagliptin, saxagliptin, linagliptin), phentermine, diethylpropion, phendimetrazine, benzphetamine, oxyntomodulin, fluoxetine hydrochloride, qnexa (topiramate and phentermine), excalia (bupropion and zonisamide), contrave (bupropion and naltrexone), xenical (Orlistat), cetilistat, and GT 389-255, statins, cholesterol lowering drugs such as proprotein convertase subtilisin kexin type 9 (PCSK9) inhibitors, ACE inhibitors, aldosterone inhibitors, angiotensin II receptor blockers, beta-blockers, calcium channel blockers, antiplatelets such as aspirin, clopidogrel (Plavix) or dipyridamole (Persantine), anti-coagulants such as warfarin (Coumadin), heparin, direct factor Xa inhibitors, direct thrombin inhibitors, hydralazine, diuretics, corticosteroids, non-steroidal anti-inflammatory drugs, anti-TNF, anti-IL-1 and anti-IL-6. 8. The activator of IFN receptor for the use, the use, or the method of any one of items 1-7, wherein the activator of IFN receptor is a small molecule, an antibody or an antibody fragment, a peptide, a polynucleotide expressing IFN, IFN or an IFN derivative. 9. The activator of IFN receptor for the use, the use, or the method of item 8, wherein the activator of IFN receptor is IFN. 10. The activator of IFN receptor for the use, the use, or the method of item 9, wherein the IFN is human IFN. 11. The activator of IFN receptor for the use, the use, or the method of item 10, wherein the IFN is selected from the group consisting of IFN1, IFN2, IFN3 and IFN4. 12. The activator of IFN receptor for the use, the use, or the method of item 11, wherein the IFN is IFN1. 13. The activator of IFN receptor for the use, the use, or the method of item 11, wherein the IFN is IFN2. 14. The activator of IFN receptor for the use, the use, or the method of item 11, wherein the IFN is IFN3. 15. The activator of IFN receptor for the use, the use, or the method of item 11, wherein the IFN is IFN4. 16. The activator of IFN receptor for the use, the use, or the method of any one of items 9-15, wherein a mammal is treated with homologous IFN. 17. The activator of IFN receptor for the use, the use, or the method of any one of items 9-16, wherein the IFN is pegylated, in particular monopegylated or conjugated with a polyalkyl oxide moiety. 18. The activator of IFN receptor for the use, the use, or the method of any one of items 9-17, wherein the IFN is administered via intravenous, intraperitoneal, subcutaneous or intramuscular injection; via oral, topical or transmucosal administration; or via nasal or pulmonary inhalation. 19. The activator of IFN receptor for the use, the use, or the method of any one of items 9-17, wherein the IFN is administered via gene-therapy. 20. The activator of IFN receptor for the use, the use, or the method of any one of items 9-19, wherein the IFN is administered weekly. 21. The activator of IFN receptor for the use, the use, or the method of any one of items 9-19, wherein the IFN is administered every two weeks. 22. The activator of IFN receptor for the use, the use, or the method of any one of items 9-19, wherein the IFN is administered twice a week. 23. The activator of IFN receptor for the use, the use, or the method of any one of items 9-22, wherein the IFN is administered at a dose of 10 g to 10 mg. 24. The activator of IFN receptor for the use, the use, or the method of item 23, wherein the IFN is administered at a dose of 100 g to 9 mg. 25. The activator of IFN receptor for the use, the use, or the method of item 24, wherein the IFN is administered at a dose of 500 g to 8 mg. 26. The activator of IFN receptor for the use, the use, or the method of item 25, wherein the IFN is administered at a dose of 1 mg to 7 mg. 27. The activator of IFN receptor for the use, the use, or the method of item 26, wherein the IFN is administered at a dose of 2 mg to 6 mg. 28. The activator of IFN receptor for the use, the use, or the method of item 27, wherein the IFN is administered at a dose of 5 mg. 29. The activator of IFN receptor for the use, the use, or the method of any one of items 9-22, wherein the IFN is administered at a dose of 0.1-150 g/kg body weight. 30. The activator of IFN receptor for the use, the use, or the method of item 29, wherein the IFN is administered at a dose of 0.5-100 g/kg body weight. 31. The activator of IFN receptor for the use, the use, or the method of item 30, wherein the IFN is administered at a dose of 1-90 g/kg body weight. 32. The activator of IFN receptor for the use, the use, or the method of item 31, wherein the IFN is administered at a dose of 10-80 g/kg body weight. 33. The activator of IFN receptor for the use, the use, or the method of item 32, wherein the IFN is administered at a dose of 20-70 g/kg body weight. 34. The activator of IFN receptor for the use, the use, or the method of item 33, wherein the IFN is administered at a dose of 60 g/kg body weight. 35. A method of determining susceptibility of a subject suffering from atherosclerosis to treatment with an activator of IFN receptor, wherein the method comprises administering the activator of IFN receptor to the subject and determining the effect on the atherosclerosis. 36. An activator of IFN receptor for use in determining susceptibility of a subject suffering from atherosclerosis to treatment with the activator of IFN receptor, wherein the activator of IFN receptor is administered to the subject and the effect on the atherosclerosis is determined. 37. A pharmaceutical composition comprising an activator of IFN receptor and a pharmaceutically acceptable excipient for use in the treatment of atherosclerosis
EXAMPLES
(127) Methods
(128) Adenovirus Expressing IFN2 and Recombinant IFN3
(129) Recombinant replication-deficient E1/E3-deleted adenovirus expressing IFN2 (AdIFN2) and mock control adenovirus (Ad0) were constructed using the Gateway system (Invitrogen). The IFN2 cDNA used has been previously described (Koltsida et al. 2011). Recombinant mouse IFN3 was purchased by eBioscience.
(130) Experimental Animals and Treatments
(131) Male Apoe/ mice (Jackson Laboratories) were fed a normal chow diet containing 18.5% protein and 5.5% fat (Harlan Tekland) and analyzed at various time points as indicated. For the assessment of the in vivo effects of IFN, 10-week old male Apoe.sup./ mice were treated intravenously every three weeks with 510.sup.8 AdIFN2 in 200 l sterile PBS, Ad0 or vehicle control (PBS) as indicated.
(132) In an alternative approach, 5 g of recombinant mouse IFN3 (eBioscience) in 200 l of sterile PBS were administered intraperitoneally twice per week to 10-week old male Apoe.sup./ mice. At the end of the treatment, mice were euthanized and serum and tissues were collected.
(133) For the diet-induced obesity model, male wild type C57BL/6 mice (Jackson Laboratories) were fed a high fat diet containing 26% protein and 35% fat (D12492; Research Diets) from week six of age onwards and analyzed at the timepoints indicated. Treatment involved intraperitoneal administration of 5 g of recombinant mouse IFN3 (eBioscience) bi-weekly from week 6 (prophylactic) or week 10 (therapeutic) onwards.
(134) In another setting, male wild type C57BL/6 mice (Jackson Laboratories) fed a normal chow diet (D12450B; Research Diets) were compared to global IFNR.sup./ mice or CD11c.sup.+ cell-specific IFNR.sup./ mice (derived from IFNR.sup./ mice reported in Lin J D et al., 2016) and analyzed at the timepoints indicated.
(135) Serum Measurements
(136) Serum proinsulin C-peptide, insulin, leptin, TNF and MCP-1 levels were measured by the Milliplex Map Mouse Adipokine Magnetic Bead Panel (Merck Millipore).
(137) Glucose Tolerance and Insulin Tolerance Tests
(138) Studies were performed as described by Li et al., 2000 and Tordjman et al., 2001. Glucose tolerance testing (GTT) preceded insulin tolerance testing (ITT) by 1 week. GTT was performed following an overnight fast (accounting for the lower fasting glucose levels as compared with those which followed a 5-hour fast). Mice received an intraperitoneal injection of 10% D-glucose (1 g/kg body weight) for GTT and an intraperitoneal injection of human regular insulin (Eli Lilly and Co.) at a dose of 0.75 U/Kg body weight for ITT. Tail vein blood (5-10 l) for GTT was assayed for glucose at 0, 20, 40, 60, 90 and 120 minutes and for ITT at 0, 20, 40, 60 and 120 minutes with Bayer's Contour Next Meter (Bayer AG).
(139) Indirect Calorimetry Method
(140) Metabolic measurement was performed using an Oxymax indirect calorimetry system (Columbus Instruments). In short, preweighed mice were housed individually in specifically designed Oxymax calorimeter chambers with ad libitum access to the diet and water for 72 h with a 12 h light/12 h dark cycle in an ambient temperature of 22 C. Mice were singly housed for 2 days prior to transferring into the calorimeter chamber. VO2, VCO2 and rates were determined under Oxymax system settings as follows: air flow, 0.6 l/min, sample flow, 0.5 l/min. The system was calibrated against a standard gas mixture to measure O2 consumed (VO2, ml/kg/h) and CO2 generated (VCO2, ml/kg/h). Metabolic rate, respiratory quotient (ratio of VCO2/VO2, RER), and activity (counts) were evaluated over a 48-h period. Energy expenditure was calculated as the product of the calorific value of oxygen (3.815+1.232respiratory quotient) and the volume of O.sub.2 consumed.
(141) Analysis of Atherosclerotic Lesions
(142) Oil Red O (Sigma-Aldrich) stained serial sections of the aortic valve, spanning a 500 m area and Sudan V (Sigma-Aldrich) stained entire aortas were analyzed using the Image J software (Wayne Rasband).
(143) Immunofluorescence-Immunohistochemistry
(144) Mouse aortic sinus cryosections were stained with anti-mouse CD68 (clone FA-11; Serotec), alpha smooth muscle actin (clone 1A4, Sigma-Aldrich), or isotype control monoclonal antibodies and counterstained with 4-,6-diamidino-2-phenylindole (DAPI, Molecular Probes). Positive staining areas were quantified by use of the Image J software (Wayne Rasband).
(145) Neutrophil Isolation, Stimulation, qPCR and RNAseq Analysis
(146) For neutrophil isolation, bone marrow cells were flushed from femora and tibiae of WT C57BL/6J male mice and suspensions filtered through a 40 m cell strainer. Neutrophils were purified to >99.7% purity with the EasySep Mouse Neutrophil Enrichment Kit (StemCell Technologies), according to the manufacturer's instructions. Purified neutrophils were plated at 110.sup.6 cells/ml in 24-well plates and left untreated or cultured for 8 h in complete RPMI medium in the presence of 100 ng/ml IFN3 or IFN2 (eBioscience). At the end of the incubation, cells were harvested and total RNA was purified with the RNeasy Micro kit (Qiagen) and quantified on a NanoDrop (Thermo Scientific). qPCR analysis was performed on Roche Lightcycler using primers for ISG15 and OAS1 (Galani et al., 2017). RNA seq libraries were prepared with the TruSeq RNA Library Prep Kit v2 (Illumina) according to the manufacturer's instructions. Quality of the libraries was validated with an Agilent DNA 1000 kit run on an Agilent 2100 Bioanalyzer. Bar-coded cDNA libraries were pooled together in equal concentrations in one pool, and were sequenced on a HiSeq2000 (Illumina) at the Genomics Core Facility of EMBL (Heidelberg, Germany). Samples were then analyzed using standard protocols. Briefly, raw reads were pre-processed using FastQC v.0.11.2 and cutadapt v.1.6, and then mapped to the mouse genome (Mus musculus UCSC version mm10) using the TopHat version 2.0.13, Bowtie v.1.1.1 and Samtools version v.1.1. The read count table was produced using HTSeq v.0.6. Normalization and differential expression analysis was performed using R/Bioconductor DESeq2.
Statistical Analysis
(147) Statistical significance of differences was assessed using the parametric Student t test for normally distributed data and the nonparametric Mann-Whitney U (MWW) test for skewed data that deviate from normality.
Example 1. IFN Lowers Insulin Levels in the Serum
(148) Experiments were designed to investigate the effect of IFN administration in circulating insulin levels. 10-week old Apoe.sup./ mice were treated intravenously with vehicle (PBS), 510.sup.8 mock (Ad0) or 510.sup.8 IFN2-expressing adenovirus (AdIFN2) at day 0 and day 21. Sera were collected and analyzed at day 24. The results of these experiments are shown in
Example 2. IFN Promotes Insulin Sensitivity and Enhances Glucose Uptake
(149) In a follow up of Example 1, experiments were designed to investigate the direct effects of IFN treatment in insulin sensitivity. 10-week old Apoe.sup./ mice were treated with recombinant IFN3 (5 g/mouse) or saline control, intraperitoneally twice per week for a total of 16 weeks. Control groups received saline. Glucose tolerance testing (GTT) preceded insulin tolerance testing (ITT) by 1 week. GTT was performed following overnight fasting. Mice received an intraperitoneal injection of 10% D-glucose (1 g/kg body weight) for GTT and an intraperitoneal injection of human regular insulin at a dose of 0.75 U/kg body weight for ITT. Tail vein blood (5-10 l) for GTT was assayed for glucose at 0, 20, 40, 60, 90 and 120 minutes and for ITT at 0, 20, 40, 60 and 120 minutes with Bayer's Contour Next Meter. Results are shown in
Example 3. IFN Prevents Weight Gain in Apoe.SUP./ .Mice
(150) To address the effect of IFN treatment in weight gain and obesity we used experimental animals. 10-week old Apoe.sup./ mice were treated with recombinant IFN3 (5 g/mouse) bi-weekly for a total of 16 weeks. The control group of mice received saline. Weight was measured daily from week 10 until week 26. As presented in
Example 4. IFN Lowers Food Consumption and Reduces the Carbohydrate Burning Rate
(151) Experiments were performed to shed light into the suppressive effects of IFN treatment in weight gain. 10-week old Apoe.sup./ mice were treated with recombinant IFN3 (5 g/mouse) biweekly for a total of 16 weeks as indicated earlier. Control mice received saline. Metabolic measurements were then performed using an Oxymax indirect calorimetry system according to standard protocols. Food consumption, metabolic rate, respiratory exchange rate and oxidation rate activity were evaluated over a 48 h period. Results are shown in
Example 5. IFN Reduces Atherosclerosis and Prevents Atherosclerotic Plaque Vulnerability
(152) 10-week old Apoe.sup./ mice were treated intravenously with vehicle (PBS), 510.sup.8 mock (Ad0) or 510.sup.8 IFN2-expressing adenovirus (AdIFN) over 3-week intervals for 12 weeks. Alternatively, 10-week old Apoe.sup./ mice were administered biweekly intraperitoneally recombinant IFN3 (5 g/mouse) for a total of 12 weeks. Control mice received saline. At both cases, mice were analyzed for the development of atherosclerosis at 22-weeks. Representative light photomicrographs of ORO-stained sections and fluorescent photomicrographs of CD68-stained sections at the level of the aortic valve are shown in
Example 6. IFN Reduces Co-Agulation and Thrombosis
(153) Neutrophils from C57BL/6 mice were isolated to >99% purity and exposed to 100 ng/ml of recombinant IFN3 for 8 h. Transcriptional profiling by RNA sequencing was then performed and data analyzed through standard methodologies. IFN2 treatment reduces the relative expression levels of tissue factor (TF), Cathepsin G (CTSG), elastase (ELANE), peptidyl arginine deiminase type IV (PADI4) and IL-1ra as shown in
Example 7. IFN Reduces Diet-Induced Metabolic and Inflammatory Mediators in C57BL/6 Mice
(154) To address the effects of IFN treatment in diet-induced metabolic and inflammatory mediators contributing to obesity and insulin resistance, wild type C57BL/6 mice were fed with high fat diet (HFD) from week 6 onwards and treated with recombinant IFN3 (5 g/mouse) twice per week for a total of 8 or 12 weeks. At the end of the treatment period, blood was collected and serum analyzed. As shown in
Example 8. IFN Treats Diet-Induced Obesity and Insulin Resistance in C57BL/6 Mice
(155) To address the effects of IFN treatment in diet-induced obesity, the most established animal model of obesity, metabolic disease and diabetes, wild type C57BL/6 mice were fed with high fat diet (HFD) from week 6 onwards and treated with recombinant IFN3 (5 g/mouse) twice per week for a total of 8 or 12 weeks. As shown in
Example 9. The IFN Receptor System is Required for Preserving Normal Weight and Metabolic Health Under Normal Chow Diet
(156) To investigate the importance of endogenous IFN receptor activators in maintaining a healthy body weight, we used IFNR.sup./ mice lacking IFNR globally or in CD11c+ cells only. As shown in
Example 10. The Activity of Recombinant IFNs is Dependent on IFNR
(157) To confirm the specificity of recombinant IFN3 we treated neutrophils from wild type (WT) and IFNR.sup./ mice and examined the induction of downstream signaling. As shown in
(158) The present invention also inter alia comprises the following items: 1. An activator of IFN receptor for use in the prevention or treatment of a coagulation disorder in a subject. 2. A method of preventing or treating a coagulation disorder in a subject comprising administering a therapeutically effective amount of an activator of IFN receptor to the subject in need of such treatment or prevention. 3. The activator of IFN receptor for the use or the method of item 1 or item 2, wherein the coagulation disorder is thrombosis. 4. The activator of IFN receptor for the use, the use, or the method of any one of items 1-3, wherein the subject is a mammalian subject. 5. The activator of IFN receptor for the use, the use, or the method of any one of items 1-3, wherein the subject is a human. 6. The activator of IFN receptor for the use, the use, or the method of any one of items 1-5, wherein the activator of IFN receptor is administered in combination with one or more further therapeutic agent(s). 7. The activator of IFN receptor for the use, the use, or the method of item 6, wherein the further therapeutic agent(s) is/are selected from the group consisting of insulin, metformin (Glucophage), meglitinides (Prandin and Starlix), sulfonylureas (glyburide/DiaBeta, glipizide/Glucotrol and Glimepiride/Amaryl), canagliflozin (Invokana) and dapagliflozin (Farxiga), thiazolidinediones, such as pioglitazone (Actos), acarbose (Precose), pramlintide (Symlin), exenatide (Byetta), liraglutide (Victoza), long-acting exenatide (Bydureon), albiglutide (Tanzeum), dulaglutide (Trulicity), DPP-IV inhibitors (sitagliptin, saxagliptin, linagliptin), phentermine, diethylpropion, phendimetrazine, benzphetamine, oxyntomodulin, fluoxetine hydrochloride, qnexa (topiramate and phentermine), excalia (bupropion and zonisamide), contrave (bupropion and naltrexone), xenical (Orlistat), cetilistat, and GT 389-255, statins, cholesterol lowering drugs such as proprotein convertase subtilisin kexin type 9 (PCSK9) inhibitors, ACE inhibitors, aldosterone inhibitors, angiotensin II receptor blockers, beta-blockers, calcium channel blockers, antiplatelets such as aspirin, clopidogrel (Plavix) or dipyridamole (Persantine), anti-coagulants such as warfarin (Coumadin), heparin, direct factor Xa inhibitors, direct thrombin inhibitors, hydralazine, diuretics, corticosteroids, non-steroidal anti-inflammatory drugs, anti-TNF, anti-IL-1 and anti-IL-6. 8. The activator of IFN receptor for the use, the use, or the method of any one of items 1-7, wherein the activator of IFN receptor is a small molecule, an antibody or an antibody fragment, a peptide, a polynucleotide expressing IFN, IFN or an IFN derivative. 9. The activator of IFN receptor for the use, the use, or the method of item 8, wherein the activator of IFN receptor is IFN. 10. The activator of IFN receptor for the use, the use, or the method of item 9, wherein the IFN is human IFN. 11. The activator of IFN receptor for the use, the use, or the method of item 10, wherein the IFN is selected from the group consisting of IFN1, IFN2, IFN3 and IFN4. 12. The activator of IFN receptor for the use, the use, or the method of item 11, wherein the IFN is IFN1. 13. The activator of IFN receptor for the use, the use, or the method of item 11, wherein the IFN is IFN2. 14. The activator of IFN receptor for the use, the use, or the method of item 11, wherein the IFN is IFN3. 15. The activator of IFN receptor for the use, the use, or the method of item 11, wherein the IFN is IFN4. 16. The activator of IFN receptor for the use, the use, or the method of any one of items 9-15, wherein a mammal is treated with homologous IFN. 17. The activator of IFN receptor for the use, the use, or the method of any one of items 9-16, wherein the IFN is pegylated, in particular monopegylated or conjugated with a polyalkyl oxide moiety. 18. The activator of IFN receptor for the use, the use, or the method of any one of items 9-17, wherein the IFN is administered via intravenous, intraperitoneal, subcutaneous or intramuscular injection; via oral, topical or transmucosal administration; or via nasal or pulmonary inhalation. 19. The activator of IFN receptor for the use, the use, or the method of any one of items 9-17, wherein the IFN is administered via gene-therapy. 20. The activator of IFN receptor for the use, the use, or the method of any one of items 9-19, wherein the IFN is administered weekly. 21. The activator of IFN receptor for the use, the use, or the method of any one of items 9-19, wherein the IFN is administered every two weeks. 22. The activator of IFN receptor for the use, the use, or the method of any one of items 9-19, wherein the IFN is administered twice a week. 23. The activator of IFN receptor for the use, the use, or the method of any one of items 9-22, wherein the IFN is administered at a dose of 10 g to 10 mg. 24. The activator of IFN receptor for the use, the use, or the method of item 23, wherein the IFN is administered at a dose of 100 g to 9 mg. 25. The activator of IFN receptor for the use, the use, or the method of item 24, wherein the IFN is administered at a dose of 500 g to 8 mg. 26. The activator of IFN receptor for the use, the use, or the method of item 25, wherein the IFN is administered at a dose of 1 mg to 7 mg. 27. The activator of IFN receptor for the use, the use, or the method of item 26, wherein the IFN is administered at a dose of 2 mg to 6 mg. 28. The activator of IFN receptor for the use, the use, or the method of item 27, wherein the IFN is administered at a dose of 5 mg. 29. The activator of IFN receptor for the use, the use, or the method of any one of items 9-22, wherein the IFN is administered at a dose of 0.1-150 g/kg body weight. 30. The activator of IFN receptor for the use, the use, or the method of item 29, wherein the IFN is administered at a dose of 0.5-100 g/kg body weight. 31. The activator of IFN receptor for the use, the use, or the method of item 30, wherein the IFN is administered at a dose of 1-90 g/kg body weight. 32. The activator of IFN receptor for the use, the use, or the method of item 31, wherein the IFN is administered at a dose of 10-80 g/kg body weight. 33. The activator of IFN receptor for the use, the use, or the method of item 32, wherein the IFN is administered at a dose of 20-70 g/kg body weight. 34. The activator of IFN receptor for the use, the use, or the method of item 33, wherein the IFN is administered at a dose of 60 g/kg body weight. 35. A method of determining susceptibility of a subject suffering from a coagulation disorder to treatment with an activator of IFN receptor, wherein the method comprises administering the activator of IFN receptor to the subject and determining the effect on the coagulation disorder. 36. An activator of IFN receptor for use in determining susceptibility of a subject suffering from a coagulation disorder to treatment with the activator of IFN receptor, wherein the activator of IFN receptor is administered to the subject and the effect on the coagulation disorder is determined. 37. A pharmaceutical composition comprising an activator of IFN receptor and a pharmaceutically acceptable excipient for use in the treatment of a coagulation disorder.
LITERATURE
(159) Abushahba W, Balan M, Castaneda I, Yuan Y, Reuhl K, Raveche E, de la Torre A, Lasfar A, Kotenko S V (2010) Antitumor activity of type I and type III interferons in BNL hepatoma model. Cancer immunology, immunotherapy: CII 59: 1059-1071 Ank N, West H, Bartholdy C, Eriksson K, Thomsen A R, Paludan S R (2006) Lambda interferon (IFN-lambda), a type III IFN, is induced by viruses and IFNs and displays potent antiviral activity against select virus infections in vivo. J Virol 80: 4501-4509 Aspinall R J, Pockros P J (2004) The management of side-effects during therapy for hepatitis C. Alimentary pharmacology & therapeutics 20: 917-929 Bullens D M, Decraene A, Dilissen E, Meyts I, De Boeck K, Dupont L J, Ceuppens J L (2008) Type III IFN-lambda mRNA expression in sputum of adult and school-aged asthmatics. Clinical and experimental allergy: journal of the British Society for Allergy and Clinical Immunology 38: 1459-1467 Contoli M, Message S D, Laza-Stanca V, Edwards M R, Wark P A, Bartlett N W, Kebadze T, Mallia P, Stanciu L A, Parker H L et al (2006) Role of deficient type III interferon-lambda production in asthma exacerbations. Nature medicine 12: 1023-1026 Dai J, Megjugorac N J, Gallagher G E, Yu R Y, Gallagher G (2009) IFN-lambda1 (IL-29) inhibits GATA3 expression and suppresses Th2 responses in human naive and memory T cells. Blood 113: 5829-5838 Durbin R K, Kotenko S V, Durbin J E (2013) Interferon induction and function at the mucosal surface. Immunol Rev 255: 25-39 Gad H H, Dellgren C, Hamming O J, Vends S, Paludan S R, Hartmann R (2009) Interferon-lambda is functionally an interferon but structurally related to the interleukin-10 family. The Journal of biological chemistry 284: 20869-20875 Galani I E, Koltsida O, Andreakos E. Type III interferons (IFNs) (2015) Emerging Master Regulators of Immunity. Adv Exp Med Biol. 850:1-15 Galani I E, Triantafyllia V, Eleminiadou E E, Koltsida O, Stavropoulos A, Manioudaki M, Thanos D, Doyle S E, Kotenko S V, Thanopoulou K, Andreakos E (2017). Interferon- Mediates Non-redundant Front-Line Antiviral Protection against Influenza Virus Infection without Compromising Host Fitness. Immunity. 16; 46(5):875-890 Hernandez P P, Mahlakoiv T, Yang I, Schwierzeck V, Nguyen N, Guendel F, Gronke K, Ryffel B, Holscher C, Dumoutier L et al (2015) Interferon-lambda and interleukin 22 act synergistically for the induction of interferon-stimulated genes and control of rotavirus infection. Nat Immunol 16: 698-707 Jordan W J, Eskdale J, Boniotto M, Rodia M, Kellner D, Gallagher G (2007a) Modulation of the human cytokine response by interferon lambda-1 (IFN-lambda1/IL-29). Genes Immun 8: 13-20 Jordan W J, Eskdale J, Srinivas S, Pekarek V, Kelner D, Rodia M, Gallagher G (2007b) Human interferon lambda-1 (IFN-lambda1/IL-29) modulates the Th1/Th2 response. Genes Immun 8: 254-261 Koltsida O, Hausding M, Stavropoulos A, Koch S, Tzelepis G, Ubel C, Kotenko S V, Sideras P, Lehr H A, Tepe M et al (2011) IL-28A (IFN-lambda2) modulates lung D C function to promote Th1 immune skewing and suppress allergic airway disease. EMBO Mol Med 3: 348-361 Kotenko S V (2011) IFN-lambdas. Curr Opin Immunol 23: 583-590 Kotenko S V, Gallagher G, Baurin V V, Lewis-Antes A, Shen M, Shah N K, Langer J A, Sheikh F, Dickensheets H, Donnelly R P (2003) IFN-lambdas mediate antiviral protection through a distinct class II cytokine receptor complex. Nat Immunol 4: 69-77 Lasfar A, Lewis-Antes A, Smirnov S V, Anantha S, Abushahba W, Tian B, Reuhl K, Dickensheets H, Sheikh F, Donnelly R P et al (2006) Characterization of the mouse IFN-lambda ligand-receptor system: IFN-lambdas exhibit antitumor activity against B16 melanoma. Cancer research 66: 4468-4477 Lazear H M, Nice T J, Diamond M S (2015) Interferon-lambda: Immune Functions at Barrier Surfaces and Beyond. Immunity 43: 15-28 Li W, Lewis-Antes A, Huang J, Balan M, Kotenko S V (2008) Regulation of apoptosis by type III interferons. Cell proliferation 41: 960-979 Lin J D, Feng N, Sen A, Balan M, Tseng H C, McElrath C, Smirnov S V, Peng J, Yasukawa L L, Durbin R K, Durbin J E, Greenberg H B, Kotenko S V (2016). Distinct Roles of Type I and Type III Interferons in Intestinal Immunity to Homologous and Heterologous Rotavirus Infections. PLoS Pathog. 12(4):e1005600. Maher S G, Sheikh F, Scarzello A J, Romero-Weaver A L, Baker D P, Donnelly R P, Gamero A M (2008) IFNalpha and IFNlambda differ in their antiproliferative effects and duration of JAK/STAT signaling activity. Cancer biology & therapy 7: 1109-1115 Mahlakoiv T, Hernandez P, Gronke K, Diefenbach A, Staeheli P (2015) Leukocyte-derived IFN-alpha/beta and epithelial IFN-lambda constitute a compartmentalized mucosal defense system that restricts enteric virus infections. PLoS Pathog 11: e1004782 Megjugorac N J, Gallagher G E, Gallagher G (2009) Modulation of human plasmacytoid D C function by IFN-lambda1 (IL-29). Journal of leukocyte biology 86: 1359-1363 Mendoza J L, Schneider W M, Hoffmann H H, Vercauteren K, Jude K M, Xiong A, Moraga I, Horton T M, Glenn J S, de Jong Y P, Rice C M, Garcia K C (2017) The IFN--IFN-R1-IL-10R Complex Reveals Structural Features Underlying Type III IFN Functional Plasticity. Immunity 46(3):379-392 Mennechet F J, Uze G (2006) Interferon-lambda-treated dendritic cells specifically induce proliferation of FOXP3-expressing suppressor T cells. Blood 107: 4417-4423 Misumi I, Whitmire J K (2014) IFN- exerts opposing effects on T cell responses depending on the chronicity of the virus infection. J Immunol 192:3596-606 Mordstein M, Michiels T, Staeheli P (2010) What have we learned from the IL28 receptor knockout mouse? J Interferon Cytokine Res 30: 579-584 Morrow M P, Yan J, Pankhong P, Shedlock D J, Lewis M G, Talbott K, Toporovski R, Khan A S, Sardesai N Y, Weiner D B (2010) IL-28B/IFN-lambda 3 drives granzyme B loading and significantly increases CTL killing activity in macaques. Molecular therapy: the journal of the American Society of Gene Therapy 18: 1714-1723 Numasaki M, Tagawa M, Iwata F, Suzuki T, Nakamura A, Okada M, Iwakura Y, Aiba S, Yamaya M (2007) IL-28 elicits antitumor responses against murine fibrosarcoma. J Immunol 178: 5086-5098 Odendall C, Dixit E, Stavru F, Bierne H, Franz K M, Durbin A F, Boulant S, Gehrke L, Cossart P, Kagan J C (2014) Diverse intracellular pathogens activate type III interferon expression from peroxisomes. Nature immunology 15: 717-726 Onoguchi K, Yoneyama M, Takemura A, Akira S, Taniguchi T, Namiki H, Fujita T (2007) Viral infections activate types I and III interferon genes through a common mechanism. The Journal of biological chemistry 282: 7576-7581 Osterlund P I, Pietila T E, Veckman V, Kotenko S V, Julkunen 1 (2007) IFN regulatory factor family members differentially regulate the expression of type III IFN (IFN-lambda) genes. J Immunol 179: 3434-3442 Pekarek V, Srinivas S, Eskdale J, Gallagher G (2007) Interferon lambda-1 (IFN-lambda1/IL-29) induces ELR() CXC chemokine mRNA in human peripheral blood mononuclear cells, in an IFN-gamma-independent manner. Genes and immunity 8: 177-180 Pott J, Mahlakoiv T, Mordstein M, Duerr C U, Michiels T, Stockinger S, Staeheli P, Hornef M W (2011) IFN-lambda determines the intestinal epithelial antiviral host defense. Proc Natl Acad Sci USA 108: 7944-7949 Prokunina-Olsson L, Muchmore B, Tang W, Pfeiffer R M, Park H, Dickensheets H, Hergott D, Porter-Gill P, Mumy A, Kohaar I et al (2013) A variant upstream of IFNL3 (IL28B) creating a new interferon gene IFNL4 is associated with impaired clearance of hepatitis C virus. Nat Genet 45: 164-171 Ramos E L (2010) Preclinical and clinical development of pegylated interferon-lambda 1 in chronic hepatitis C. Journal of interferon & cytokine research: the official journal of the International Society for Interferon and Cytokine Research 30: 591-595 Robek M D, Boyd B S, Chisari F V (2005) Lambda interferon inhibits hepatitis B and C virus replication. Journal of virology 79: 3851-3854 Sato A, Ohtsuki M, Hata M, Kobayashi E, Murakami T (2006) Antitumor activity of IFN-lambda in murine tumor models. J Immunol 176: 7686-7694 Sheppard P, Kindsvogel W, Xu W, Henderson K, Schlutsmeyer S, Whitmore T E, Kuestner R, Garrigues U, Birks C, Roraback J et al (2003) IL-28, IL-29 and their class II cytokine receptor IL-28R. Nat Immunol 4: 63-68 Sommereyns C, Paul S, Staeheli P, Michiels T (2008) IFN-lambda (IFN-lambda) is expressed in a tissue-dependent fashion and primarily acts on epithelial cells in vivo. PLoS pathogens 4: e1000017 Thomson S J, Goh F G, Banks H, Krausgruber T, Kotenko S V, Foxwell B M, Udalova I A (2009) The role of transposable elements in the regulation of IFN-lambda1 gene expression. Proc Natl Acad Sci USA 106: 11564-11569 Witte K, Gruetz G, Volk H D, Looman A C, Asadullah K, Sterry W, Sabat R, Wolk K (2009) Despite IFN-lambda receptor expression, blood immune cells, but not keratinocytes or melanocytes, have an impaired response to type III interferons: implications for therapeutic applications of these cytokines. Genes and immunity 10: 702-714 Yin Z, Dai J, Deng J, Sheikh F, Natalia M, Shih T, Lewis-Antes A, Amrute S B, Garrigues U, Doyle S et al (2012) Type III IFNs are produced by and stimulate human plasmacytoid dendritic cells. J Immunol 189: 2735-2745 Zitzmann K, Brand S, Baehs S, Goke B, Meinecke J, Spottl G, Meyer H, Auernhammer C J (2006) Novel interferon-lambdas induce antiproliferative effects in neuroendocrine tumor cells. Biochemical and biophysical research communications 344: 1334-1341
(160) In view of the above, it will be apparent that the present invention inter alia comprises the following items: 1. An activator of IFN receptor for use in the prevention or treatment of an obesity-related disorder in a subject. 2. A method of preventing or treating an obesity-related disorder in a subject comprising administering a therapeutically effective amount of an activator of IFN receptor to the subject in need of such treatment or prevention. 3. The activator of IFN receptor for the use or the method of item 1 or item 2, wherein the obesity-related disorder is selected from the group consisting of obesity, hyperphagia, prediabetes, diabetes (including type 1 diabetes, type 2 diabetes, and gestational diabetes), insulin resistance, metabolic disease, metabolic syndrome, coronary heart disease, carotid artery disease, myocardial infarction, stroke, thrombosis, dyslipidemia, hyperlipidemia or hypercholesterolemia. 4. The activator of IFN receptor for the use or the method of item 3, wherein the obesity-related disorder is obesity. 5. The activator of IFN receptor for the use or the method of item 3, wherein the diabetes is type 1 diabetes or type 2 diabetes. 6. An activator of IFN receptor for use in the prevention or treatment of atherosclerosis in a subject. 7. A method of preventing or treating atherosclerosis in a subject comprising administering a therapeutically effective amount of an activator of IFN receptor to the subject in need of such treatment or prevention. 8. The activator of IFN receptor for the use or the method of item 6 or item 7, wherein said treatment or prevention is reduction or prevention of atheromatic plaque formation and rupture, respectively. 9. An activator of IFN receptor for use in the prevention or treatment of a coagulation disorder in a subject. 10. A method of preventing or treating a coagulation disorder in a subject comprising administering a therapeutically effective amount of an activator of IFN receptor to the subject in need of such treatment or prevention. 11. The activator of IFN receptor for the use or the method of item 9 or item 10, wherein the coagulation disorder is thrombosis. 12. An activator of IFN receptor for use in the therapeutic reduction of body weight in a subject. 13. A method for therapeutic reduction of body weight in a subject comprising administering an activator of IFN receptor to the subject. 14. An activator of IFN receptor for use in the therapeutic reduction of overweight in a subject. 15. A method for therapeutic reduction of overweight in a subject comprising administering an activator of IFN receptor to the subject. 16. Use of an activator of IFN receptor for the non-therapeutic reduction of body weight in a subject, optionally wherein the non-therapeutic reduction of body weight involves the suppression of appetite and/or the suppression of overeating. 17. A method for non-therapeutic reduction of body weight in a subject comprising administering an activator of IFN receptor to the subject, optionally wherein the non-therapeutic reduction of body weight involves the suppression of appetite and/or the suppression of overeating. 18. Use of an activator of IFN receptor for the non-therapeutic reduction of overweight in a subject, optionally wherein the non-therapeutic reduction of overweight involves the suppression of appetite and/or the suppression of overeating. 19. A method for non-therapeutic reduction of overweight in a subject comprising administering an activator of IFN receptor to the subject, optionally wherein the non-therapeutic reduction of overweight involves the suppression of appetite and/or the suppression of overeating. 20. The activator of IFN receptor for the use, the use, or the method of any one of items 1-19, wherein the subject is a mammalian subject. 21. The activator of IFN receptor for the use, the use, or the method of any one of items 1-20, wherein the subject is a human. 22. The activator of IFN receptor for the use, the use, or the method of any one of items 1-21, wherein the activator of IFN receptor is administered in combination with one or more further therapeutic agent(s). 23. The activator of IFN receptor for the use, the use, or the method of item 22, wherein the further therapeutic agent(s) is/are selected from the group consisting of insulin, metformin (Glucophage), meglitinides (Prandin and Starlix), sulfonylureas (glyburide/DiaBeta, glipizide/Glucotrol and Glimepiride/Amaryl), canagliflozin (Invokana) and dapagliflozin (Farxiga), thiazolidinediones, such as pioglitazone (Actos), acarbose (Precose), pramlintide (Symlin), exenatide (Byetta), liraglutide (Victoza), long-acting exenatide (Bydureon), albiglutide (Tanzeum), dulaglutide (Trulicity), DPP-IV inhibitors (sitagliptin, saxagliptin, linagliptin), phentermine, diethylpropion, phendimetrazine, benzphetamine, oxyntomodulin, fluoxetine hydrochloride, qnexa (topiramate and phentermine), excalia (bupropion and zonisamide), contrave (bupropion and naltrexone), xenical (Orlistat), cetilistat, and GT 389-255, statins, cholesterol lowering drugs such as proprotein convertase subtilisin kexin type 9 (PCSK9) inhibitors, ACE inhibitors, aldosterone inhibitors, angiotensin II receptor blockers, beta-blockers, calcium channel blockers, antiplatelets such as aspirin, clopidogrel (Plavix) or dipyridamole (Persantine), anti-coagulants such as warfarin (Coumadin), heparin, direct factor Xa inhibitors, direct thrombin inhibitors, hydralazine, diuretics, corticosteroids, non-steroidal anti-inflammatory drugs, anti-TNF, anti-IL-1 and anti-IL-6. 24. The activator of IFN receptor for the use, the use, or the method of any one of items 1-23, wherein the activator of IFN receptor is a small molecule, an antibody or an antibody fragment, a peptide, a polynucleotide expressing IFN, IFN or an IFN derivative. 25. The activator of IFN receptor for the use, the use, or the method of item 24, wherein the activator of IFN receptor is IFN. 26. The activator of IFN receptor for the use, the use, or the method of item 25, wherein the IFN is human IFN. 27. The activator of IFN receptor for the use, the use, or the method of item 26, wherein the IFN is selected from the group consisting of IFN1, IFN2, IFN3 and IFN4. 28. The activator of IFN receptor for the use, the use, or the method of item 27, wherein the IFN is IFN1. 29. The activator of IFN receptor for the use, the use, or the method of item 27, wherein the IFN is IFN2. 30. The activator of IFN receptor for the use, the use, or the method of item 27, wherein the IFN is IFN3. 31. The activator of IFN receptor for the use, the use, or the method of item 27, wherein the IFN is IFN4. 32. The activator of IFN receptor for the use, the use, or the method of any one of items 25-31, wherein a mammal is treated with homologous IFN. 33. The activator of IFN receptor for the use, the use, or the method of any one of items 25-32, wherein the IFN is pegylated, in particular monopegylated or conjugated with a polyalkyl oxide moiety. 34. The activator of IFN receptor for the use, the use, or the method of any one of items 25-33, wherein the IFN is administered via intravenous, intraperitoneal, subcutaneous or intramuscular injection; via oral, topical or transmucosal administration; or via nasal or pulmonary inhalation. 35. The activator of IFN receptor for the use, the use, or the method of any one of items 25-33, wherein the IFN is administered via gene-therapy. 36. The activator of IFN receptor for the use, the use, or the method of any one of items 25-35, wherein the IFN is administered weekly. 37. The activator of IFN receptor for the use, the use, or the method of any one of items 25-35, wherein the IFN is administered every two weeks. 38. The activator of IFN receptor for the use, the use, or the method of any one of items 25-35, wherein the IFN is administered twice a week. 39. The activator of IFN receptor for the use, the use, or the method of any one of items 25-38, wherein the IFN is administered at a dose of 10 g to 10 mg. 40. The activator of IFN receptor for the use, the use, or the method of item 39, wherein the IFN is administered at a dose of 100 g to 9 mg. 41. The activator of IFN receptor for the use, the use, or the method of item 40, wherein the IFN is administered at a dose of 500 g to 8 mg. 42. The activator of IFN receptor for the use, the use, or the method of item 41, wherein the IFN is administered at a dose of 1 mg to 7 mg. 43. The activator of IFN receptor for the use, the use, or the method of item 42, wherein the IFN is administered at a dose of 2 mg to 6 mg. 44. The activator of IFN receptor for the use, the use, or the method of item 43, wherein the IFN is administered at a dose of 5 mg. 45. The activator of IFN receptor for the use, the use, or the method of any one of items 25-38, wherein the IFN is administered at a dose of 0.1-150 g/kg body weight. 46. The activator of IFN receptor for the use, the use, or the method of item 45, wherein the IFN is administered at a dose of 0.5-100 g/kg body weight. 47. The activator of IFN receptor for the use, the use, or the method of item 46, wherein the IFN is administered at a dose of 1-90 g/kg body weight. 48. The activator of IFN receptor for the use, the use, or the method of item 47, wherein the IFN is administered at a dose of 10-80 g/kg body weight. 49. The activator of IFN receptor for the use, the use, or the method of item 48, wherein the IFN is administered at a dose of 20-70 g/kg body weight. 50. The activator of IFN receptor for the use, the use, or the method of item 49, wherein the IFN is administered at a dose of 60 g/kg body weight. 51. A method of determining susceptibility of a subject suffering from an obesity-related disorder, atherosclerosis or a coagulation disorder to treatment with an activator of IFN receptor, wherein the method comprises administering the activator of IFN receptor to the subject and determining the effect on the obesity-related disorder, atherosclerosis or the coagulation disorder, respectively. 52. An activator of IFN receptor for use in determining susceptibility of a subject suffering from an obesity-related disorder, atherosclerosis or a coagulation disorder to treatment with the activator of IFN receptor, wherein the activator of IFN receptor is administered to the subject and the effect on the obesity-related disorder, atherosclerosis or the coagulation disorder is determined, respectively. 53. A pharmaceutical composition comprising an activator of IFN receptor and a pharmaceutically acceptable excipient for use in the treatment of an obesity-related disorder. 54. A pharmaceutical composition comprising an activator of IFN receptor and a pharmaceutically acceptable excipient for use in the treatment of atherosclerosis. 55. A pharmaceutical composition comprising an activator of IFN receptor and a pharmaceutically acceptable excipient for use in the treatment of a coagulation disorder.