ENGINEERED T CELL RECEPTORS FUSED TO BINDING DOMAINS FROM ANTIBODIES

20240342215 · 2024-10-17

    Inventors

    Cpc classification

    International classification

    Abstract

    The present disclosure provides improved T cell receptors, polynucleotides, polypeptides, vectors, cells, and methods of using the same. Particularly, the present invention relates to T cell receptor-based constructs engineered to comprise one or more additional binding domains, and methods of using the same. In certain embodiments, the one or more binding domains are fused to one or both TCR variable domains. In particular embodiments, the one or more additional binding domains are linked to the TCR with one or more polypeptide linkers.

    Claims

    1. An engineered T cell receptor (TCR) comprising: a) a TCR? polypeptide comprising a TCR? variable domain; b) a TCR? polypeptide comprising a TCR? variable domain; and c) one or more antigen-binding domains linked to the TCR? variable domain and/or TCR? variable domain.

    2. An engineered T cell receptor (TCR) comprising: a) a TCR? polypeptide comprising a TCR? variable domain; b) a TCR? polypeptide comprising a TCR? variable domain; and c) one or more antigen-binding domains linked to the TCR? variable domain and/or TCR? variable domain.

    3. The engineered TCR of claim 1, wherein the TCR? polypeptide comprises a TCR? constant domain and the TCR? polypeptide comprises a TCR? constant domain.

    4. The engineered TCR of claim 2, wherein the TCR? polypeptide comprises a TCR? constant domain and the TCR? polypeptide comprises a TCR? constant domain.

    5. The engineered TCR of any one of claims 1-4, wherein the one or more antigen-binding domains comprises a first antigen-binding domain linked to the TCR? or TCR? variable domain.

    6. The engineered TCR of any one of claims 1-5, wherein the one or more antigen-binding domains comprises a first antigen-binding domain linked to the TCR? or TCR? variable domain.

    7. The engineered TCR of any one of claims 1-6, wherein the one or more antigen-binding domains comprise: (i) a first antigen-binding domain linked to the TCR? or TCR? variable domain, and (ii) a first antigen-binding domain linked to the TCR? or TCR? variable domain.

    8. The engineered TCR of any one of claims 5-7, wherein the first antigen-binding domains are linked to the N-terminus of the variable domains.

    9. The engineered TCR of any one of claims 5-8, wherein the first antigen-binding domains are the same or different, and/or bind to the same or different target antigens.

    10. The engineered TCR of any one of claims 5-9, wherein the one or more antigen-binding domains comprises a second antigen-binding domain linked to the first antigen-binding domain linked to the TCR? or TCR? variable domain.

    11. The engineered TCR of any one of claims 5-10, wherein the one or more antigen-binding domains comprises a second antigen-binding domain linked to the first antigen-binding domain linked to the TCR? or TCR? variable domain.

    12. The engineered TCR of any one of claims 5-11, wherein the one or more antigen-binding domains comprises: (i) a second antigen-binding domain linked to the first antigen-binding domain linked to the TCR? or TCR? variable domain, and (ii) a second antigen-binding domain linked to the first antigen-binding domain linked to the TCR? or TCR? variable domain.

    13. The engineered TCR of any one of claims 10-12, wherein the second antigen-binding domains are linked to the N-terminus of the first antigen-binding domain.

    14. The engineered TCR of claim 12 or claim 13, wherein the second antigen-binding domains are the same or different, and/or bind to the same or different target antigens.

    15. The engineered TCR of any one of claims 5-14, wherein the first and second antigen-binding domains are the same or different, and/or bind to the same or different target antigens.

    16. The engineered TCR of any one of claims 1-15, wherein the one or more antigen-binding domains bind a target antigen selected from the group consisting of: alpha folate receptor (FR?), ?.sub.v?.sub.6 integrin, ADGRE2, BACE2, B cell maturation antigen (BCMA), B7-H3 (CD276), B7-H4, B7-H6, CA19.9, carbonic anhydrase IX (CAIX), CCR1, CD7, CD16, CD19, CD20, CD22, CD30, CD33, CD3?, CD38, CD44, CD44v6, CD44v7/8, CD70, CD79a, CD79b, CD123, CD133, CD138, CD171, CD244, carcinoembryonic antigen (CEA), C-type lectin-like molecule-1 (CLL-1), CD2 subset 1 (CS-1), CLDN6, cMET, chondroitin sulfate proteoglycan 4 (CSPG4), CLDN18.2, cutaneous T cell lymphoma-associated antigen 1 (CTAGE1), DLL3, epidermal growth factor receptor (EGFR), epidermal growth factor receptor variant III (EGFRvIII), EGFR806, epithelial glycoprotein 2 (EGP2), epithelial glycoprotein 40 (EGP40), EPHB2, ERBB4, epithelial cell adhesion molecule (EPCAM), ephrin type-A receptor 2 (EPHA2), fibroblast activation protein (FAP), Fc Receptor Like 5 (FCRL5), fetal acetylcholinesterase receptor (AchR), FLT3, FN, FN-EDB, FRBeta, ganglioside G2 (GD2), ganglioside G3 (GD3), Glypican-3 (GPC3), EGFR family including ErbB2 (HER2), HER2p95, EGFRv3, IL-10R?, IL-13R?2, Kappa, cancer/testis antigen 2 (LAGE-1A), K-Ras, K-Ras G12C, K-Ras G12D, K-Ras G12V, Lambda, Lewis-Y (LeY), L1 cell adhesion molecule (L1-CAM), LILRB2, LY6G6GD, melanoma antigen recognized by T cells 1 (MelanA or MART1), Mesothelin (MSLN), MMP10, MUC1, MUC16, MHC class I chain related proteins A (MICA), MHC class I chain related proteins B (MICB), neural cell adhesion molecule (NCAM), prostate stem cell antigen (PSCA), prostate-specific membrane antigen (PSMA), receptor tyrosine kinase-like orphan receptor 1 (ROR1), synovial sarcoma, X breakpoint 2 (SSX2), Survivin, tumor associated glycoprotein 72 (TAG72), transmembrane activator and CAML interactor (TACI), tumor endothelial marker 1 (TEM1/CD248), tumor endothelial marker 7-related (TEM7R), TIM3, trophoblast glycoprotein (TPBG), UL16-binding protein (ULBP) 1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, and vascular endothelial growth factor receptor 2 (VEGFR2).

    17. The engineered TCR of any one of claims 1-16, wherein the one or more antigen-binding domains bind a target polypeptide derived from a protein selected from the group consisting of: ?-fetoprotein (AFP), ASCL2, B Melanoma Antigen (BAGE) family members, Brother of the regulator of imprinted sites (BORIS), Cancer-testis antigens, Cancer-testis antigen 83 (CT-83), Carbonic anhydrase IX (CAIX), Carcinoembryonic antigen (CEA), Cytomegalovirus (CMV) antigens, Cytotoxic T cell (CTL)-recognized antigen on melanoma (CAMEL), Epstein-Barr virus (EBV) antigens, EPHB2, G antigen 1 (GAGE-1), GAGE-2, GAGE-3, GAGE-4, GAGE-5, GAGE-6, GAGE-7B, GAGE-8, Glycoprotein 100 (GP100), Hepatitis B virus (HBV) antigens, Hepatitis C virus (HCV) non-structure protein 3 (NS3), Human papillomavirus (HPV)-E6, HPV-E7, Human telomerase reverse transcriptase (hTERT), IGF2BP3/A3, IGF2BP1, K-Ras, K-Ras G12C, K-Ras G12D, K-Ras G12V, Latent membrane protein 2 (LMP2), LY6G6D, Melanoma antigen family A, 1 (MAGE-A1), MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A6, MAGE-A10, MAGE-A12, Melanoma antigen recognized by T cells (MART-1), Mesothelin (MSLN), Mucin 1 (MUC1), Mucin 16 (MUC16), New York esophageal squamous cell carcinoma-1 (NYESO-1), P53,P antigen (PAGE) family members, PAP, PIK3CA, PIK3CA H1047R, Placenta-specific 1 (PLAC1), Preferentially expressed antigen in melanoma (PRAME), Prostate specific antigen PSA, Survivin, Synovial sarcoma X 1 (SSX1), Synovial sarcoma X 2 (SSX2), Synovial sarcoma X 3 (SSX3), Synovial sarcoma X 4 (SSX4), Synovial sarcoma X 5 (SSX5), Synovial sarcoma X 8 (SSX8), Thyroglobulin, TP53 R175H, Tyrosinase, Tyrosinase related protein (TRP)1, TRP2, UBD, Wilms tumor protein (WT-1), Wnt10A, X Antigen Family Member 1 (XAGE1), and X Antigen Family Member 2 (XAGE2).

    18. The engineered TCR of any one of claims 1-17, wherein the one or more antigen-binding domains bind CD33, CLL1, CD19, CD20, CD22, CD79A, CD79B, or BCMA.

    19. The engineered TCR of any one of claims 1-17, wherein the one or more antigen-binding domains bind CD19, CD20, CD22, CD33, CD79A, CD79B, B7H3, Muc16, Her2, EGFR, FN-EDB, CLDN18.2, DLL3, FLT3, CLL1, CD123, or BCMA.

    20. The engineered TCR of any one of claims 1-17, wherein the one or more antigen-binding domains comprises an amino acid sequence at least 95% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 1-32.

    21. The engineered TCR of any one of claims 1-20, wherein the one or more antigen-binding domains comprise an antibody or antigen binding fragment thereof selected from the group consisting of: a Camel Ig, a Llama Ig, an Alpaca Ig, Ig NAR, a Fab fragment, a F(ab).sub.2 fragment, a bispecific Fab dimer (Fab2), a trispecific Fab trimer (Fab3), an Fv, an single chain Fv protein (scFv), a bis-scFv, (scFv).sub.2, a minibody, a diabody, a triabody, a tetrabody, a disulfide stabilized Fv protein (dsFv), and a single-domain antibody (sdAb, a camelid VHH, Nanobody).

    22. The engineered TCR of any one of claims 1-21, wherein the one or more antigen-binding domains comprise one or more single-chain variable fragments (scFv).

    23. The engineered TCR of any one of claims 1-22, wherein the one or more antigen-binding domains comprise one or more single domain antibodies (sdAb).

    24. The engineered TCR of claim 23, wherein the sdAb is a camelid VHH, nanobody, or heavy chain-only antibody (HcAb).

    25. The engineered TCR of claim 23, wherein the sdAb is a camelid VHH.

    26. The engineered TCR of any one of claims 21-25, wherein antibody or antigen binding fragment thereof is human or humanized.

    27. The engineered TCR of any one of claims 1-19, wherein the one or more antigen-binding domains comprise a ligand.

    28. The engineered TCR of any one of claims 1-27, wherein the one or more antigen-binding domain are linked to the TCR variable domains by one or more polypeptide linkers.

    29. The engineered TCR of claim 28, wherein the one or more polypeptide linkers comprise a linker from about 2 to about 25 amino acids long.

    30. The engineered TCR of claim 28 or claim 29, wherein the one or more polypeptide linkers comprise a linker from about 4 to about 15 amino acids long.

    31. The engineered TCR of any one of claims 28-30, wherein the one or more polypeptide linkers comprise a linker from about 4 to about 10 amino acids long.

    32. The engineered TCR of any one of claims 28-31, wherein the one or more polypeptide linkers comprise a linker of about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, or about 15 amino acids long.

    33. The engineered TCR of any one of claims 28-32, wherein the one or more polypeptide linkers comprise a linker of about 9 or about 10 amino acids long.

    34. The engineered TCR of any one of claims 28-33 wherein the one or more polypeptide linkers comprise a linker selected from the group consisting of: GG, GS, SG, SS, GSS, SSG, GSG, SGS, SGG, GGS, GGGS (SEQ ID NO: 53), (GGGGS).sub.1-5 polypeptide (SEQ ID NOs: 35-39), a linker from a marsupial ??TCR (e.g., LEKT; SEQ ID NO: 33), and any combination thereof.

    35. The engineered TCR of claims 28-34, wherein the one or more polypeptide linkers comprises a linker from a marsupial YTCR, comprising an amino acid sequence as set forth in SEQ ID NO: 33.

    36. The engineered TCR of claims 28-35, wherein the one or more polypeptide linkers comprise a GGGGS (SEQ ID NO: 35) linker (G4S).

    37. The engineered TCR of claims 28-36, wherein the one or more polypeptide linkers comprise a marsupial ??TCR linker and a G4S linker as set forth in SEQ ID NO: 34.

    38. The engineered TCR of claims 28-37, wherein the one or more polypeptide linkers comprise two GGGGS linkers (2?G4S) (SEQ ID NO: 36).

    39. The engineered TCR of claims 28-38, wherein the one or more polypeptide linkers comprise three GGGGS linkers (3?G4S) (SEQ ID NO: 37).

    40. The engineered TCR of claims 28-39, wherein the one or more polypeptide linkers comprise an amino acid sequence as set forth in any one of SEQ ID NOs: 33-53.

    41. The engineered TCR of any one of claims 10-40, wherein the first and second antigen-binding domains are separated by a second polypeptide linker.

    42. The engineered TCR of claim 41, wherein the second polypeptide linker is about 2 to about 25 amino acids long.

    43. The engineered TCR of claim 41 or claim 42, wherein the second polypeptide linker is about 4 to about 15 amino acids long.

    44. The engineered TCR of any one of claims 41-43, wherein the second polypeptide linker comprises a linker selected from the group consisting of: GG, GS, SG, SS, GSS, SSG, GSG, SGS, SGG, GGS, GGGS (SEQ ID NO: 53), (GGGGS).sub.1-5 polypeptide (SEQ ID NOs: 35-39), and any combination thereof.

    45. The engineered TCR of any one of claims 41-44, wherein the second polypeptide linker comprises an amino acid sequence as set forth in any one of SEQ ID NOs: 33-53.

    46. The engineered TCR of any one of claims 1-45, wherein the TCR variable domains bind a target polypeptide presented by an MHC complex.

    47. The engineered TCR of any one of the claims 1-46, wherein the TCR variable domains bind a target polypeptide derived from a protein selected from the group consisting of: ?-fetoprotein (AFP), ASCL2, B Melanoma Antigen (BAGE) family members, Brother of the regulator of imprinted sites (BORIS), Cancer-testis antigens, Cancer-testis antigen 83 (CT-83), Carbonic anhydrase IX (CAIX), Carcinoembryonic antigen (CEA), Cytomegalovirus (CMV) antigens, Cytotoxic T cell (CTL)-recognized antigen on melanoma (CAMEL), Epstein-Barr virus (EBV) antigens, EPHB2, G antigen 1 (GAGE-1), GAGE-2, GAGE-3, GAGE-4, GAGE-5, GAGE-6, GAGE-7B, GAGE-8, Glycoprotein 100 (GP100), Hepatitis B virus (HBV) antigens, Hepatitis C virus (HCV) non-structure protein 3 (NS3), Human papillomavirus (HPV)-E6, HPV-E7, Human telomerase reverse transcriptase (hTERT), IGF2BP3/A3, IGF2BP1, K-Ras, K-Ras G12C, K-Ras G12D, K-Ras G12V, Latent membrane protein 2 (LMP2), LY6G6D, Melanoma antigen family A, 1 (MAGE-A1), MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A6, MAGE-A10, MAGE-A12, Melanoma antigen recognized by T cells (MART-1), Mesothelin (MSLN), Mucin 1 (MUC1), Mucin 16 (MUC16), New York esophageal squamous cell carcinoma-1 (NYESO-1), P53,P antigen (PAGE) family members, PAP, PIK3CA, PIK3CA H1047R, Placenta-specific 1 (PLAC1), Preferentially expressed antigen in melanoma (PRAME), Prostate specific antigen PSA, Survivin, Synovial sarcoma X 1 (SSX1), Synovial sarcoma X 2 (SSX2), Synovial sarcoma X 3 (SSX3), Synovial sarcoma X 4 (SSX4), Synovial sarcoma X 5 (SSX5), Synovial sarcoma X 8 (SSX8), Thyroglobulin, TP53 R175H, Tyrosinase, Tyrosinase related protein (TRP)1, TRP2, UBD, Wilms tumor protein (WT-1), Wnt10A, X Antigen Family Member 1 (XAGE1), and X Antigen Family Member 2 (XAGE2).

    48. The engineered TCR of any one of the claims 1-47, wherein the TCR variable domains bind a target polypeptide derived from MAGE-A4, PRAME, K-Ras, TP53R175H, PSA, or IGF2BP3.

    49. The engineered TCR of any one of the claims 1-48, wherein the TCR variable domains bind a target polypeptide derived from MAGE-A4.

    50. The engineered TCR of any one of claims 1-49, wherein the TCR? constant domain comprises an amino acid sequence at least 90% identical to an amino acid sequence as set forth in SEQ ID NOs: 82 or 88, and/or the TCR? constant domain comprises an amino acid sequence at least 90% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 80, 81, 86, or 87.

    51. The engineered TCR of any one of claims 1-49, wherein the TCR? constant domain comprises an amino acid sequence at least 90% identical to an amino acid sequence as set forth in SEQ ID NO: 83 or 84, and/or the TCR? constant domain comprises an amino acid sequence at least 90% identical to an amino acid sequence as set forth in any one of SEQ ID NO: 85.

    52. The engineered TCR of any one of claims 1-51, wherein the TCR? or TCR? polypeptide comprises (i) an amino acid sequence as set forth in any one of SEQ ID NOs: 105-111, or (ii) a TCR? or TCR? variable domain comprising an amino acid sequence as set forth in any one of SEQ ID NOs: 62, 64, 66, 68, 70, 72, 74, 76, and 78.

    53. The engineered TCR of any one of claims 1-52, wherein the TCR? or TCR? polypeptide comprises (i) an amino acid sequence as set forth in SEQ ID NO: 103 or 104, or (ii) a TCR? or TCR? variable domain comprising an amino acid sequence as set forth in any one of SEQ ID NOs: 63, 65, 67, 69, 71, 73, 75, 77, and 79.

    54. A fusion polypeptide comprising: a) a TCR? polypeptide comprising a TCR? variable domain; b) a polypeptide cleavage signal; and c) a TCR? polypeptide comprising one or more antigen-binding domains, a polypeptide linker, and a TCR? variable domain.

    55. A fusion polypeptide comprising: a) a TCR? polypeptide comprising one or more antigen-binding domains, a polypeptide linker, and a TCR? variable domain; b) a polypeptide cleavage signal; and c) a TCR? polypeptide comprising a TCR? variable domain.

    56. A fusion polypeptide comprising: a) a TCR? polypeptide comprising one or more antigen-binding domains, a polypeptide linker, and a TCR? variable domain; b) a polypeptide cleavage signal; and c) a TCR? polypeptide comprising one or more antigen-binding domains, a polypeptide linker, and a TCR? variable domain.

    57. A fusion polypeptide comprising: a) a TCR? polypeptide comprising a TCR? variable domain; b) a polypeptide cleavage signal; and c) a TCR? polypeptide comprising one or more antigen-binding domains, a polypeptide linker, and a TCR? variable domain.

    58. A fusion polypeptide comprising: a) a TCR? polypeptide comprising one or more antigen-binding domains, a polypeptide linker, and a TCR? variable domain; b) a polypeptide cleavage signal; and c) a TCR? polypeptide comprising a TCR? variable domain.

    59. A fusion polypeptide comprising: a) a TCR? polypeptide comprising one or more antigen-binding domains, a polypeptide linker, and a TCR? variable domain; b) a polypeptide cleavage signal; and c) a TCR? polypeptide comprising one or more antigen-binding domains, a polypeptide linker, and a TCR? variable domain.

    60. The fusion polypeptide of any one of claims 54-56, wherein the TCR? polypeptide comprises TCR? constant domain, and the TCR? polypeptide comprises a TCR? constant domain.

    61. The fusion polypeptide of any one of claims 57-59, wherein the TCR? polypeptide comprises TCR? constant domain, and the TCR? polypeptide comprises a TCR? constant domain.

    62. The fusion polypeptide of any one of claims 54-61, wherein the one or more antigen-binding domains comprises a first antigen-binding domain linked to the TCR? or TCR? variable domain.

    63. The fusion polypeptide of any one of claims 54-62, wherein the one or more antigen-binding domains comprises a first antigen-binding domain linked to the TCR? or TCR? variable domain.

    64. The fusion polypeptide of any one of claims 54-63, wherein the one or more antigen-binding domains comprise: (i) a first antigen-binding domain linked to the TCR? or TCR? variable domain, and (ii) a first antigen-binding domain linked to the TCR? or TCR? variable domain.

    65. The fusion polypeptide of any one of claims 62-64, wherein the first antigen-binding domains are linked to the N-terminus of the variable domains.

    66. The fusion polypeptide of any one of claims 62-65, wherein the first antigen-binding domains are the same or different, and/or bind to the same or different target antigens.

    67. The fusion polypeptide of any one of claims 62-66, wherein the one or more antigen-binding domains comprises a second antigen-binding domain linked to the first antigen-binding domain linked to the TCR? or TCR? variable domain.

    68. The fusion polypeptide of any one of claims 62-67, wherein the one or more antigen-binding domains comprises a second antigen-binding domain is linked to the first antigen-binding domain linked to the TCR? or TCR? variable domain.

    69. The fusion polypeptide of any one of claims 62-68, wherein the one or more antigen-binding domains comprises: (i) a second antigen-binding domain linked to the first antigen-binding domain linked to the TCR? or TCR? variable domain, and (ii) a second antigen-binding domain linked to the first antigen-binding domain linked to the TCR? or TCR? variable domain.

    70. The fusion polypeptide of any one of claims 67-69, wherein the second antigen-binding domains are linked to the N-terminus of the first antigen-binding domain.

    71. The fusion polypeptide of claim 69 or claim 70, wherein the second antigen-binding domains are the same or different, and/or bind to the same or different target antigens.

    72. The fusion polypeptide of any one of claims 67-71, wherein the first and second antigen-binding domains are the same or different, and/or bind to the same or different target antigens.

    73. The fusion polypeptide of any one of claims 54-72, wherein the one or more antigen-binding domains bind a target antigen selected from the group consisting of: alpha folate receptor (FR?), ?.sub.v?.sub.6 integrin, ADGRE2, BACE2, B cell maturation antigen (BCMA), B7-H3 (CD276), B7-H4, B7-H6, CA19.9, carbonic anhydrase IX (CAIX), CCR1, CD7, CD16, CD19, CD20, CD22, CD30, CD33, CD37, CD38, CD44, CD44v6, CD44v7/8, CD70, CD79a, CD79b, CD123, CD133, CD138, CD171, CD244, carcinoembryonic antigen (CEA), C-type lectin-like molecule-1 (CLL-1), CD2 subset 1 (CS-1), CLDN6, cMET, chondroitin sulfate proteoglycan 4 (CSPG4), CLDN18.2, cutaneous T cell lymphoma-associated antigen 1 (CTAGE1), DLL3, epidermal growth factor receptor (EGFR), epidermal growth factor receptor variant III (EGFRvIII), EGFR806, epithelial glycoprotein 2 (EGP2), epithelial glycoprotein 40 (EGP40), EPHB2, ERBB4, epithelial cell adhesion molecule (EPCAM), ephrin type-A receptor 2 (EPHA2), fibroblast activation protein (FAP), Fc Receptor Like 5 (FCRL5), fetal acetylcholinesterase receptor (AchR), FLT3, FN, FN-EDB, FRBeta, ganglioside G2 (GD2), ganglioside G3 (GD3), Glypican-3 (GPC3), EGFR family including ErbB2 (HER2), HER2p95, EGFRv3, IL-10R?, IL-13R?2, Kappa, cancer/testis antigen 2 (LAGE-1A), K-Ras, K-Ras G12C, K-Ras G12D, K-Ras G12V, Lambda, Lewis-Y (LeY), L1 cell adhesion molecule (L1-CAM), LILRB2, LY6G6GD, melanoma antigen recognized by T cells 1 (MelanA or MART1), Mesothelin (MSLN), MMP10, MUC1, MUC16, MHC class I chain related proteins A (MICA), MHC class I chain related proteins B (MICB), neural cell adhesion molecule (NCAM), prostate stem cell antigen (PSCA), prostate-specific membrane antigen (PSMA), receptor tyrosine kinase-like orphan receptor 1 (ROR1), synovial sarcoma, X breakpoint 2 (SSX2), Survivin, tumor associated glycoprotein 72 (TAG72), transmembrane activator and CAML interactor (TACI), tumor endothelial marker 1 (TEM1/CD248), tumor endothelial marker 7-related (TEM7R), TIM3, trophoblast glycoprotein (TPBG), UL16-binding protein (ULBP) 1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, and vascular endothelial growth factor receptor 2 (VEGFR2).

    74. The fusion polypeptide of any one of claims 54-73, wherein the one or more antigen-binding domains bind a target polypeptide derived from a protein selected from the group consisting of: ?-fetoprotein (AFP), ASCL2, B Melanoma Antigen (BAGE) family members, Brother of the regulator of imprinted sites (BORIS), Cancer-testis antigens, Cancer-testis antigen 83 (CT-83), Carbonic anhydrase IX (CAIX), Carcinoembryonic antigen (CEA), Cytomegalovirus (CMV) antigens, Cytotoxic T cell (CTL)-recognized antigen on melanoma (CAMEL), Epstein-Barr virus (EBV) antigens, EPHB2, G antigen 1 (GAGE-1), GAGE-2, GAGE-3, GAGE-4, GAGE-5, GAGE-6, GAGE-7B, GAGE-8, Glycoprotein 100 (GP100), Hepatitis B virus (HBV) antigens, Hepatitis C virus (HCV) non-structure protein 3 (NS3), Human papillomavirus (HPV)-E6, HPV-E7, Human telomerase reverse transcriptase (hTERT), IGF2BP3/A3, IGF2BP1, K-Ras, K-Ras G12C, K-Ras G12D, K-Ras G12V, Latent membrane protein 2 (LMP2), LY6G6D, Melanoma antigen family A, 1 (MAGE-A1), MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A6, MAGE-A10, MAGE-A12, Melanoma antigen recognized by T cells (MART-1), Mesothelin (MSLN), Mucin 1 (MUC1), Mucin 16 (MUC16), New York esophageal squamous cell carcinoma-1 (NYESO-1), P53,P antigen (PAGE) family members, PAP, PIK3CA, PIK3CA H1047R, Placenta-specific 1 (PLAC1), Preferentially expressed antigen in melanoma (PRAME), Prostate specific antigen PSA, Survivin, Synovial sarcoma X 1 (SSX1), Synovial sarcoma X 2 (SSX2), Synovial sarcoma X 3 (SSX3), Synovial sarcoma X 4 (SSX4), Synovial sarcoma X 5 (SSX5), Synovial sarcoma X 8 (SSX8), Thyroglobulin, TP53 R175H, Tyrosinase, Tyrosinase related protein (TRP)1, TRP2, UBD, Wilms tumor protein (WT-1), Wnt10A, X Antigen Family Member 1 (XAGE1), and X Antigen Family Member 2 (XAGE2).

    75. The fusion polypeptide of claims 54-74, wherein the one or more antigen-binding domains bind CD33, CLL1, CD19, CD20, CD22, CD79A, CD79B, or BCMA.

    76. The engineered TCR of any one of claims 54-74, wherein the one or more antigen-binding domains bind CD19, CD20, CD22, CD33, CD79A, CD79B, B7H3, Muc16, Her2, EGFR, FN-EDB, CLDN18.2, DLL3, FLT3, CLL1, CD123, or BCMA.

    77. The engineered TCR of any one of claims 54-74, wherein the one or more antigen-binding domains comprises an amino acid sequence at least 95% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 1-32.

    78. The fusion polypeptide of any one of claims 54-77, wherein the one or more antigen-binding domains comprise an antibody or antigen binding fragment thereof selected from the group consisting of: a Camel Ig, a Llama Ig, an Alpaca Ig, Ig NAR, a Fab fragment, a F(ab).sub.2 fragment, a bispecific Fab dimer (Fab2), a trispecific Fab trimer (Fab3), an Fv, an single chain Fv protein (scFv), a bis-scFv, (scFv).sub.2, a minibody, a diabody, a triabody, a tetrabody, a disulfide stabilized Fv protein (dsFv), and a single-domain antibody (sdAb, a camelid VHH, Nanobody).

    79. The fusion polypeptide of any one of claims 54-78, wherein the one or more antigen-binding domains comprise one or more single-chain variable fragments (scFv).

    80. The fusion polypeptide of any one of claims 54-79, wherein the one or more antigen-binding domains comprise one or more single domain antibodies (sdAb).

    81. The fusion polypeptide of claim 80, wherein the sdAb is a camelid VHH, nanobody, or heavy chain-only antibody (HcAb).

    82. The fusion polypeptide of claim 80, wherein the sdAb is a camelid VHH.

    83. The fusion polypeptide of any one of claims 74-82, wherein the antibody or antigen binding fragment thereof is human or humanized.

    84. The fusion polypeptide of any one of claims 54-76, wherein the one or more antigen-binding domains comprise a ligand.

    85. The fusion polypeptide of any one of claims 54-84, wherein the one or more antigen-binding domains are linked to the TCR variable domains by one or more polypeptide linkers.

    86. The fusion polypeptide of claim 85, wherein the one or more polypeptide linkers comprise a linker from about 2 to about 25 amino acids long.

    87. The fusion polypeptide of claim 85 or claim 86, wherein the one or more polypeptide linkers comprise a linker from about 4 to about 15 amino acids long.

    88. The fusion polypeptide of any one of claims 85-87, wherein the one or more polypeptide linkers comprise a linker from about 4 to about 10 amino acids long.

    89. The fusion polypeptide of any one of claims 85-88, wherein the one or more polypeptide linkers comprise a linker of about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, or about 15 amino acids long.

    90. The fusion polypeptide of any one of claims 85-89, wherein the one or more polypeptide linkers comprise a linker of about 9 or about 10 amino acids long.

    91. The fusion polypeptide of any one of claims 85-90 wherein the one or more polypeptide linkers comprise a linker selected from the group consisting of: GG, GS, SG, SS, GSS, SSG, GSG, SGS, SGG, GGS, GGGS (SEQ ID NO: 53), (GGGGS).sub.1-5 polypeptide (SEQ ID NOs: 35-39), a linker from a marsupial ??TCR (e.g., LEKT; SEQ ID NO: 33), and any combination thereof.

    92. The fusion polypeptide of claims 85-91, wherein the one or more polypeptide linkers comprises a linker from a marsupial YTCR, comprising an amino acid sequence as set forth in SEQ ID NO: 33.

    93. The fusion polypeptide of claims 85-92, wherein the one or more polypeptide linkers comprise a GGGGS (SEQ ID NO: 35) linker (G4S).

    94. The fusion polypeptide of claims 85-93, wherein the one or more polypeptide linkers comprise a marsupial ??TCR linker and a G4S linker as set forth in SEQ ID NO: 34.

    95. The fusion polypeptide of claims 85-94, wherein the one or more polypeptide linkers comprise two GGGGS linkers (2?G4S) (SEQ ID NO: 36).

    96. The fusion polypeptide of claims 85-95, wherein the one or more polypeptide linkers comprise three GGGGS linkers (3?G4S) (SEQ ID NO: 37).

    97. The fusion polypeptide of claims 85-96, wherein the one or more polypeptide linkers comprise an amino acid sequence as set forth in any one of SEQ ID NOs: 33-53.

    98. The fusion polypeptide of any one of claims 67-97, wherein the first and second antigen-binding domains are separated by a second polypeptide linker.

    99. The fusion polypeptide of claim 98, wherein the second polypeptide linker is about 2 to about 25 amino acids long.

    100. The fusion polypeptide of claim 98 or claim 99, wherein the one or more polypeptide linkers comprise a linker from about 4 to about 15 amino acids long.

    101. The fusion polypeptide of any one of claims 98-100, wherein the second polypeptide linker comprises a linker selected from the group consisting of: GG, GS, SG, SS, GSS, SSG, GSG, SGS, SGG, GGS, GGGS (SEQ ID NO: 53), (GGGGS).sub.1-5 polypeptide (SEQ ID NOs: 35-39), and any combination thereof.

    102. The fusion polypeptide of any one of claims 98-101, wherein the second polypeptide linker comprises an amino acid sequence as set forth in any one of SEQ ID NOs: 33-53.

    103. The fusion polypeptide of any one of claims 54-102, wherein the TCR variable domains bind a target polypeptide presented by an MHC complex.

    104. The fusion polypeptide of any one of the claims 54-103, wherein the TCR variable domains bind a target polypeptide derived from a protein selected from the group consisting of: ?-fetoprotein (AFP), ASCL2, B Melanoma Antigen (BAGE) family members, Brother of the regulator of imprinted sites (BORIS), Cancer-testis antigens, Cancer-testis antigen 83 (CT-83), Carbonic anhydrase IX (CAIX), Carcinoembryonic antigen (CEA), Cytomegalovirus (CMV) antigens, Cytotoxic T cell (CTL)-recognized antigen on melanoma (CAMEL), Epstein-Barr virus (EBV) antigens, EPHB2, G antigen 1 (GAGE-1), GAGE-2, GAGE-3, GAGE-4, GAGE-5, GAGE-6, GAGE-7B, GAGE-8, Glycoprotein 100 (GP100), Hepatitis B virus (HBV) antigens, Hepatitis C virus (HCV) non-structure protein 3 (NS3), Human papillomavirus (HPV)-E6, HPV-E7, Human telomerase reverse transcriptase (hTERT), IGF2BP3/A3, IGF2BP1, K-Ras, K-Ras G12C, K-Ras G12D, K-Ras G12V, Latent membrane protein 2 (LMP2), LY6G6D, Melanoma antigen family A, 1 (MAGE-A1), MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A6, MAGE-A10, MAGE-A12, Melanoma antigen recognized by T cells (MART-1), Mesothelin (MSLN), Mucin 1 (MUC1), Mucin 16 (MUC16), New York esophageal squamous cell carcinoma-1 (NYESO-1), P53,P antigen (PAGE) family members, PAP, PIK3CA, PIK3CA H1047R, Placenta-specific 1 (PLAC1), Preferentially expressed antigen in melanoma (PRAME), Prostate specific antigen PSA, Survivin, Synovial sarcoma X 1 (SSX1), Synovial sarcoma X 2 (SSX2), Synovial sarcoma X 3 (SSX3), Synovial sarcoma X 4 (SSX4), Synovial sarcoma X 5 (SSX5), Synovial sarcoma X 8 (SSX8), Thyroglobulin, TP53 R175H, Tyrosinase, Tyrosinase related protein (TRP)1, TRP2, UBD, Wilms tumor protein (WT-1), Wnt10A, X Antigen Family Member 1 (XAGE1), and X Antigen Family Member 2 (XAGE2).

    105. The fusion polypeptide of any one of the claims 54-104, wherein the TCR variable domains bind a target polypeptide derived from MAGE-A4, PRAME, K-Ras, TP53R175H, PSA, or IGF2BP3.

    106. The fusion polypeptide of any one of the claims 54-105, wherein the TCR variable domains bind a target polypeptide derived from MAGE-A4.

    107. The engineered TCR of any one of claims 54-106, wherein the TCR? constant domain comprises an amino acid sequence at least 90% identical to an amino acid sequence as set forth in SEQ ID NOs: 82 or 88, and/or the TCR? constant domain comprises an amino acid sequence at least 90% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 80, 81, 86, or 87.

    108. The engineered TCR of any one of claims 54-106, wherein the TCR? constant domain comprises an amino acid sequence at least 90% identical to an amino acid sequence as set forth in SEQ ID NO: 83 or 84, and/or the TCR? constant domain comprises an amino acid sequence at least 90% identical to an amino acid sequence as set forth in any one of SEQ ID NO: 85.

    109. The fusion polypeptide of any one of claims 54-108, wherein the TCR? or TCR? polypeptide comprises (i) an amino acid sequence as set forth in any one of SEQ ID NOs: 105-111, or (ii) a TCR? or TCR? variable domain comprising an amino acid sequence as set forth in any one of SEQ ID NOs: 62, 64, 66, 68, 70, 72, 74, 76, and 78.

    110. The fusion polypeptide of any one of claims 54-109, wherein the TCR? or TCR? polypeptide comprises an amino acid sequence as set forth in any one of SEQ ID NOs: 103 or 104, or (ii) a TCR? or TCR? variable domain comprising an amino acid sequence as set forth in any one of SEQ ID NOs: 63, 65, 67, 69, 71, 73, 75, 77, and 79.

    111. The fusion polypeptide of any one of claims 54-110, wherein the polypeptide cleavage signal is a viral self-cleaving peptide or ribosomal skipping sequence.

    112. The fusion polypeptide of any one of claims 54-111, wherein the polypeptide cleavage signal is a viral 2A peptide.

    113. The fusion polypeptide of any one of claims 54-112, wherein the polypeptide cleavage signal is an aphthovirus 2A peptide, a potyvirus 2A peptide, or a cardiovirus 2A peptide.

    114. The fusion polypeptide of any one of claims 54-113, wherein the polypeptide cleavage signal is a viral 2A peptide selected from the group consisting of: a foot-and-mouth disease virus (FMDV) 2A peptide, an equine rhinitis A virus (ERAV) 2A peptide, a Thosea asigna virus (TaV) 2A peptide, a porcine teschovirus-1 (PTV-1) 2A peptide, a Theilovirus 2A peptide, and an encephalomyocarditis virus 2A peptide.

    115. The fusion polypeptide of any one of claims 111-114, wherein the polypeptide cleavage signal comprises a furin recognition site upstream of the self-cleaving peptide, optionally wherein the furin recognition site comprises the amino acid sequence as set forth in SEQ ID NO: 112.

    116. The fusion polypeptide of any one of claims 54-115, wherein the polypeptide cleavage signal comprises an amino acid sequence as set forth in any one of SEQ ID NOs: 113-137.

    117. The fusion polypeptide of any one of claims 54-116, wherein the TCR? or TCR? polypeptide is N-terminal of the TCR? or TCR? polypeptide.

    118. The fusion polypeptide of any one of claims 54-116, wherein the TCR? or TCR? polypeptide is N-terminal of the TCR? or TCR? polypeptide.

    119. The fusion polypeptide of any one of claims 54-118, wherein the TCR? and TCR? polypeptides each comprise an N-terminal signal sequence.

    120. The fusion polypeptide of any one of claims 54-119, wherein the TCR? and TCR? polypeptides each comprises an N-terminal signal sequence.

    121. The fusion polypeptide of claim 119 or claim 120, wherein the signal sequences are the same or different.

    122. The fusion polypeptide of any one of claims 119-121, wherein the signal sequence is an IgK or TCR? signal sequence.

    123. The fusion polypeptide of any one of claims 54-122, wherein the fusion polypeptide comprises an amino acid sequence at least 90% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 91-97, 100, and 102.

    124. A polynucleotide encoding the TCR polypeptides of the engineered TCR according to any one of claims 1-51, or the fusion polypeptide of any one of claims 54-123.

    125. A vector comprising the polynucleotide of claim 124.

    126. The vector of claim 125, wherein the vector is an expression vector, retroviral vector, or a lentiviral vector.

    127. A cell comprising the engineered TCR according to any one of claims 1-53, the fusion polypeptide of any one of claims 54-123, the polynucleotide of claim 124, or the vector of claim 125 or claim 126.

    128. The cell of claim 127, wherein the cell is a hematopoietic cell.

    129. The cell of claim 127 or claim 128, wherein the cell is a T cell, an ??-T cell, or a ??-T cell.

    130. The cell of any one of claims 127-129, wherein the cell is a CD3.sup.+, CD4.sup.+, and/or CD8.sup.+ cell.

    131. The cell of any one of claims 127-130, wherein the cell is an immune effector cell.

    132. The cell of any one of claims 127-131, wherein the cell is a cytotoxic T lymphocytes (CTLs), a tumor infiltrating lymphocytes (TILs), or a helper T cell.

    133. The cell of any one of claims 127-132, wherein the cell is a T cell, a natural killer (NK) cell, or a natural killer T (NKT) cell.

    134. The cell of any one of claims 127-133, wherein the source of the cell is peripheral blood mononuclear cells, bone marrow, lymph nodes tissue, cord blood, thymus issue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, or tumors.

    135. The cell of any one of claims 127-134, wherein the cell is an isolated non-natural cell.

    136. The cell of any one of claims 127-135, wherein the cell is obtained from a subject.

    137. The cell of any one of claims 127-136, wherein the cell is a human cell.

    138. A composition comprising the engineered TCR according to any one of claims 1-53, the fusion polypeptide of any one of claims 54-123, the polynucleotide of claim 124, or the vector of claim 125 or claim 126, or the cell of any one of claims 127-137.

    139. A pharmaceutical composition comprising a pharmaceutically acceptable carrier and the engineered TCR according to any one of claims 1-53, the fusion polypeptide of any one of claims 54-123, the polynucleotide of claim 124, or the vector of claim 125 or claim 126, or the cell of any one of claims 127-137.

    140. A method of treating a subject in need thereof comprising administering the subject an effective amount of the cell of any one of claims 127-137, the composition of claim 138, or the pharmaceutical composition of claim 139.

    141. A method of treating, preventing, or ameliorating at least one symptom of a cancer, infectious disease, autoimmune disease, inflammatory disease, and immunodeficiency, or condition associated therewith, comprising administering to the subject an effective amount of the cell of any one of claims 127-137, the composition of claim 138, or the pharmaceutical composition of claim 139.

    142. A method of treating a solid cancer comprising administering to the subject an effective amount of the cell of any one of claims 127-137, the composition of claim 138, or the pharmaceutical composition of claim 139.

    143. The method of claim 142, wherein the solid cancer is selected from the group consisting of: lung cancer, squamous cell carcinoma, colorectal cancer, pancreatic cancer, breast cancer, thyroid cancer, bladder cancer, cervical cancer, esophageal cancer, ovarian cancer, gastric cancer endometrial cancer, brain cancer, or sarcoma.

    144. The method of claim 142, wherein the solid cancer is a non-small cell lung carcinoma (NSCLC), small cell lung cancer (SCLC), head and neck squamous cell carcinoma, colorectal cancer, pancreatic cancer, breast cancer, thyroid cancer, bladder cancer, cervical cancer, esophageal cancer, ovarian cancer, gastric cancer endometrial cancer, gliomas, glioblastomas, oligodendroglioma, sarcoma, or osteosarcoma.

    145. A method of treating a hematological malignancy comprising administering to the subject an effective amount of the cell of any one of claims 127-137, the composition of claim 138, or the pharmaceutical composition of claim 139.

    146. The method of claim 145, wherein the hematological malignancy is a leukemia, lymphoma, or multiple myeloma.

    147. The method of claim 145 or claim 146, wherein the hematological malignancy is selected from the group consisting of non-Hodgkin's lymphoma, acute myeloid leukemia (AML), acute lymphoblastic leukemia (ALL).

    Description

    BRIEF DESCRIPTION OF SEVERAL VIEWS OF THE DRAWINGS

    [0051] FIG. 1A shows illustrative MAGE TCR, CD33 DARIC, and engineered TCR (VHH-TCR) construct designs.

    [0052] FIG. 1B shows an illustrative engineered TCR having a VHH linked to a TCR.

    [0053] FIG. 2A shows VHH expression on immune effector cells.

    [0054] FIG. 2B shows engineered TCR/receptor cytokine response against A549.CD33 cells.

    [0055] FIG. 2C shows engineered TCR/receptor cytotoxicity against A549.CD33 cells.

    [0056] FIG. 3A shows engineered TCR/receptor expression on immune effector cells.

    [0057] FIG. 3B shows engineered TCR/receptor cytokine response against A549.A2.MAGEA4 cells.

    [0058] FIG. 3C shows engineered TCR/receptor cytotoxicity against A549.A2.MAGEA4 cells.

    [0059] FIG. 4A shows engineered TCR cytokine response against MAGEA4 peptide.

    [0060] FIGS. 4B and 4C show engineered TCR cytokine response against cells electroporated with varying amounts of CD33 mRNA.

    [0061] FIGS. 5A-5C show engineered TCR and DARIC cytotoxicity against HL-60, Kasumi1, and OCI-AML3 cells.

    [0062] FIG. 6 shows illustrative engineered TCR constructs.

    [0063] FIG. 7A shows VHH expression on immune effector cells.

    [0064] FIG. 7B shows engineered TCR/receptor cytokine response against A549.CD33 cells.

    [0065] FIG. 7C shows engineered TCR/receptor cytotoxicity against A549.CD33 cells.

    [0066] FIG. 8A shows VHH expression on immune effector cells.

    [0067] FIG. 8B shows engineered TCR/receptor cytokine response against A549.MAGEA4.A2 cells.

    [0068] FIG. 8C shows engineered TCR/receptor cytotoxicity against A549.MAGEA4.A2 cells.

    [0069] FIG. 9 shows illustrative engineered TCR constructs.

    [0070] FIG. 10A shows VHH expression on immune effector cells.

    [0071] FIG. 10B shows engineered TCR/receptor cytokine response against A549.CD33 cells.

    [0072] FIG. 10C shows engineered TCR/receptor cytotoxicity against A549.CD33 cells.

    [0073] FIG. 11A shows VHH expression on immune effector cells.

    [0074] FIG. 11B shows engineered TCR cytokine response against A549.MAGEA4.A2 cells.

    [0075] FIG. 11C shows engineered TCR/receptor cytotoxicity against A549.MAGEA4.A2 cells.

    [0076] FIG. 12A shows illustrative MAGE TCR, CD33 DARIC, CLL1 DARIC, CLL1-CD33 DARIC, and engineered TCR (CLL1-CD33 VHH TCR) construct designs.

    [0077] FIG. 12B shows an illustrative engineered TCR having two VHHs linked to the TCR.

    [0078] FIG. 13A shows CD33-based receptor expression on immune effector cells.

    [0079] FIG. 13B shows engineered TCR/receptor cytokine response against A549.CD33 cells.

    [0080] FIG. 14A shows CLL1-based receptor expression on immune effector cells.

    [0081] FIG. 14B shows engineered TCR/receptor cytokine response against A549.CLL1 cells.

    [0082] FIG. 15A shows TCR expression on immune effector cells.

    [0083] FIG. 15B shows engineered TCR/receptor cytokine response against A549.MAGEA4 cells.

    [0084] FIG. 16 shows TCR and CAR expression on immune effector cells.

    [0085] FIG. 17 shows engineered TCR and CAR cytokine responses against A375.NLR (MAGEA4+; BCMA?) cells.

    [0086] FIG. 18A shows engineered TCR and CAR IFNg cytokine response against Toledo cells.

    [0087] FIG. 18B shows engineered TCR and CAR IL-2 cytokine response against Toledo cells.

    [0088] FIG. 19 shows antigen-independent IFNg cytokine response with engineered TCR and CAR T cells alone.

    [0089] FIG. 20A shows illustrative MAGEA4 TCR, scFv CAR, and engineered TCR (scFv TCR) construct designs.

    [0090] FIG. 20B shows an illustrative engineered TCR having an scFv linked to the TCR.

    [0091] FIG. 21A shows BCMA-based receptor expression on immune effector cells.

    [0092] FIG. 21B shows engineered TCR/receptor IFNg cytokine response against HT1080.BCMA, RPMI-8226, and Toledo cells.

    [0093] FIG. 21C shows engineered TCR/receptor IL-2 cytokine response against HT1080.BCMA, RPMI-8226, and Toledo cells.

    [0094] FIG. 21D shows engineered TCR/receptor TNF? cytokine response against HT1080.BCMA, RPMI-8226, and Toledo cells.

    [0095] FIG. 21E shows engineered TCR/receptor cytotoxicity against HT1080.BCMA cells.

    [0096] FIG. 22A shows TCR expression on immune effector cells.

    [0097] FIG. 22B shows engineered TCR/receptor IFNg, IL2, and TNF? cytokine response against A375 cells.

    [0098] FIG. 23 shows HL-60.FP (CD33+ MAGEA4?) tumor growth in an NGS systemic tumor model treated with UTD T cells, CD33 DARIC T cells, MAGEA4 TCR T cells, or VHH-TCR T cells.

    [0099] FIG. 24 shows NCI-H2023 (CD33? MAGEA4+) tumor growth in an NGS subcutaneous tumor model treated with UTD T cells, CD33 DARIC T cells, MAGEA4 TCR T cells, or VHH-TCR T cells.

    [0100] FIG. 25A shows TCR/ATOMIC expression on immune effector cells.

    [0101] FIG. 25B shows engineered TCR/ATOMIC IFNg cytokine response against RPMI-8226 cells.

    [0102] FIG. 25C shows engineered TCR/ATOMIC IFNg cytokine response against K562.CD19 cells.

    BRIEF DESCRIPTION OF THE SEQUENCE IDENTIFIERS

    [0103] SEQ ID NOs: 1-32 set forth the amino acid sequences for representative target antigen binding domains.

    [0104] SEQ ID NOs: 33-53 set forth the amino acid sequences for representative polypeptide linkers.

    [0105] SEQ ID NOs: 54-79 set forth the amino acid sequences for representative TCR components (e.g., TCR variable regions).

    [0106] SEQ ID NOs: 80-88 set forth the amino acid sequences for representative TCR constant domains.

    [0107] SEQ ID NO: 89 sets forth the amino acid sequence for a representative MAGEA4-targeting TCR.

    [0108] SEQ ID NOs: 90, 98, and 99 set forth the amino acid sequences for representative DARICs.

    [0109] SEQ ID NO: 91-97, 100, and 102 set forth the amino acid sequences for representative engineered TCR constructs/ATOMICs.

    [0110] SEQ ID NO: 101 sets forth the amino acid sequences for a representative anti-BCMA CAR.

    [0111] SEQ ID NOs: 103-111 set forth the amino acid sequences for representative TRA or TRB polypeptides.

    [0112] SEQ ID NO: 112 sets forth the amino acid sequence for a representative furin cleavage site.

    [0113] SEQ ID NO: 113-137 set forth the amino acid sequences for representative polypeptide cleavage signal (e.g., self-cleaving peptides).

    [0114] In the foregoing sequences, X, if present, refers to any amino acid or the absence of an amino acid.

    DETAILED DESCRIPTION

    A. Overview

    [0115] The present disclosure generally relates to, in part, TCR-based constructs engineered to comprise one or more additional binding domains (e.g., antigen-binding domains), and methods of using the same. Without wishing to be bound by any particular theory, the inventors have unexpectedly discovered that TCRs engineered to comprise both a TCR binding domain (e.g., a TCR variable domain) and one or more additional antigen-binding domains are surprisingly effective at cell killing, and can target cells expressing either a TCR antigen, a non-TCR antigen, or both.

    [0116] The multi-chain architecture of the TCR poses significant structural hurdles to grafting secondary binders into the TCR architecture, and success has primarily been achieved through co-expressing scFv-CD3 chain fusions or replacing the TCR variable regions with antibody-based binders. Overall, the complexity and MHC-restricted nature of the TCR architecture has stymied the development of broadly applicable technologies that achieve high levels of sensitivity and/or multiplexing. At minimum, there are very few potential solutions to these important challenges that do not consume the majority of available vector (e.g., lentiviral) payload space.

    [0117] Thus, disclosed herein is an efficient and effective engineered/hybrid TCR architecture that enables concurrent TCR targeting and secondary binder targeting. Specifically, an antigen-binding domain (e.g., a VHH or scFv) is linked to a TCR component, e.g., a TCR?, TCR?, TCR?, and/or TCR? variable domain/chain, in a manner that preserves TCR function. In certain embodiments, the engineered TCRs comprise a linker between the antigen-binding domain and the TCR component, such that the function of each targeting molecule (i.e., the TCR component and secondary antigen-binding domain) is preserved. Accordingly, the invention enables simultaneous targeting of intracellular and extracellular antigens.

    [0118] In various embodiments, the engineered/hybrid TCR comprises one or more additional antigen-binding domains. In some embodiments, the engineered/hybrid TCR comprises two or more additional antigen-binding domains. In some embodiments, the two or more additional antigen-binding domains target the same or different antigens.

    [0119] In various embodiments, the one or more antigen-binding domains are selected from the group consisting of: a Camel Ig, a Llama Ig, an Alpaca Ig, Ig NAR, a Fab fragment, a F(ab).sub.2 fragment, a bispecific Fab dimer (Fab2), a trispecific Fab trimer (Fab3), an Fv, an single chain Fv protein (scFv), a bis-scFv, (scFv).sub.2, a minibody, a diabody, a triabody, a tetrabody, a disulfide stabilized Fv protein (dsFv), and a single-domain antibody (sdAb, a camelid VHH, Nanobody). In particular embodiments, the one or more antigen-binding domains comprise one or more single-chain variable fragments (scFv) or single domain antibodies (sdAb, e.g., camelid VHHs).

    [0120] In various embodiments, the linker is a polypeptide linker from about 2 to about 25 amino acids long. In some embodiments, the linker is selected from the group consisting of: GG, GS, SG, SS, GSS, SSG, GSG, SGS, SGG, GGS, GGGS (SEQ ID NO: 53), (GGGGS).sub.1-5 polypeptide (SEQ ID NOs: 35-39), a linker from a marsupial ??TCR (e.g., LEKT; SEQ ID NO: 33), and any combination thereof. In particular embodiments, the linker comprises an amino acid sequence as set forth in any one of SEQ ID NOs: 33-53.

    [0121] In various embodiments, the engineered TCR comprises one or more TCR components comprising one or more TCR variable domains that bind a target polypeptide presented by an MHC complex.

    [0122] In various embodiments, the TCR component of the engineered TCR comprises a TCR constant region. In some embodiments, the TCR constant region is selected from a TCR?, TCR?, TCR?, or TCR? constant region. In some embodiments, the TCR constant domain comprises an amino acid sequence at least 90% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 80-88.

    [0123] In some embodiments, a non-functioning TCR can be used if antibody-based targeting alone is sufficient.

    [0124] Techniques for recombinant (i.e., engineered) DNA, peptide and oligonucleotide synthesis, immunoassays, tissue culture, transformation (e.g., electroporation, lipofection), enzymatic reactions, purification and related techniques and procedures may be generally performed as described in various general and more specific references in microbiology, molecular biology, biochemistry, molecular genetics, cell biology, virology and immunology as cited and discussed throughout the present specification. See, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual, 3d ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Current Protocols in Molecular Biology (John Wiley and Sons, updated July 2008); Short Protocols in Molecular Biology: A Compendium of Methods from Current Protocols in Molecular Biology, Greene Pub. Associates and Wiley-Interscience; Glover, DNA Cloning: A Practical Approach, vol. I & II (IRL Press, Oxford Univ. Press USA, 1985); Current Protocols in Immunology (Edited by: John E. Coligan, Ada M. Kruisbeek, David H. Margulies, Ethan M. Shevach, Warren Strober 2001 John Wiley & Sons, NY, NY); Real-Time PCR: Current Technology and Applications, Edited by Julie Logan, Kirstin Edwards and Nick Saunders, 2009, Caister Academic Press, Norfolk, UK; Anand, Techniques for the Analysis of Complex Genomes, (Academic Press, New York, 1992); Guthrie and Fink, Guide to Yeast Genetics and Molecular Biology (Academic Press, New York, 1991); Oligonucleotide Synthesis (N. Gait, Ed., 1984); Nucleic Acid The Hybridization (B. Hames & S. Higgins, Eds., 1985); Transcription and Translation (B. Hames & S. Higgins, Eds., 1984); Animal Cell Culture (R. Freshney, Ed., 1986); Perbal, A Practical Guide to Molecular Cloning (1984); Next-Generation Genome Sequencing (Janitz, 2008 Wiley-VCH); PCR Protocols (Methods in Molecular Biology) (Park, Ed., 3.sup.rd Edition, 2010 Humana Press); Immobilized Cells And Enzymes (IRL Press, 1986); the treatise, Methods In Enzymology (Academic Press, Inc., N.Y.); Gene Transfer Vectors For Mammalian Cells (J. H. Miller and M. P. Calos eds., 1987, Cold Spring Harbor Laboratory); Harlow and Lane, Antibodies, (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1998); Immunochemical Methods In Cell And Molecular Biology (Mayer and Walker, eds., Academic Press, London, 1987); Handbook Of Experimental Immunology, Volumes I-IV (D. M. Weir and C C Blackwell, eds., 1986); Roitt, Essential Immunology, 6.sup.th Edition, (Blackwell Scientific Publications, Oxford, 1988); Current Protocols in Immunology (Q. E. Coligan, A. M. Kruisbeek, D. H. Margulies, E. M. Shevach and W. Strober, eds., 1991); Annual Review of Immunology; as well as monographs in journals such as Advances in Immunology.

    [0125] Methods and techniques for generating and modifying novel TCRs are also known in the art, see, e.g., Linnemann, C. et al., Nat. Med., 19, 1534-1541 (2013); Scheper, W. et al., Nat. Med., 25, 89-94 (2019); Yossef, R. et al., JCI Insight, 3, 122467 (2018); Hu, Z. et al., Blood, 132, 1911-1921 (2018); Li, Y. et al., Nat. Biotechnol, 23, 349-354 (2005); Wagner, E. K. et al. J. Biol. Chem, 294, 5790-5804 (2019); Guo, X.-Z. J. et al., Mol. Ther. Methods Clin. Dev, 3, 15054 (2016); Azizi, E. et al., Cell, 174, 1293-1308 (2018); Kieke, M. C. et al., Proc. Natl Acad. Sci. USA, 96, 5651-5656 (1999); Smith, S. N. et al, 1319, 95-141 (Springer, 2015); Tsuji, T. et al., Cancer Immunol. Res, 6, 594-604 (2018); and Spindler, M. J., et al., Nat Biotechnol, 38, 609-619 (2020).

    B. Definitions

    [0126] Prior to setting forth this disclosure in more detail, it may be helpful to an understanding thereof to provide definitions of certain terms to be used herein.

    [0127] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by those of ordinary skill in the art to which the invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of particular embodiments, preferred embodiments of compositions, methods and materials are described herein. For the purposes of the present disclosure, the following terms are defined below.

    [0128] The articles a, an, and the are used herein to refer to one or to more than one (i.e., to at least one, or to one or more) of the grammatical object of the article. By way of example, an element means one element or one or more elements.

    [0129] The use of the alternative (e.g., or) should be understood to mean either one, both, or any combination thereof of the alternatives.

    [0130] The term and/or should be understood to mean either one, or both of the alternatives.

    [0131] As used herein, the term about or approximately refers to a quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length that varies by as much as 15%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2% or 1% to a reference quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length. In one embodiment, the term about or approximately refers a range of quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length ?15%, ?10%, ?9%, ?8%, ?7%, ?6%, ?5%, ?4%, ?3%, ?2%, or ?1% about a reference quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length.

    [0132] In one embodiment, a range, e.g., 1 to 5, about 1 to 5, or about 1 to about 5, refers to each numerical value encompassed by the range. For example, in one non-limiting and merely illustrative embodiment, the range 1 to 5 is equivalent to the expression 1, 2, 3, 4, 5; or 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, or 5.0; or 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, or 5.0.

    [0133] As used herein, the term substantially refers to a quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length that is 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher compared to a reference quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length. In one embodiment, substantially the same refers to a quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length that produces an effect, e.g., a physiological effect, that is approximately the same as a reference quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length.

    [0134] Throughout this specification, unless the context requires otherwise, the words comprise, comprises and comprising will be understood to imply the inclusion of a stated step or element or group of steps or elements but not the exclusion of any other step or element or group of steps or elements. By consisting of is meant including, and limited to, whatever follows the phrase consisting of. Thus, the phrase consisting of indicates that the listed elements are required or mandatory, and that no other elements may be present. By consisting essentially of is meant including any elements listed after the phrase, and limited to other elements that do not interfere with or contribute to the activity or action specified in the disclosure for the listed elements. Thus, the phrase consisting essentially of indicates that the listed elements are required or mandatory, but that no other elements are present that materially affect the activity or action of the listed elements.

    [0135] Reference throughout this specification to one embodiment, an embodiment, a particular embodiment, a related embodiment, a certain embodiment, an additional embodiment, or a further embodiment or combinations thereof means that a particular feature, structure or characteristic described in connection with the embodiment is included in at least one embodiment. Thus, the appearances of the foregoing phrases in various places throughout this specification are not necessarily all referring to the same embodiment. Furthermore, the particular features, structures, or characteristics may be combined in any suitable manner in one or more embodiments. It is also understood that the positive recitation of a feature in one embodiment, serves as a basis for excluding the feature in a particular embodiment.

    [0136] As used herein, the term TCR complex refers to a complex formed by the association of CD3 with a TCR. For example, a TCR complex can be composed of a CD3? chain, a CD3? chain, two CD3? chains, a homodimer of CD3? chains, a TCR? chain, and a TCR? chain. In some embodiments, a TCR complex can be composed of a CD37 chain, a CD3? chain, two CD3? chains, a homodimer of CD3? chains, a TCR? chain, and a TCR? chain.

    [0137] A component of a TCR complex, as used herein, refers to a TCR chain (i.e., TCR?, TCR?, TCR? or TCR?), a CD3 chain (i.e., CD3?, CD3?, CD3? or CD3?), or a complex formed by two or more TCR chains or CD3 chains (e.g., a complex of TCR? and TCR?, a complex of TCR? and TCR?, a complex of CD3? and CD3?, a complex of CD3? and CD3?, or a sub-TCR complex of TCR?, TCR?, CD3?, CD3?, and two CD3? chains).

    [0138] As used herein, the terms, binding domain, extracellular domain, antigen binding domain, extracellular binding domain, extracellular antigen binding domain, antigen-specific binding domain, extracellular antigen specific binding domain, binder, and antigen binder are used interchangeably and provide a polypeptide with the ability to specifically bind to the target antigen of interest. The binding domain may be derived either from a natural, synthetic, semi-synthetic, or recombinant source.

    [0139] The term antibody refers to a binding agent that is a polypeptide comprising at least a light chain or heavy chain immunoglobulin variable region or fragment thereof which specifically recognizes and binds one or more epitopes of an antigen, such as a peptide, lipid, polysaccharide, or nucleic acid containing an antigenic determinant, such as those recognized by an immune cell.

    [0140] The term antibody encompasses any naturally-occurring, recombinant, modified or engineered immunoglobulin or immunoglobulin-like structure or antigen-binding fragment or portion thereof, or derivative thereof, as further described elsewhere herein. Thus, the term refers to an immunoglobulin molecule that specifically binds to a target antigen, and includes, for instance, chimeric, humanized, fully human, and bispecific antibodies. An intact antibody will generally comprise at least two full-length heavy chains and two full-length light chains, but in some instances can include fewer chains such as antibodies naturally occurring in camelids which can comprise only heavy chains. Antibodies can be derived solely from a single source, or can be chimeric, that is, different portions of the antibody can be derived from two different antibodies. Antibodies, or antigen-binding portions thereof, can be produced in hybridomas, by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact antibodies.

    [0141] The term antigen binding fragment or antigen binding portion refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen. Antigen binding fragments include, but are not limited to, any naturally occurring, enzymatically obtainable, synthetic, or genetically engineered polypeptide or glycoprotein that specifically binds an antigen to form a complex. In some embodiments, an antigen-binding portion of an antibody may be derived, e.g., from full antibody molecules using any suitable standard techniques such as proteolytic digestion or recombinant genetic engineering techniques involving the manipulation and expression of DNA encoding antibody variable and optionally constant domains.

    [0142] A Single-chain Fv or scFv antibody fragments comprise the VH and VL domains of antibody, wherein these domains are present in a single polypeptide chain and in either orientation (e.g., VL-VH or VH-VL). For example, in some embodiments, the scFv variable light chain is positioned c-terminal to that of the variable heavy chain. In some embodiments, the scFv variable heavy chain is positioned c-terminal to that of the variable light chain. Generally, the scFv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen binding. For a review of scFv, see, e.g., Pluckthun, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., (Springer-Verlag, New York, 1994), pp. 269-315.

    [0143] A VHH, VHH antibody, or VHH domain as used herein refers an antibody fragment that contains the smallest known antigen-binding unit of the variable region of a heavy chain antibody (Koch-Nolte, et al, FASEB J., 21: 3490-3498 (2007)).

    [0144] An isolated antibody or antigen binding fragment thereof refers to an antibody or antigen binding fragment thereof which has been identified and separated and/or recovered from a component of its natural environment.

    [0145] The terms Antigen (Ag), target antigen, and polypeptide antigen are used interchangeably and broadly include any molecules comprising an antigenic determinant within a binding region(s) to which an TCR or antibody or a fragment specifically binds. In particular embodiments, an antigen (Ag) refers to a compound, composition, or substance that can stimulate the production of antibodies or a T cell response in an animal, including compositions (such as one that includes a cancer-specific protein) that are injected or absorbed into an animal. An antigen reacts with the products of specific humoral or cellular immunity, including those induced by heterologous antigens, such as the disclosed antigens.

    [0146] An antigen can be a single-unit molecule (such as a protein monomer or a fragment) or a complex comprised of multiple components. An antigen provides an epitope, e.g., a molecule or a portion of a molecule, or a complex of molecules or portions of molecules, capable of being bound by a selective binding agent, such as an antigen-binding protein (including, e.g., an antibody and/or a TCR). Thus, a selective binding agent may specifically bind to an antigen that is formed by two or more components in a complex. In some embodiments, the antigen is capable of being used in an animal to produce antibodies capable of binding to that antigen. An antigen can possess one or more epitopes that are capable of interacting with different antigen-binding proteins, e.g., antibodies. In preferred TCR-related embodiments, the terms antigen (Ag), target antigen, and polypeptide antigen are collective refer to a naturally processed or synthetically produced portion of an antigenic protein, e.g., a tumor associated antigen (TAA) or tumor specific antigen (TSA), ranging in length from about 7 amino acids to about 15 amino acids, which can form a complex with a MHC (e.g., HLA) molecule forming a target antigen:MHC (e.g., HLA) complex.

    [0147] A target antigen or target antigen of interest refers to a molecule expressed on the cell surface of a target cell that a binding domain contemplated herein, is designed to bind. In particular embodiments, the target antigen is an epitope of a polypeptide expressed on the surface of a cancer cell. An epitope or antigenic determinant refers to the region of an antigen to which a binding agent binds. Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents. An epitope typically includes at least 3, and more usually, at least 5, about 9, or about 8-10 amino acids in a unique spatial conformation.

    [0148] The terms selectively binds or selectively bound or selectively binding or selectively targets, specific binding affinity or specifically binds or specifically bound or specific binding or specifically targets as used herein, describes preferential binding of one molecule to a target molecule (on-target binding) in the presence of a plurality of off-target molecules. In particular embodiments, the terms refer to binding of a TCR, antibody, or antigen binding fragment thereof to an antigen at greater binding affinity than background binding. A binding domain specifically binds to an antigen if it binds to or associates with the antigen With an affinity or K.sub.a (i.e., an equilibrium association constant of a particular binding interaction with units of 1/M) of, for example, greater than or equal to about 105 M.sup.?1. In certain embodiments, a binding domain (or a fusion protein thereof) binds to a target with a Ka greater than or equal to about 10.sup.6 M.sup.?1, 10.sup.7 M.sup.?1, 10.sup.8 M.sup.?1, 10.sup.9 M.sup.?1, 10.sup.10 M.sup.?1, 10.sup.11 M.sup.1, 10.sup.12 M.sup.?1, or 10.sup.13 M.sup.?1. High affinity binding domains (or single chain fusion proteins thereof) refers to those binding domains with a K.sub.a of at least 10.sup.7 M.sup.?1, at least 10.sup.8 M.sup.?1, at least 10.sup.9 M.sup.?1, at least 10.sup.10 M.sup.?1, at least 10.sup.11 M.sup.?1, at least 10.sup.12 M.sup.?1, at least 10.sup.3 M.sup.?1, or greater.

    [0149] Alternatively, affinity may be defined as an equilibrium dissociation constant (K.sub.d) of a particular binding interaction with units of M (e.g., 10.sup.?5 M to 10.sup.?13 M, or less). Affinities of binding domain polypeptides and CAR proteins according to the present disclosure can be readily determined using conventional techniques, e.g., by competitive ELISA (enzyme-linked immunosorbent assay), or by binding association, or displacement assays using labeled ligands, or using a surface-plasmon resonance device such as the Biacore T100, which is available from Biacore, Inc., Piscataway, NJ, or optical biosensor technology such as the EPIC system or EnSpire that are available from Corning and Perkin Elmer respectively (see also, e.g., Scatchard et al. (1949) Ann. N.Y. Acad. Sci. 51:660; and U.S. Pat. Nos. 5,283,173; 5,468,614, or the equivalent).

    [0150] In one embodiment, the affinity of specific binding is about 2 times greater than background binding, about 5 times greater than background binding, about 10 times greater than background binding, about 20 times greater than background binding, about 50 times greater than background binding, about 100 times greater than background binding, or about 1000 times greater than background binding or more.

    [0151] In particular embodiments, the engineered/hybrid TCR comprises an antibody or antigen binding fragment thereof. In the context of an engineered TCR, an antibody refers to a binding agent that is a polypeptide comprising at least a light chain or heavy chain immunoglobulin variable region which specifically recognizes and binds an epitope of an antigen, such as a peptide, lipid, polysaccharide, or nucleic acid containing an antigenic determinant, such as those recognized by an immune cell.

    [0152] As would be understood by the skilled person and as described elsewhere herein, a complete antibody comprises two heavy chains and two light chains. Each heavy chain consists of a variable region and a first, second, and third constant region, while each light chain consists of a variable region and a constant region.

    [0153] Light and heavy chain variable regions contain a framework region interrupted by three hypervariable regions, also called complementarity-determining regions or CDRs. The CDRs can be defined or identified by conventional methods, such as by sequence according to Kabat et al (Wu, TT and Kabat, E. A., J Exp Med. 132(2):211-50, (1970); Borden, P. and Kabat E. A., PNAS, 84: 2440-2443 (1987); (see, Kabat et al., Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 1991, which is hereby incorporated by reference), or by structure according to Chothia et al (Chothia, C. and Lesk, A. M., J Mol. Biol., 196(4): 901-917 (1987), Chothia, C. et al, Nature, 342: 877-883 (1989)).

    [0154] Other boundaries defining CDRs overlapping with the Kabat CDRs have been described by Padlan (1995) FASEB J. 9: 133-139 and MacCallum (1996) J. Mol. Biol. 262(5): 732-45. Still other CDR boundary definitions may not strictly follow one of the herein systems, but will nonetheless overlap with the Kabat CDRs, although they may be shortened or lengthened in light of prediction or experimental findings that particular residues or groups of residues or even entire CDRs do not significantly impact antigen-binding. For example, the CDRs of an antibody can be determined according to the AbM numbering scheme, which refers to AbM hypervariable regions, which represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software (Oxford Molecular Group, Inc.).

    [0155] Additionally, the CDRs of an antibody can be determined according to the IMGT numbering system as described in Lefranc M-P, (1999) The Immunologist 7: 132-136 and Lefranc M-P et al., (1999) Nucleic Acids Res 27: 209-212.

    [0156] Still other methods of CDR determination are disclosed in MacCallum R M et al., (1996) J Mol Biol 262: 732-745. See also, e.g., Martin A. Protein Sequence and Structure Analysis of Antibody Variable Domains, in Antibody Engineering, Kontermann and Dubel, eds., Chapter 31, pp. 422-439, Springer-Verlag, Berlin (2001). Proprietary and publicly available programs are known to those skilled in the art which can be used to determine CDRs base on any of the CDR definitions described herein, for example, abYsis (abysis.org/abysis/) and IMGT/V-QUEST (imgt.org/IMGT_vquest).

    [0157] Illustrative examples of rules for predicting light chain CDRs include: CDRL1 starts at about residue 24, is preceded by a Cys, is about 10-17 residues, and is followed by a Trp (typically Trp-Tyr-Gln, but also, Trp-Leu-Gln, Trp-Phe-Gln, Trp-Tyr-Leu); CDRL2 starts about 16 residues after the end of CDRL1, is generally preceded by Ile-Tyr, but also, Val-Tyr, Ile-Lys, Ile-Phe, and is 7 residues; and CDRL3 starts about 33 residues after the end of CDRL2, is preceded by a Cys, is 7-11 residues, and is followed by Phe-Gly-XXX-Gly (XXX is any amino acid).

    [0158] Illustrative examples of rules for predicting heavy chain CDRs include: CDRH1 starts at about residue 26, is preceded by Cys-XXX-XXX-XXX, is 10-12 residues and is followed by a Trp (typically Trp-Val, but also, Trp-Ile, Trp-Ala); CDRH2 starts about 15 residues after the end of CDRH1, is generally preceded by Leu-Glu-Trp-Ile-Gly (SEQ ID NO: 138), or a number of variations, is 16-19 residues, and is followed by Lys/Arg-Leu/Ile/Val/Phe/Thr/Ala-Thr/Ser/Ile/Ala, AbM definition ends 7 residues earlier; and CDRH3 starts about 33 residues after the end of CDRH2, is preceded by Cys-XXX-XXX (typically Cys-Ala-Arg), is 3 to 25 residues, and is followed by Trp-Gly-XXX-Gly.

    [0159] References to V.sub.H or VH refer to the variable region of an immunoglobulin heavy chain, including that of an antibody, Fv, scFv, dsFv, Fab, or other antibody fragment as disclosed herein. References to V.sub.L or VL refer to the variable region of an immunoglobulin light chain, including that of an antibody, Fv, scFv, dsFv, Fab, or other antibody fragment as disclosed herein.

    [0160] Additional definitions are set forth throughout this disclosure.

    C. Engineered T Cell Receptors

    [0161] T cell receptors (TCRs) recognize a peptide fragment of a target antigen when it is presented by a major histocompatibility complex (MHC) molecule. There are two different classes of MHC molecules, MHC I and MHC II, that deliver peptides from different cellular compartments to the cell surface. Engagement of the TCR with antigen and MHC results in immune effector cell activation through a series of biochemical events mediated by associated enzymes, co-receptors, and specialized accessory molecules.

    [0162] A TCR contemplated herein is a heterodimeric complex comprising a TCR alpha (TCR?) polypeptide/chain and a TCR beta (TCR?) polypeptide/chain; or a TCR gamma (TCR?) polypeptide/chain and a TCR delta (TCR?) polypeptide/chain.

    [0163] The human TCR? locus is located on chromosome 14 (14q11.2). The mature TCR? chain comprises a variable domain derived from recombination of a variable (V) segment and a joining (J) segment, and a constant (C) domain. The term variable TCR? region or TCR? variable region or variable TCR? chain or TCR? variable chain or variable TCR? domain or TCR? variable domain refers to the variable region of a TCR? chain.

    [0164] The human TCR? locus is located on chromosome 7 (7q34). The mature TCR? chain comprises a variable domain derived from recombination of a variable (V) segment, a diversity (D) segment, and a joining (J) segment, and one of two constant (C) domains. The term variable TCR? region or TCR? variable region or variable TCR? chain or TCR? variable chain or variable TCR? domain or TCR? variable domain refers to the variable region of a TCR? chain.

    [0165] The human TCR? locus is located on chromosome 7 (7p14.1). The mature TCR? chain comprises a variable domain derived from recombination of a variable (V) segment and a joining (J) segment, and a constant (C) domain. The term variable TCR? region or TCR? variable region or variable TCR? chain or TCR? variable chain or variable TCR? domain or TCR? variable domain refers to the variable region of a TCR? chain.

    [0166] The human TCR? locus is located on chromosome 14 (14q11.2). The mature TCR? chain comprises a variable domain derived from recombination of a variable (V) segment, a diversity (D) segment, and a joining (J) segment, and one of two constant (C) domains. The term variable TCR? region or TCR? variable region or variable TCR? chain or TCR? variable chain or variable TCR? domain or TCR? variable domain refers to the variable region of a TCR? chain.

    [0167] The rearranged V(D)J regions of both the TCR?, TCR?, TCR?, and TCR? chains each contain three hypervariable regions known as complementarity determining regions (CDRs). CDR3 is the main CDR responsible for recognizing processed antigen, although CDR1 of the alpha chain has also been shown to interact with the N-terminal part of the antigenic peptide, whereas CDR1 of the beta chain interacts with the C-terminal part of the peptide. CDR2 is thought to recognize the MHC molecule. Framework regions (FRs) are positioned between the CDRs. These regions provide the structure of the TCR variable region.

    [0168] The constant domain or constant region of the TCR chain also contributes to TCR structure and consists of an extracellular domain, a transmembrane domain and a short cytoplasmic domain. The TCR structure allows the formation of a TCR complex that includes the TCR? or TCR? chain, the TCR? or TCR? chain, and accessory molecules CD3?, CD3?, CD3?, and CD3?. The signal from the T cell complex is enhanced by simultaneous binding of the MHC molecules by a specific co-receptor. CD4 is the co-receptor for MHC II molecules expressed on helper T cells and CD8 is the co-receptor for MHC I molecules expressed on cytotoxic T cells. The co-receptor not only ensures the specificity of the TCR for an antigen, but also allows prolonged engagement between the antigen presenting cell and the T cell and recruits essential molecules (e.g., LCK) inside the cell involved in the signaling of the activated T lymphocyte.

    [0169] Engineered TCRs contemplated herein can be used to redirect immune effector cells to target cells. Additionally, the TCRs contemplated herein are engineered to comprise a functional antigen binding domain. In particular embodiments, the engineered TCR comprises both functional TCR binding domains (e.g., functional TCR variable regions) and one or more separate antigen-binding domains linked to one or both of the TCR polypeptides/chains. Accordingly, in some embodiments, the engineered TCR variable domains and the additional antigen binding domains can bind the same antigen or two different antigens, or more. In some embodiments, the engineered TCR can bind both an intracellular antigen presented on MHC molecules and a second antigen (e.g., receptor, ligand, or cancer antigen). In some embodiments, the engineered TCR can bind three different antigens.

    [0170] The TCRs contemplated herein are sometimes referred to as engineered TCRs, hybrid TCRs, dual targeting TCRs, multi-targeting TCRs, or ATOMICs (Antibody Tethered Orthogonal Multiplexing Compatible) and comprise one or more antigen-binding domain components (A component) and one or more TCR components (C component), with or without one or more linkers (B component), each of which are described in more detail in the subsections below.

    [0171] The data in the Examples demonstrate that the engineered TCRs and fusion proteins disclosed herein may comprise an antigen-binding domain (A component) and/or TCR component (C component) specific for any antigen(s). One of ordinary skill in the art would readily understand that an antigen-binding domain component and TCR component, irrespective of the antigen specificity or any specific sequence, e.g., of its variable domain or CDR sequences, may be linked to produce an engineered TCR or fusion protein meeting the characteristics of the engineered TCRs disclosed herein.

    [0172] This is because the inventors have unexpectedly discovered that the disclosed engineered TCRs and fusion proteins, which comprise an antigen-binding domain (A component) linked to one or more TCR binding domains (C component), have an efficient and effective architecture that enables concurrent TCR targeting and secondary antigen-binder targeting, in a manner that preserves the function of both components. The antigen specificity of the component, as well as the sequences of the component, e.g., variable domain or CDR sequences, can be varied by one of ordinary skill in the art using the illustrative general engineered TCR formulas provided herein. Therefore, although the present disclosure and Examples provide a plethora of engineered TCRs and fusion proteins comprising (i) antigen-binding domain components and TCR components to different antigens, as well as (ii) different antigen-binding domains directed to the same antigen, one of ordinary skill in the art would understand that the engineered TCRs and fusion proteins disclosed and claimed herein should not be limited by antigen-specificity or by sequence, e.g., variable region sequences or CDR sequences.

    1. Antigen-Binding Domain Component (A Component)

    [0173] Provided herein are engineered TCRs, and related fusion polypeptides, comprising (a) a TCR? or TCR? polypeptide comprising a TCR? or TCR? variable domain; (b) a TCR? or TCR? polypeptide comprising a TCR? or TCR? variable domain; and (c) one or more antigen-binding domains (A components) linked to the TCR?, TCR?, TCR? and/or TCR? variable domains.

    [0174] In various embodiments, the one or more antigen-binding domains (also referred to herein as binders or antigen-binders) comprises one or more, two or more, or three or more antigen-binding domains. In some embodiments, the one or more antigen-binding domains comprises one or more first antigen-binding domains linked to any one or more of the TCR?, TCR?, TCR?, and/or TCR? variable domains. In some embodiments, the one or more antigen-binding domains comprises a first antigen-binding domain linked to the TCR? variable domain. In some embodiments, the one or more antigen-binding domains comprises a first antigen-binding domain linked to the TCR? variable domain. In some embodiments, the one or more antigen-binding domains comprises a first antigen-binding domain linked to the TCR? variable domain. In some embodiments, the one or more antigen-binding domains comprises a first antigen-binding domain linked to the TCR? variable domain. In some embodiments, the one or more antigen-binding domains comprise: (i) a first antigen-binding domain linked to the TCR? variable domain, and (ii) a first antigen-binding domain linked to the TCR? variable domain. In some embodiments, the one or more antigen-binding domains comprise: (i) a first antigen-binding domain linked to the TCR? variable domain, and (ii) a first antigen-binding domain linked to the TCR? variable domain. In some embodiments, the first antigen-binding domains are the same or different, and/or bind to the same or different target antigens.

    [0175] In various embodiments, the first antigen-binding domains are linked to the N-terminus of the variable domains.

    [0176] In various embodiments, the one or more antigen-binding domains comprises a second antigen-binding domain linked to the first antigen-binding domain. In some embodiments, the second antigen-binding domain is N-terminal of the first antigen-binding domain. In some embodiments, the one or more antigen-binding domains comprises a second antigen-binding domain linked to the first antigen-binding domain which is linked to the TCR? variable domain. In some embodiments, the one or more antigen-binding domains comprises a second antigen-binding domain linked to the first antigen-binding domain which is linked to the TCR? variable domain. In some embodiments, the one or more antigen-binding domains comprises a second antigen-binding domain linked to the first antigen-binding domain which is linked to the TCR? variable domain. In some embodiments, the one or more antigen-binding domains comprises a second antigen-binding domain linked to the first antigen-binding domain which is linked to the TCR? variable domain.

    [0177] In various embodiments, the one or more antigen-binding domains comprises: (i) a second antigen-binding domain linked to the first antigen-binding domain linked to the TCR? variable domain, and (ii) a second antigen-binding domain linked to the first antigen-binding domain linked to the TCR? variable domain.

    [0178] In various embodiments, the one or more antigen-binding domains comprises: (i) a second antigen-binding domain linked to the first antigen-binding domain linked to the TCR? variable domain, and (ii) a second antigen-binding domain linked to the first antigen-binding domain linked to the TCR? variable domain.

    [0179] In various embodiments, the second antigen-binding domains are the same or different, and/or bind to the same or different target antigens. In some embodiments, the second antigen-binding domains are the same. In some embodiments, the second antigen-binding domains are different.

    [0180] In various embodiments, the one or more antigen-binding domains (e.g., the first and/or second antigen-binding domains) bind a target antigen selected from the group consisting of: alpha folate receptor (FR?), ?.sub.v?.sub.6 integrin, ADGRE2, BACE2, B cell maturation antigen (BCMA), B7-H3 (CD276), B7-H4, B7-H6, CA19.9, carbonic anhydrase IX (CAIX), CCR1, CD7, CD16, CD19, CD20, CD22, CD30, CD33, CD37, CD38, CD44, CD44v6, CD44v7/8, CD70, CD79a, CD79b, CD123, CD133, CD138, CD171, CD244, carcinoembryonic antigen (CEA), C-type lectin-like molecule-1 (CLL-1), CD2 subset 1 (CS-1), CLDN6, cMET, chondroitin sulfate proteoglycan 4 (CSPG4), CLDN18.2, cutaneous T cell lymphoma-associated antigen 1 (CTAGE1), DLL3, epidermal growth factor receptor (EGFR), epidermal growth factor receptor variant III (EGFRvIII), EGFR806, epithelial glycoprotein 2 (EGP2), epithelial glycoprotein 40 (EGP40), EPHB2, ERBB4, epithelial cell adhesion molecule (EPCAM), ephrin type-A receptor 2 (EPHA2), fibroblast activation protein (FAP), Fc Receptor Like 5 (FCRL5), fetal acetylcholinesterase receptor (AchR), FLT3, FN, FN-EDB, FRBeta, ganglioside G2 (GD2), ganglioside G3 (GD3), Glypican-3 (GPC3), EGFR family including ErbB2 (HER2), HER2p95, EGFRv3, IL-10R?, IL-13R?2, Kappa, cancer/testis antigen 2 (LAGE-1A), K-Ras, K-Ras G12C, K-Ras G12D, K-Ras G12V, Lambda, Lewis-Y (LeY), L1 cell adhesion molecule (L1-CAM), LILRB2, LY6G6GD, melanoma antigen recognized by T cells 1 (MelanA or MART1), Mesothelin (MSLN), MMP10, MUC1, MUC16, MHC class I chain related proteins A (MICA), MHC class I chain related proteins B (MICB), neural cell adhesion molecule (NCAM), prostate stem cell antigen (PSCA), prostate-specific membrane antigen (PSMA), receptor tyrosine kinase-like orphan receptor 1 (ROR1), synovial sarcoma, X breakpoint 2 (SSX2), Survivin, tumor associated glycoprotein 72 (TAG72), transmembrane activator and CAML interactor (TACI), tumor endothelial marker 1 (TEM1/CD248), tumor endothelial marker 7-related (TEM7R), TIM3, trophoblast glycoprotein (TPBG), UL16-binding protein (ULBP) 1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, and vascular endothelial growth factor receptor 2 (VEGFR2).

    [0181] In various embodiments, the one or more antigen-binding domains (e.g., the first and/or second antigen-binding domains) bind a target polypeptide derived from a protein selected from the group consisting of: ?-fetoprotein (AFP), ASCL2, B Melanoma Antigen (BAGE) family members, Brother of the regulator of imprinted sites (BORIS), Cancer-testis antigens, Cancer-testis antigen 83 (CT-83), Carbonic anhydrase IX (CAIX), Carcinoembryonic antigen (CEA), Cytomegalovirus (CMV) antigens, Cytotoxic T cell (CTL)-recognized antigen on melanoma (CAMEL), Epstein-Barr virus (EBV) antigens, EPHB2, G antigen 1 (GAGE-1), GAGE-2, GAGE-3, GAGE-4, GAGE-5, GAGE-6, GAGE-7B, GAGE-8, Glycoprotein 100 (GP100), Hepatitis B virus (HBV) antigens, Hepatitis C virus (HCV) non-structure protein 3 (NS3), Human papillomavirus (HPV)-E6, HPV-E7, Human telomerase reverse transcriptase (hTERT), IGF2BP3/A3, IGF2BP1, K-Ras, K-Ras G12C, K-Ras G12D, K-Ras G12V, Latent membrane protein 2 (LMP2), LY6G6D, Melanoma antigen family A, 1 (MAGE-A1), MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A6, MAGE-A10, MAGE-A12, Melanoma antigen recognized by T cells (MART-1), Mesothelin (MSLN), Mucin 1 (MUC1), Mucin 16 (MUC16), New York esophageal squamous cell carcinoma-1 (NYESO-1), P53, P antigen (PAGE) family members, PAP, PIK3CA, PIK3CA H1047R, Placenta-specific 1 (PLAC1), Preferentially expressed antigen in melanoma (PRAME), Prostate specific antigen PSA, Survivin, Synovial sarcoma X 1 (SSX1), Synovial sarcoma X 2 (SSX2), Synovial sarcoma X 3 (SSX3), Synovial sarcoma X 4 (SSX4), Synovial sarcoma X 5 (SSX5), Synovial sarcoma X 8 (SSX8), Thyroglobulin, TP53 R175H, Tyrosinase, Tyrosinase related protein (TRP)1, TRP2, UBD, Wilms tumor protein (WT-1), Wnt10A, X Antigen Family Member 1 (XAGE1), and X Antigen Family Member 2 (XAGE2).

    [0182] In various embodiments, the one or more antigen-binding domains bind CD33, CLL1, CD19, CD20, CD22, CD79A, CD79B, or BCMA. In some embodiments, the one or more antigen-binding domains bind CD19, CD20, CD22, CD33, CD79A, CD79B, B7H3, Muc16, Her2, EGFR, FN-EDB, CLDN18.2, DLL3, FLT3, CLL1, CD123, or BCMA.

    [0183] In various embodiments, the one or more antigen-binding domains comprises an amino acid sequence at least 85% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 1-32. In various embodiments, the one or more antigen-binding domains comprises an amino acid sequence at least 90% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 1-32. In various embodiments, the one or more antigen-binding domains comprises an amino acid sequence at least 95% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 1-32. In some embodiments, the one or more antigen-binding domains comprises an amino acid sequence at least 96% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 1-32. In some embodiments, the one or more antigen-binding domains comprises an amino acid sequence at least 97% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 1-32. In some embodiments, the one or more antigen-binding domains comprises an amino acid sequence at least 98% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 1-32. In some embodiments, the one or more antigen-binding domains comprises an amino acid sequence at least 99% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 1-32. In some embodiments, the one or more antigen-binding domains comprises an amino acid sequence as set forth in any one of SEQ ID NOs: 1-32.

    [0184] In various embodiments, the one or more antigen-binding domains comprise an antibody or antigen binding fragment thereof selected from the group consisting of: a Camel Ig, a Llama Ig, an Alpaca Ig, Ig NAR, a Fab fragment, a F(ab)2 fragment, a bispecific Fab dimer (Fab2), a trispecific Fab trimer (Fab3), an Fv, an single chain Fv protein (scFv), a bis-scFv, (scFv)2, a minibody, a diabody, a triabody, a tetrabody, a disulfide stabilized Fv protein (dsFv), and a single-domain antibody (sdAb, a camelid VHH, Nanobody).

    [0185] In various embodiments, the one or more antigen-binding domains comprise one or more single-chain variable fragments (scFv).

    [0186] In various embodiments, the one or more antigen-binding domains comprise one or more single domain antibodies (sdAb). In some embodiments, the sdAb is a camelid VHH, nanobody, or heavy chain-only antibody (HcAb). In particular embodiments, the sdAb is a camelid VHH.

    [0187] In various embodiments, the antibody or antigen binding fragment thereof is human or humanized.

    [0188] Numerous methods may be used for obtaining antibodies, or antigen-binding fragments thereof. For example, antibodies can be produced using recombinant DNA methods. Monoclonal antibodies may also be produced by generation of hybridomas (see e.g., Kohler and Milstein (1975) Nature, 256: 495-499) in accordance with known methods. Hybridomas formed in this manner are then screened using standard methods, such as enzyme-linked immunosorbent assay (ELISA) and surface plasmon resonance (e.g., OCTET or BIACORE) analysis, to identify one or more hybridomas that produce an antibody that specifically binds to a specified antigen. Any form of the specified antigen may be used as the immunogen, e.g., recombinant antigen, naturally occurring forms, any variants or fragments thereof, as well as antigenic peptide thereof (e.g., any of the epitopes described herein as a linear epitope or within a scaffold as a conformational epitope). One exemplary method of making antibodies includes screening protein expression libraries that express antibodies or fragments thereof (e.g., scFv), e.g., phage or ribosome display libraries. Phage display is described, for example, in Ladner et al., U.S. Pat. No. 5,223,409; Smith (1985) Science 228:1315-1317; Clackson et al. (1991) Nature, 352: 624-628; Marks et al. (1991) J. Mol. Biol., 222: 581-597; WO 92/18619; WO 91/17271; WO92/20791; WO92/15679; WO93/01288; WO92/01047; WO92/09690; and WO90/02809.

    [0189] In some embodiments, a monoclonal antibody is obtained from the non-human animal, and then modified, e.g., chimeric, using suitable recombinant DNA techniques. A variety of approaches for making chimeric antibodies have been described. See e.g., Morrison et al., Proc. Natl. Acad. Sci. U.S.A. 81:6851, 1985; Takeda et al., Nature 314:452, 1985; Cabilly et al., U.S. Pat. No. 4,816,567; Boss et al., U.S. Pat. No. 4,816,397; Tanaguchi et al., European Patent Publication EP171496; European Patent Publication 0173494; and United Kingdom Patent GB 2177096B.

    [0190] For additional antibody production techniques, see Antibodies: A Laboratory Manual, eds. Harlow et al., Cold Spring Harbor Laboratory, 1988. The present disclosure is not necessarily limited to any particular source, method of production, or other special characteristics of an antibody.

    [0191] In various embodiments, the one or more antigen-binding domains comprise a ligand.

    2. Linkers (B Component)

    [0192] As contemplated herein, the engineered TCRs may or may not comprise linker residues (B component) between the various domains, e.g., added for appropriate spacing and conformation of the molecule. Particularly, the engineered TCRs comprise a linker between the one or more antigen-binding domains and the TCR component, e.g., TCR variable domain. In various embodiments, the one or more antigen-binding domains are linked to the TCR component, e.g., TCR variable domains, by one or more polypeptide linkers. In some embodiments, the TCR comprises two or more linkers between the antigen-binding domain and the TCR variable domain. In some embodiments, the engineered TCR does not comprise a polypeptide linker (B component) between the antigen-binding domain and the TCR component.

    [0193] A linker or polypeptide linker or linker polypeptide is an amino acid sequence that connects adjacent domains of a polypeptide or fusion polypeptide. Illustrative examples of linkers include glycine polymers (G).sub.n; glycine-serine polymers (G.sub.1-5S.sub.15).sub.n, where n is an integer of at least one, two, three, four, or five; glycine-alanine polymers; alanine-serine polymers; and other flexible linkers known in the art. Glycine accesses significantly more phi-psi space than even alanine, and is much less restricted than residues with longer side chains (see Scheraga, Rev. Computational Chem. 11173-142 (1992)). A linker may be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more amino acids long.

    [0194] In particular embodiments, the engineered TCRs and/or antigen-binding domains comprise one, two, three, four, or five or more linkers. The linker may be between the TCR variable domain and the antigen-binding domain, between two or more antigen binding domains, or between VH and VL sequences within an antigen binding domain (e.g., scFv). In particular embodiments, the length of a linker is about 2 to about 25 amino acids, about 5 to about 20 amino acids, or about 10 to about 20 amino acids, or any intervening length of amino acids. In some embodiments, the linker is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more amino acids long.

    [0195] In various embodiments, the one or more polypeptide linkers comprise a linker from about 2 to about 25 amino acids long. In some embodiments, the one or more polypeptide linkers comprise a linker from about 3 to about 20 amino acids long. In some embodiments, the one or more polypeptide linkers comprise a linker from about 4 to about 15 amino acids long. In some embodiments, the one or more polypeptide linkers comprise a linker from about 4 to about 10 amino acids long. In some embodiments, the one or more polypeptide linkers comprise a linker of about 4 amino acids long. In some embodiments, the one or more polypeptide linkers comprise a linker of about 5 amino acids long. In some embodiments, the one or more polypeptide linkers comprise a linker of about 6 amino acids long. In some embodiments, the one or more polypeptide linkers comprise a linker of about 7 amino acids long. In some embodiments, the one or more polypeptide linkers comprise a linker of about 8 amino acids long. In some embodiments, the one or more polypeptide linkers comprise a linker of about 9 amino acids long. In some embodiments, the one or more polypeptide linkers comprise a linker of about amino acids long. In some embodiments, the one or more polypeptide linkers comprise a linker of about 11 amino acids long. In some embodiments, the one or more polypeptide linkers comprise a linker of about 12 amino acids long. In some embodiments, the one or more polypeptide linkers comprise a linker of about 13 amino acids long. In some embodiments, the one or more polypeptide linkers comprise a linker of about 14 amino acids long. In some embodiments, the one or more polypeptide linkers comprise a linker of about 15 amino acids long.

    [0196] Illustrative examples of linkers include glycine polymers (G).sub.n; glycine-serine polymers (G.sub.1-5S.sub.1-5).sub.n, where n is an integer of at least one, two, three, four, or five; glycine-alanine polymers; alanine-serine polymers; and other flexible linkers are known in the art. Glycine and glycine-serine polymers are relatively unstructured, and therefore may be able to serve as a neutral tether between domains of fusion proteins such as the engineered/hybrid TCRs described herein. Glycine accesses significantly more phi-psi space than even alanine, and is much less restricted than residues with longer side chains (see Scheraga, Rev. Computational Chem. 11173-142 (1992)). The ordinarily skilled artisan will recognize that design of an engineered/hybrid TCR in particular embodiments can include linkers that are all or partially flexible, such that the linker can include a flexible linker as well as one or more portions that confer less flexible structure to provide for a desired TCR/hybrid structure.

    [0197] Other illustrative linkers include, but are not limited to the following amino acid sequences: DGGGS (SEQ ID NO: 40); TGEKP (SEQ ID NO: 41) (see, e.g., Liu et al., PNAS 5525-5530 (1997)); GGRR (SEQ ID NO: 42) (Pomerantz et al. 1995, supra); (GGGGS).sub.n where n=1, 2, 3, 4 or 5 (SEQ ID NOs: 35-39) (Kim et al., PNAS 93, 1156-1160 (1996.); EGKSSGSGSESKVD (SEQ ID NO: 43) (Chaudhary et al., 1990, Proc. Natl. Acad. Sci. U.S.A. 87:1066-1070); KESGSVSSEQLAQFRSLD (SEQ ID NO: 44) (Bird et al., 1988, Science 242:423-426), GGRRGGGS (SEQ ID NO: 45); LRQRDGERP (SEQ ID NO: 46); LRQKDGGGSERP (SEQ ID NO: 47); LRQKD(GGGS).sub.2 ERP (SEQ ID NO: 48). Alternatively, flexible linkers can be rationally designed using a computer program capable of modeling both DNA-binding sites and the peptides themselves (Desjarlais & Berg, PNAS 90:2256-2260 (1993), PNAS 91:11099-11103 (1994) or by phage display methods. In particular embodiments, a linker comprises the amino acid sequence: GSTSGSGKPGSGEGSTKG (SEQ ID NO: 49) or GSTSGSGKSSEGSGSTKG (SEQ ID NO: 50) (Cooper et al., Blood, 101(4): 1637-1644 (2003) and Whitlow et al., Protein Eng., 6(8): 989-95 (1993)). Other linkers include GSTSGSGKSSEGKG (SEQ ID NO: 51), GSTSGSGKPGSGEGS (SEQ ID NO: 52), or GGGS (SEQ ID NO: 53).

    [0198] In various embodiments, the one or more polypeptide linkers comprise a linker selected from the group consisting of: GG, GS, SG, SS, GSS, SSG, GSG, SGS, SGG, GGS, GGGS (SEQ ID NO: 53), (GGGGS).sub.1-5 polypeptide (SEQ ID NOs: 35-39), a linker from a marsupial YTCR (e.g., LEKT; SEQ ID NO: 33), and any combination thereof.

    [0199] In various embodiments, the one or more polypeptide linkers comprise a linker from a marsupial ??TCR. In particular embodiments, the marsupial ??TCR linker is a ?LNK comprising an amino acid sequence as set forth in SEQ ID NO: 33. In various embodiments, the one or more polypeptide linkers comprise a marsupial ??TCR linker and a G4S linker as set forth in SEQ ID NO: 34.

    [0200] In various embodiments, the one or more polypeptide linkers comprise a GGGGS (SEQ ID NO: 35) linker (G4S). In various embodiments, the one or more polypeptide linkers comprise two GGGGS linkers (2?G4S) (SEQ ID NO: 36). In various embodiments, the one or more polypeptide linkers comprise three GGGGS linkers (3?G4S) (SEQ ID NO: 37). In various embodiments, the one or more polypeptide linkers comprise four GGGGS linkers (4?G4S) (SEQ ID NO: 38). In various embodiments, the one or more polypeptide linkers comprise five GGGGS linkers (5?G4S) (SEQ ID NO: 39).

    [0201] In various embodiments, the one or more polypeptide linkers comprise an amino acid sequence as set forth in any one of SEQ ID NOs: 33-53.

    [0202] In particular embodiments, the first and second antigen-binding domains are separated by a second polypeptide linker. In some embodiments, the second polypeptide linker comprises a linker from about 2 to about 25 amino acids long. In some embodiments, the second polypeptide linker comprises a linker from about 3 to about 20 amino acids long. In some embodiments, the second polypeptide linker comprises a linker from about 4 to about 15 amino acids long. In some embodiments, the second polypeptide linker comprises a linker from about 4 to about 10 amino acids long. In some embodiments, the second polypeptide linker comprises a linker of about 4 amino acids long. In some embodiments, the second polypeptide linker comprises a linker of about 5 amino acids long. In some embodiments, the second polypeptide linker comprises a linker of about 6 amino acids long. In some embodiments, the second polypeptide linker comprises a linker of about 7 amino acids long. In some embodiments, the second polypeptide linker comprises a linker of about 8 amino acids long. In some embodiments, the second polypeptide linker comprises a linker of about 9 amino acids long. In some embodiments, the second polypeptide linker comprises a linker of about 10 amino acids long. In some embodiments, the second polypeptide linker comprises a linker of about 11 amino acids long. In some embodiments, the second polypeptide linker comprises a linker of about 12 amino acids long. In some embodiments, the second polypeptide linker comprises a linker of about 13 amino acids long. In some embodiments, the second polypeptide linker comprises a linker of about 14 amino acids long. In some embodiments, the second polypeptide linker comprises a linker of about 15 amino acids long.

    [0203] In various embodiments, the second polypeptide linker comprises a linker selected from the group consisting of: GG, GS, SG, SS, GSS, SSG, GSG, SGS, SGG, GGS, GGGS (SEQ ID NO: 53), (GGGGS).sub.1-5 polypeptide (SEQ ID NOs: 35-39), and any combination thereof. In some embodiments, the second polypeptide linker comprises a GGGGS (SEQ ID NO: 35) linker (G4S). In some embodiments, the one or more polypeptide linkers comprise two GGGGS linkers (2?G4S) (SEQ ID NO: 36). In some embodiments, the second polypeptide linker comprises three GGGGS linkers (3?G4S) (SEQ ID NO: 37). In some embodiments, the second polypeptide linker comprises four GGGGS linkers (4?G4S) (SEQ ID NO: 38). In some embodiments, the second polypeptide linker comprises five GGGGS linkers (5?G4S) (SEQ ID NO: 39).

    [0204] In various embodiments, the second polypeptide linker comprises an amino acid sequence as set forth in any one of SEQ ID NOs: 33-53, or combination thereof.

    3. T Cell Receptor Component (C Component)

    [0205] The engineered T cell receptors (TCRs) contemplated herein bind a polypeptide antigen presented by a major histocompatibility complex (MHC) class I or MHC class II molecule, preferentially a polypeptide antigen presented by an MHC class I molecule.

    [0206] Major histocompatibility complex (MHC) refers to glycoproteins that deliver peptide antigens to a cell surface. MHC class I molecules are heterodimers having a membrane spanning ? chain (with three ? domains) and a non-covalently associated ?2 microglobulin. MHC class II molecules are composed of two transmembrane glycoproteins, ? and ?, both of which span the membrane. Each chain has two domains. MHC class I molecules deliver peptides originating in the cytosol to the cell surface, where a peptide:MHC complex is recognized by CD8.sup.+ T cells. MHC class II molecules deliver peptides originating in the vesicular system to the cell surface, where they are recognized by CD4.sup.+ T cells. Human MHC is referred to as human leukocyte antigen (HLA).

    [0207] Principles of antigen processing by antigen presenting cells (APC) (such as dendritic cells, macrophages, lymphocytes or other cell types), and of antigen presentation by APC to T cells, including major histocompatibility complex (MHC)-restricted presentation between immunocompatible (e.g., sharing at least one allelic form of an MHC gene that is relevant for antigen presentation) APC and T cells, are well established (see, e.g., Murphy, Janeway's Immunobiology (8th Ed.) 2011 Garland Science, NY; chapters 6, 9 and 16). For example, processed antigen peptides originating in the cytosol (e.g., tumor antigen, intracellular pathogen) are generally from about 7 amino acids to about 11 amino acids in length and will associate with class I MHC molecules, whereas peptides processed in the vesicular system (e.g., bacterial, viral) will generally vary in length from about 10 amino acids to about 25 amino acids and associate with class II MHC molecules.

    [0208] In particular embodiments, an engineered TCR contemplated herein binds a tumor antigen, e.g., a TAA or TSA. Tumor associate antigens or TAAs include but are not limited to oncofetal antigens, overexpressed antigens, lineage restricted antigens, and cancer-testis antigens. TAAs are relatively restricted to tumor cells. TAAs have elevated expression levels on tumor cells, but are also expressed at lower levels on healthy cells. Tumor-specific antigens or TSAs include but are not limited to neoantigens and oncoviral antigens. TSAs are unique to tumor cells. TSAs are expressed in cancer cells and not normal cells.

    [0209] In particular embodiments, engineered TCRs contemplated herein bind an antigenic portion of a polypeptide selected from the group consisting of: ?-fetoprotein (AFP), ASCL2, B Melanoma Antigen (BAGE) family members, Brother of the regulator of imprinted sites (BORIS), Cancer-testis antigens, Cancer-testis antigen 83 (CT-83), Carbonic anhydrase IX (CAIX), Carcinoembryonic antigen (CEA), Cytomegalovirus (CMV) antigens, Cytotoxic T cell (CTL)-recognized antigen on melanoma (CAMEL), Epstein-Barr virus (EBV) antigens, EPHB2, G antigen 1 (GAGE-1), GAGE-2, GAGE-3, GAGE-4, GAGE-5, GAGE-6, GAGE-7B, GAGE-8, Glycoprotein 100 (GP100), Hepatitis B virus (HBV) antigens, Hepatitis C virus (HCV) non-structure protein 3 (NS3), Human papillomavirus (HPV)-E6, HPV-E7, Human telomerase reverse transcriptase (hTERT), IGF2BP3/A3, IGF2BP1, K-Ras, K-Ras G12C, K-Ras G12D, K-Ras G12V, Latent membrane protein 2 (LMP2), LY6G6D, Melanoma antigen family A, 1 (MAGE-A1), MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A6, MAGE-A10, MAGE-A12, Melanoma antigen recognized by T cells (MART-1), Mesothelin (MSLN), Mucin 1 (MUC1), Mucin 16 (MUC16), New York esophageal squamous cell carcinoma-1 (NYESO-1), P53, P antigen (PAGE) family members, PAP, PIK3CA, PIK3CA H1047R, Placenta-specific 1 (PLAC1), Preferentially expressed antigen in melanoma (PRAME), Prostate specific antigen PSA, Survivin, Synovial sarcoma X 1 (SSX1), Synovial sarcoma X 2 (SSX2), Synovial sarcoma X 3 (SSX3), Synovial sarcoma X 4 (SSX4), Synovial sarcoma X 5 (SSX5), Synovial sarcoma X 8 (SSX8), Thyroglobulin, TP53 R175H, Tyrosinase, Tyrosinase related protein (TRP)1, TRP2, UBD, Wilms tumor protein (WT-1), Wnt10A, X Antigen Family Member 1 (XAGE1), and X Antigen Family Member 2 (XAGE2). In some embodiments, the TCR variable domains bind a target polypeptide derived from MAGE-A4, PRAME, K-Ras, TP53R175H, PSA, or IGF2BP3. In some embodiments, the TCR variable domains bind a target polypeptide derived from MAGE-A4.

    [0210] As contemplated herein, the engineered TCRs comprise a TCR component (C component). In some embodiments, the TCR component comprises a TCR? polypeptide comprising a TCR? variable domain. In some embodiments, the TCR component comprises a TCR? polypeptide comprising a TCR? variable domain. In some embodiments, the TCR component comprises a TCR? polypeptide comprising a TCR? variable domain. In some embodiments, the TCR component comprises a TCR? polypeptide comprising a TCR? variable domain.

    [0211] In one embodiment, the TCR component (C component) comprises a TCR? polypeptide comprising a TCR? variable domain; and a TCR? polypeptide comprising a TCR? variable domain. In a particular embodiment, the TCR component comprises a TCR? polypeptide comprising a TCR? variable domain; a TCR? polypeptide comprising a TCR? variable domain; and one or more antigen-binding domains linked to the TCR? variable domain and/or TCR? variable domain.

    [0212] In one embodiment, the TCR component (C component) a TCR? polypeptide comprising a TCR? variable domain; and a TCR? polypeptide comprising a TCR? variable domain. In a particular embodiment, the TCR component comprises a TCR? polypeptide comprising a TCR? variable domain; a TCR? polypeptide comprising a TCR? variable domain; and one or more antigen-binding domains linked to the TCR? variable domain and/or TCR? variable domain.

    [0213] In various embodiments, the TCR component (C component) comprises a TCR constant domain. One of skill in the art would understand that a given TCR variable domains can be paired with any one of several different constant domains. For example, any one of the TCR?, TCR?, TCR?, or TCR? variable domains can be paired with any one of the TCR?, TCR?, TCR?, or TCR? constant domains. In some embodiments, the TCR? polypeptide comprises a TCR? constant domain. In some embodiments, the TCR? polypeptide comprises a TCR? constant domain. In some embodiments, the TCR? polypeptide comprises a TCR? constant domain. In some embodiments, the TCR? polypeptide comprises a TCR? constant domain. In some embodiments a TCR? variable domain is paired with a TCR? constant domain. In some embodiments a TCR? variable domain is paired with a TCR? constant domain. In some embodiments a TCR? variable domain is paired with a TCR? constant domain. In some embodiments a TCR? variable domain is paired with a TCR? constant domain. In some embodiments a TCR? variable domain is paired with a TCR? constant domain. In some embodiments a TCR? variable domain is paired with a TCR? constant domain. In some embodiments a TCR? variable domain is paired with a TCR? constant domain. In some embodiments a TCR? variable domain is paired with a TCR? constant domain.

    [0214] The constant domains can be derived from native constant domains or mutated to enhance pairing with each other over pairing with native TCRs when expressed, or to increase stability. Such pairing and stability enhanced TCR are known, see, e.g., WO2021195503A1 and WO2018102795A1, which is incorporated by reference herein, in its entirety.

    [0215] In various embodiments, the TCR? constant domain comprises an amino acid sequence at least 85% identical to an amino acid sequence as set forth in SEQ ID NOs: 82 or 88. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 90% identical to an amino acid sequence as set forth in SEQ ID NOs: 82 or 88. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 95% identical to an amino acid sequence as set forth in SEQ ID NOs: 82 or 88. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 96% identical to an amino acid sequence as set forth in SEQ ID NOs: 82 or 88. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 97% identical to an amino acid sequence as set forth in SEQ ID NOs: 82 or 88. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 98% identical to an amino acid sequence as set forth in SEQ ID NOs: 82 or 88. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 99% identical to an amino acid sequence as set forth in SEQ ID NOs: 82 or 88. In some embodiments, the TCR? constant domain comprises an amino acid sequence as set forth in SEQ ID NOs: 82 or 88.

    [0216] In various embodiments, the TCR? constant domain comprises an amino acid sequence at least 85% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 80, 81, 86, or 87. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 90% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 80, 81, 86, or 87. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 95% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 80, 81, 86, or 87. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 96% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 80, 81, 86, or 87. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 97% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 80, 81, 86, or 87. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 98% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 80, 81, 86, or 87. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 99% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 80, 81, 86, or 87. In some embodiments, the TCR? constant domain comprises an amino acid sequence as set forth in any one of SEQ ID NOs: 80, 81, 86, or 87.

    [0217] In various embodiments, the TCR? constant domain comprises an amino acid sequence at least 85% identical to an amino acid sequence as set forth in SEQ ID NO: 83 or 84. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 90% identical to an amino acid sequence as set forth in SEQ ID NO: 83 or 84. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 95% identical to an amino acid sequence as set forth in SEQ ID NO: 83 or 84. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 96% identical to an amino acid sequence as set forth in SEQ ID NO: 83 or 84. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 97% identical to an amino acid sequence as set forth in SEQ ID NO: 83 or 84. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 98% identical to an amino acid sequence as set forth in SEQ ID NO: 83 or 84. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 99% identical to an amino acid sequence as set forth in SEQ ID NO: 83 or 84. In some embodiments, the TCR? constant domain comprises an amino acid sequence as set forth in SEQ ID NO: 83 or 84.

    [0218] In various embodiments, the TCR? constant domain comprises an amino acid sequence at least 85% identical to an amino acid sequence as set forth in SEQ ID NO: 85. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 90% identical to an amino acid sequence as set forth in SEQ ID NO: 85. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 95% identical to an amino acid sequence as set forth in SEQ ID NO: 85. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 96% identical to an amino acid sequence as set forth in SEQ ID NO: 85. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 97% identical to an amino acid sequence as set forth in SEQ ID NO: 85. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 98% identical to an amino acid sequence as set forth in SEQ ID NO: 85. In some embodiments, the TCR? constant domain comprises an amino acid sequence at least 99% identical to an amino acid sequence as set forth in SEQ ID NO: 85. In some embodiments, the TCR? constant domain comprises an amino acid sequence as set forth in SEQ ID NO: 85.

    [0219] In various embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in any one of SEQ ID NOs: 105-111. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 105. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 106. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 107. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 108. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 109. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 110. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 111.

    [0220] In various embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in any one of SEQ ID NOs: 62, 64, 66, 68, 70, 72, 74, and 76. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 62. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 64. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 66. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 68. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 70. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 72. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 74. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 76.

    [0221] In various embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in any one of SEQ ID NO: 78.

    [0222] In various embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 103 or 104. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 103. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 104.

    [0223] In various embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in any one of SEQ ID NOs: 63, 65, 67, 69, 71, 73, 75, and 77. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 63. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 65. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 67. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 69. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 71. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 73. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 75. In some embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 77.

    [0224] In various embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in any one of SEQ ID NO: 79.

    [0225] As discussed herein, one or more antigen-binding domains are linked to one or both TCR variable domains of the TCR component. For example, one or more antigen-binding domains can be linked to any one or more of the TCR?, TCR?, TCR?, or TCR? variable domains as the case may be. Various antigen-binding domain/TCR component configurations are contemplated herein. For example, a first antigen binding domain can be linked to the N-terminus of one or both TCR polypeptides (e.g., TCR?/? or TCR?/? variable regions). Additionally, a second antigen binding domain can be linked to the N-terminus of the first antigen binding domain, thus generating a tandem antigen binding domain. The first and second antigen-binding domains can be targeted to bind the same or different antigens. Similarly, multiple first binding domains can be targeted to bind the same or different antigens, and multiple second binding domains can be targeted to bind the same or different antigens.

    [0226] In various embodiments, the TCR component further comprises a signal sequence/peptide. In some embodiments, the TCR?, TCR?, TCR?, or TCR? polypeptides comprise an N-terminal signal sequence.

    [0227] In some embodiments, the TCR? polypeptide comprises an N-terminal TCR?, TCR?, TCR?, TCR?, CD8?, or IgK signal sequence. In some embodiments, the TCR? polypeptide comprises an N-terminal TCR? signal sequence. In some embodiments, the TCR? polypeptide comprises an N-terminal IgK signal sequence. In some embodiments, the TCR? polypeptide comprises an N-terminal CD8? signal sequence.

    [0228] In some embodiments, the TCR? polypeptide comprises an N-terminal TCR?, TCR?, TCR?, TCR?, CD8?, or IgK signal sequence. In some embodiments, the TCR? polypeptide comprises an N-terminal TCR? signal sequence. In some embodiments, the TCR? polypeptide comprises an N-terminal IgK signal sequence. In some embodiments, the TCR? polypeptide comprises an N-terminal CD8? signal sequence.

    [0229] In some embodiments, the TCR? polypeptide comprises an N-terminal TCR?, TCR?, TCR?, TCR?, CD8?, or IgK signal sequence. In some embodiments, the TCR? polypeptide comprises an N-terminal TCR? signal sequence. In some embodiments, the TCR? polypeptide comprises an N-terminal IgK signal sequence. In some embodiments, the TCR? polypeptide comprises an N-terminal CD8? signal sequence.

    [0230] In some embodiments, the TCR? polypeptide comprises an N-terminal TCR?, TCR?, TCR?, TCR?, CD8?, or IgK signal sequence. In some embodiments, the TCR? polypeptide comprises an N-terminal TCR? signal sequence. In some embodiments, the TCR? polypeptide comprises an N-terminal IgK signal sequence. In some embodiments, the TCR? polypeptide comprises an N-terminal CD8? signal sequence.

    D. Illustrative Engineered TCR Polypeptides and Complexes

    [0231] Various engineered TCR polypeptides and their related variants and complexes are contemplated herein. As discussed above, the engineered TCRs surprising have multi-specificity, the ability to simultaneously target both intracellular and extracellular targets, and increased sensitivity to non-MHC presented targets.

    [0232] The engineered TCRs can be constructed in multiple formats, and can be designed and constructed using known components (e.g., antigen-binding domains, polypeptide linkers, and TCR? and TCR? chains) and techniques. For example, one or more antigen-binding domains (e.g., one or more A components) can be linked to one or more TCR components (e.g., one or more C components) with or without one or more polypeptide linkers (e.g., with or without one or more B components) using standard cloning techniques. The A component can be linked to either the TCR? or TCR? polypeptide/chain or both; or the TCR? or TCR? or both; of the C component, as the case may be. Illustrative engineered TCR formulas are provided below:


    A-C


    A-B-C

    [0233] Illustrative antigen-binding domains, linkers, and TCRs can be found in Tables 3-5 below. Additionally, Table 6 provides an illustrative list of engineered TCR/ATOMIC polypeptides and complexes based on the antigen-binding domains, linkers, and TCRs provided in Tables 3, 4, and 5 (see Example 10). One of skill in the art would understand that other combinations are possible, including combinations using other antigen-binding domains, linkers, and TCRs either known to or newly developed by the skilled artisan.

    [0234] In various embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 105. In various embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 106. In various embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 107. In various embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 108. In various embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 109. In various embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 110. In various embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 111.

    [0235] In various embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 103. In various embodiments, the TCR? polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 104.

    E. Polypeptides

    [0236] Various polypeptides, fusion polypeptides, and polypeptide variants are contemplated herein, including, but not limited to, TCR polypeptides, TCR? chain polypeptides, TCR? chain polypeptides, TCR fusion polypeptides, and fragments thereof.

    [0237] Polypeptide, peptide and protein are used interchangeably, unless specified to the contrary, and according to conventional meaning, i.e., as a sequence of amino acids. Polypeptides are not limited to a specific length, e.g., they may comprise a full-length polypeptide or a polypeptide fragment, and may include one or more post-translational modifications of the polypeptide, for example, glycosylations, acetylations, phosphorylations and the like, as well as other modifications known in the art, both naturally occurring and non-naturally occurring.

    [0238] An isolated polypeptide and the like, as used herein, refer to in vitro synthesis, isolation, and/or purification of a peptide or polypeptide molecule from a cellular environment, and from association with other components of the cell, i.e., it is not significantly associated with in vivo substances. In particular embodiments, an isolated polypeptide is a synthetic polypeptide, a recombinant polypeptide, or a semi-synthetic polypeptide, or a polypeptide obtained or derived from a recombinant source.

    [0239] Polypeptides include polypeptide variants. Polypeptide variants may differ from a naturally occurring polypeptide in one or more amino acid substitutions, deletions, additions and/or insertions. Such variants may be naturally occurring or may be synthetically generated, for example, by modifying one or more of the polypeptide sequences contemplated herein. For example, in particular embodiments, it may be desirable to improve the binding affinity, stability, expression, specific pairing, functional avidity and/or other biological properties of a TCR by introducing one or more substitutions, deletions, additions and/or insertions into any one or more of the TCR?, TCR?, TCR?, and/or TCR? polypeptides, variable domains, and/or constant regions. In particular embodiments, polypeptides include polypeptides having at least about 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% amino acid identity to any of the polypeptide sequences contemplated herein, typically where the variant maintains at least one biological activity of the reference sequence.

    [0240] Polypeptides include polypeptide fragments. Polypeptide fragments refer to a polypeptide, which can be monomeric or multimeric that has an amino-terminal deletion, a carboxyl-terminal deletion, and/or an internal deletion or substitution of a naturally-occurring or recombinantly-produced polypeptide. As used herein, the term biologically active fragment or minimal biologically active fragment refers to a polypeptide fragment that retains at least 100%, at least 90%, at least 80%, at least 70%, at least 60%, at least 50%, at least 40%, at least 30%, at least 20%, at least 10%, or at least 5% of the naturally occurring polypeptide activity. In certain embodiments, a polypeptide fragment can comprise an amino acid chain at least 5 to about 500 amino acids long. It will be appreciated that in certain embodiments, fragments are at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 150, 200, 250, 300, 350, 400, or 450 amino acids long.

    [0241] As noted above, in particular embodiments, polypeptides may be altered in various ways including amino acid substitutions, deletions, truncations, and insertions. Methods for such manipulations are generally known in the art. For example, amino acid sequence variants of a reference polypeptide can be prepared by mutations in the DNA. Methods for mutagenesis and nucleotide sequence alterations are well known in the art. See, for example, Kunkel (1985, Proc. Natl. Acad. Sci. USA. 82: 488-492), Kunkel et al., (1987, Methods in Enzymol, 154: 367-382), U.S. Pat. No. 4,873,192, Watson, J. D. et al., (Molecular Biology of the Gene, Fourth Edition, Benjamin/Cummings, Menlo Park, Calif., 1987) and the references cited therein. Guidance as to appropriate amino acid substitutions that do not affect biological activity of the protein of interest may be found in the model of Dayhoff et al., (1978) Atlas of Protein Sequence and Structure (Natl. Biomed. Res. Found., Washington, D.C.).

    [0242] In certain embodiments, a polypeptide variant comprises one or more conservative substitutions. A conservative substitution is one in which an amino acid is substituted for another amino acid that has similar properties, such that one skilled in the art of peptide chemistry would expect the secondary structure and hydropathic nature of the polypeptide to be substantially unchanged. Modifications may be made in the structure of the polynucleotides and polypeptides contemplated in particular embodiments and still obtain a functional molecule that encodes a variant or derivative polypeptide with desirable characteristics. When it is desired to alter the amino acid sequence of a polypeptide to create an equivalent, or even an improved, variant polypeptide, one skilled in the art, for example, can change one or more of the codons of the encoding DNA sequence, e.g., according to Table 1.

    TABLE-US-00001 TABLE 1 Amino Acid Codons One Three letter letter Amino Acids code code Codons Alanine A Ala GCA GCC GCG GCU Cysteine C Cys UGC UGU Aspartic acid D Asp GAC GAU Glutamic acid E Glu GAA GAG Phenylalanine F Phe UUC UUU Glycine G Gly GGA GGC GGG GGU Histidine H His CAC CAU Isoleucine I Iso AUA AUC AUU Lysine K Lys AAA AAG Leucine L Leu UUA UUG CUA CUC CUG CUU Methionine M Met AUG Asparagine N Asn AAC AAU Proline P Pro CCA CCC CCG CCU Glutamine Q Gln CAA CAG Arginine R Arg AGA AGG CGA CGC CGG CGU Serine S Ser AGC AGU UCA UCC UCG UCU Threonine T Thr ACA ACC ACG ACU Valine V Val GUA GUC GUG GUU Tryptophan W Trp UGG Tyrosine Y Tyr UAC UAU

    [0243] Guidance in determining which amino acid residues can be substituted, inserted, or deleted without abolishing biological activity can be found using computer programs well known in the art, such as DNASTAR, DNA Strider, Geneious, Mac Vector, or Vector NTI software. Preferably, amino acid changes in the protein variants disclosed herein are conservative amino acid changes, i.e., substitutions of similarly charged or uncharged amino acids. A conservative amino acid change involves substitution of one of a family of amino acids which are related in their side chains. Naturally occurring amino acids are generally divided into four families: acidic (aspartate, glutamate), basic (lysine, arginine, histidine), non-polar (alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), and uncharged polar (glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine) amino acids. Phenylalanine, tryptophan, and tyrosine are sometimes classified jointly as aromatic amino acids. In a peptide or protein, suitable conservative substitutions of amino acids are known to those of skill in this art and generally can be made without altering a biological activity of a resulting molecule. Those of skill in this art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity (see, e.g., Watson et al. Molecular Biology of the Gene, 4th Edition, 1987, The Benjamin/Cummings Pub. Co., p. 224).

    [0244] As outlined above, amino acid substitutions may be based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like.

    [0245] Polypeptide variants further include glycosylated forms, aggregative conjugates with other molecules, and covalent conjugates with unrelated chemical moieties (e.g., pegylated molecules). Covalent variants can be prepared by linking functionalities to groups which are found in the amino acid chain or at the N- or C-terminal residue, as is known in the art. Variants also include allelic variants, species variants, and muteins. Truncations or deletions of regions which do not affect functional activity of the proteins are also variants.

    [0246] In particular embodiments, expression of both TCR? and TCR? polypeptides, or TCR? and TCR? polypeptides, in the same cell is desired. Polynucleotide sequences encoding TCR polypeptides can be separated by an IRES sequence as discussed elsewhere herein.

    [0247] In preferred embodiments, fusion polypeptides are contemplated herein. Fusion polypeptides and fusion proteins refer to a polypeptide having at least two, three, four, five, six, seven, eight, nine, or ten or more polypeptide segments. Fusion polypeptides are typically linked C-terminus to N-terminus, although they can also be linked C-terminus to C-terminus, N-terminus to N-terminus, or N-terminus to C-terminus. In particular embodiments, polypeptides of the fusion protein can be in any order or a specified order.

    [0248] In a particular preferred embodiment, a TCR polypeptides (i.e., TCR?, TCR?, TCR?, and/or TCR? polypeptides) can be expressed as a fusion polypeptide that comprises one or more self-cleaving polypeptide sequences that separate TCR polypeptides.

    [0249] In particular embodiments, a TCR contemplated herein (e.g., an engineered TCR) is expressed as a fusion polypeptide that comprises a TCR? polypeptide, a polypeptide linker (e.g., self cleaving polypeptide), and a TCR? polypeptide. In particular embodiments, a TCR contemplated herein (e.g., an engineered TCR) is expressed as a fusion polypeptide that comprises a TCR? polypeptide, a polypeptide linker (e.g., self cleaving polypeptide), and a TCR? polypeptide.

    [0250] In some embodiments, a TCR (e.g., an engineered TCR) is expressed as a fusion protein that comprises from N-terminus to C-terminus, a TCR? polypeptide, a polypeptide linker (e.g., self cleaving polypeptide), and a TCR? polypeptide. In some embodiments, a TCR (e.g., an engineered TCR) is expressed as a fusion protein that comprises from N-terminus to C-terminus, a TCR? polypeptide, a polypeptide linker (e.g., self cleaving polypeptide), and a TCR? polypeptide.

    [0251] In some embodiments, a TCR (e.g., an engineered TCR) is expressed as a fusion protein that comprises from N-terminus to C-terminus, a TCR? polypeptide, a polypeptide linker (e.g., self cleaving polypeptide), and a TCR? polypeptide. In some embodiments, a TCR (e.g., an engineered TCR) is expressed as a fusion protein that comprises from N-terminus to C-terminus, a TCR? polypeptide, a polypeptide linker (e.g., self cleaving polypeptide), and a TCR? polypeptide.

    [0252] In particular embodiments, an engineered TCR (e.g., an engineered TCR complex) contemplated herein is expressed as a fusion polypeptide comprising: (a) a TCR? polypeptide comprising a TCR? variable domain; (b) a polypeptide cleavage signal; and (c) a TCR? polypeptide comprising one or more antigen-binding domains, a polypeptide linker, and a TCR? variable domain.

    [0253] In particular embodiments, an engineered TCR (e.g., an engineered TCR complex)contemplated herein is expressed as a fusion polypeptide comprising (a) a TCR? polypeptide comprising one or more antigen-binding domains, a polypeptide linker, and a TCR? variable domain; (b) a polypeptide cleavage signal; and (c) a TCR? polypeptide comprising a TCR? variable domain.

    [0254] In particular embodiments, an engineered TCR (e.g., an engineered TCR complex)contemplated herein is expressed as a fusion polypeptide comprising: (a) a TCR? polypeptide comprising one or more antigen-binding domains, a polypeptide linker, and a TCR? variable domain; (b) a polypeptide cleavage signal; and (c) a TCR? polypeptide comprising one or more antigen-binding domains, a polypeptide linker, and a TCR? variable domain.

    [0255] In particular embodiments, an engineered TCR (e.g., an engineered TCR complex)contemplated herein is expressed as a fusion polypeptide comprising: (a) a TCR? polypeptide comprising a TCR? variable domain; (b) a polypeptide cleavage signal; and (c) a TCR? polypeptide comprising one or more antigen-binding domains, a polypeptide linker, and a TCR? variable domain.

    [0256] In particular embodiments, an engineered TCR (e.g., an engineered TCR complex)contemplated herein is expressed as a fusion polypeptide comprising (a) a TCR? polypeptide comprising one or more antigen-binding domains, a polypeptide linker, and a TCR? variable domain; (b) a polypeptide cleavage signal; and (c) a TCR? polypeptide comprising a TCR? variable domain.

    [0257] In particular embodiments, an engineered TCR (e.g., an engineered TCR complex)contemplated herein is expressed as a fusion polypeptide comprising: (a) a TCR? polypeptide comprising one or more antigen-binding domains, a polypeptide linker, and a TCR? variable domain; (b) a polypeptide cleavage signal; and (c) a TCR? polypeptide comprising one or more antigen-binding domains, a polypeptide linker, and a TCR? variable domain.

    [0258] The fusion polypeptides can comprise any of the TCR polypeptides contemplated herein.

    [0259] The fusion proteins contemplated herein also comprise a polypeptide cleavage signal between the TCR polypeptides. Illustrative examples of polypeptide cleavage signals include polypeptide cleavage recognition sites such as protease cleavage sites, nuclease cleavage sites (e.g., rare restriction enzyme recognition sites, self-cleaving ribozyme recognition sites), and self-cleaving viral oligopeptides (see deFelipe and Ryan, 2004. Traffic, 5(8); 616-26).

    [0260] Suitable protease cleavages sites and self-cleaving peptides are known to the skilled person (see, e.g., in Ryan et al., 1997. J. Gener. Virol. 78, 699-722; Scymczak et al. (2004) Nature Biotech. 5, 589-594). Exemplary protease cleavage sites include, but are not limited to the cleavage sites of potyvirus NIa proteases (e.g., tobacco etch virus protease), potyvirus HC proteases, potyvirus P1 (P35) proteases, byovirus NIa proteases, byovirus RNA-2-encoded proteases, aphthovirus L proteases, enterovirus 2A proteases, rhinovirus 2A proteases, picorna 3C proteases, comovirus 24K proteases, nepovirus 24K proteases, RTSV (rice tungro spherical virus) 3C-like protease, PYVF (parsnip yellow fleck virus) 3C-like protease, heparin, thrombin, factor Xa and enterokinase. Due to its high cleavage stringency, TEV (tobacco etch virus) protease cleavage sites are preferred in one embodiment, e.g., EXXYXQ(G/S), for example, ENLYFQG (SEQ ID NO: 114) and ENLYFQS (SEQ ID NO: 115), wherein X represents any amino acid (cleavage by TEV occurs between Q and G or Q and S).

    [0261] In particular embodiments, the polypeptide cleavage signal is a viral self-cleaving peptide or ribosomal skipping sequence.

    [0262] Illustrative examples of ribosomal skipping sequences include, but are not limited to: a 2A or 2A-like site, sequence or domain (Donnelly et al., 2001. J. Gen. Virol. 82:1027-1041).

    [0263] In a particular embodiment, the viral 2A peptide is an aphthovirus 2A peptide, a potyvirus 2A peptide, or a cardiovirus 2A peptide. In one embodiment, the viral 2A peptide is selected from the group consisting of: a foot-and-mouth disease virus (FMDV) 2A peptide, an equine rhinitis A virus (ERAV) 2A peptide, a Thosea asigna virus (TaV) 2A peptide, a porcine teschovirus-1 (PTV-1) 2A peptide, a Theilovirus 2A peptide, and an encephalomyocarditis virus 2A peptide.

    [0264] Illustrative examples of 2A sites are provided in Table 1.

    TABLE-US-00002 TABLE2 SEQIDNO:116 GSGATNFSLLKQAGDVEENPGP SEQIDNO:117 ATNFSLLKQAGDVEENPGP SEQIDNO:118 LLKQAGDVEENPGP SEQIDNO:119 GSGEGRGSLLTCGDVEENPGP SEQIDNO:120 EGRGSLLTCGDVEENPGP SEQIDNO:121 LLTCGDVEENPGP SEQIDNO:122 GSGQCTNYALLKLAGDVESNPGP SEQIDNO:123 QCTNYALLKLAGDVESNPGP SEQIDNO:124 LLKLAGDVESNPGP SEQIDNO:125 GSGVKQTLNFDLLKLAGDVESNPGP SEQIDNO:126 VKQTLNFDLLKLAGDVESNPGP SEQIDNO:127 LLKLAGDVESNPGP SEQIDNO:128 LLNFDLLKLAGDVESNPGP SEQIDNO:129 TLNFDLLKLAGDVESNPGP SEQIDNO:130 LLKLAGDVESNPGP SEQIDNO:131 NFDLLKLAGDVESNPGP SEQIDNO:132 QLLNFDLLKLAGDVESNPGP SEQIDNO:133 APVKQTLNFDLLKLAGDVESNPGP SEQIDNO:134 VTELLYRMKRAETYCPRPLLAIHPTEARHKQ KIVAPVKQT SEQIDNO:135 LNFDLLKLAGDVESNPGP SEQIDNO:136 LLAIHPTEARHKQKIVAPVKQTLNFDLLKLA GDVESNPGP SEQIDNO:137 EARHKQKIVAPVKQTLNFDLLKLAGDVESNP GP

    [0265] In particular embodiments, the fusion protein comprises a polypeptide cleavage signal that is a viral self-cleaving peptide or ribosomal skipping sequence.

    [0266] In particular embodiments, the fusion protein comprises a polypeptide cleavage signal that is a viral 2A peptide. In particular embodiments, the fusion protein comprises a polypeptide cleavage signal that is an aphthovirus 2A peptide, a potyvirus 2A peptide, or a cardiovirus 2A peptide. In particular embodiments, the fusion protein comprises a polypeptide cleavage signal that is a viral 2A peptide is selected from the group consisting of: a foot-and-mouth disease virus (FMDV) 2A peptide, an equine rhinitis A virus (ERAV) 2A peptide, a Thosea asigna virus (TaV) 2A peptide, a porcine teschovirus-1 (PTV-1) 2A peptide, a Theilovirus 2A peptide, and an encephalomyocarditis virus 2A peptide.

    [0267] In particular embodiments, the polypeptide cleavage signal is a viral self-cleaving peptide or ribosomal skipping sequence. In some embodiments, the polypeptide cleavage signal is a viral 2A peptide. In some embodiments, the polypeptide cleavage signal is an aphthovirus 2A peptide, a potyvirus 2A peptide, or a cardiovirus 2A peptide. In some embodiments, the polypeptide cleavage signal is a viral 2A peptide selected from the group consisting of: a foot-and-mouth disease virus (FMDV) 2A peptide, an equine rhinitis A virus (ERAV) 2A peptide, a Thosea asigna virus (TaV) 2A peptide, a porcine teschovirus-1 (PTV-1) 2A peptide, a Theilovirus 2A peptide, and an encephalomyocarditis virus 2A peptide.

    [0268] In various embodiments, the polypeptide cleavage signal comprises a self-cleaving peptide (e.g., 2A peptide) and a GSG amino acid sequence immediately upstream (i.e., N-term) of the 2A peptide.

    [0269] In various embodiments, the polypeptide cleavage signal further comprises a furin recognition site upstream of the polypeptide cleavage signal (e.g., self-cleaving 2A peptide). In particular embodiments, the furin recognition site comprises the amino acid sequence as set forth in SEQ ID NO: 112.

    [0270] In various embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in any one of SEQ ID NOs: 113-137. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 113. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 114. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 115. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 116. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 117. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 118. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 119. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 120. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 121. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 122. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 123. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 124. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 125. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 126. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 127. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 128. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 129. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 130. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 131. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 132. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 133. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 134. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 135. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 136. In some embodiments, the polypeptide cleavage signal comprises an amino acid sequence as set forth in SEQ ID NO: 137.

    [0271] In various embodiments, the TCR? or TCR? polypeptide is N-terminal of the TCR? or TCR? polypeptide.

    [0272] In various embodiments, the TCR? or TCR? polypeptide is N-terminal of the TCR? or TCR? polypeptide.

    [0273] In particular embodiments, the fusion polypeptide comprises an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 91-97, 100, and 102. In some embodiments, the fusion polypeptide comprises an amino acid sequence at least 85%, identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 91-97, 100, and 102. In some embodiments, the fusion polypeptide comprises an amino acid sequence at least 90%, identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 91-97, 100, and 102. In some embodiments, the fusion polypeptide comprises an amino acid sequence at least 95%, identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 91-97, 100, and 102. In some embodiments, the fusion polypeptide comprises an amino acid sequence at least 96%, identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 91-97, 100, and 102. In some embodiments, the fusion polypeptide comprises an amino acid sequence at least 97%, identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 91-97, 100, and 102. In some embodiments, the fusion polypeptide comprises an amino acid sequence at least 98%, identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 91-97, 100, and 102. In some embodiments, the fusion polypeptide comprises an amino acid sequence at least 99%, identical to an amino acid sequence as set forth in any one of SEQ ID NOs: 91-97, 100, and 102.

    [0274] In particular embodiments, the fusion polypeptide comprises an amino acid sequence as set forth in any one of SEQ ID NOs: 91-97, 100, and 102. In some embodiments, the fusion polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 91. In some embodiments, the fusion polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 92. In some embodiments, the fusion polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 93. In some embodiments, the fusion polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 94. In some embodiments, the fusion polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 95. In some embodiments, the fusion polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 96. In some embodiments, the fusion polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 97. In some embodiments, the fusion polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 100. In some embodiments, the fusion polypeptide comprises an amino acid sequence as set forth in SEQ ID NO: 102.

    F. Polynucleotides

    [0275] In particular embodiments, one or more polynucleotides encoding one or more TCR polypeptides, TCR? polypeptides, TCR? polypeptides, TCR? polypeptides, TCR? polypeptides, TCR fusion polypeptides, and fragments thereof is provided. As used herein, the terms polynucleotide or nucleic acid refer to deoxyribonucleic acid (DNA), ribonucleic acid (RNA) and DNA/RNA hybrids. Polynucleotides may be monocistronic or polycistronic, single-stranded or double-stranded, and either recombinant, synthetic, or isolated. Polynucleotides include, but are not limited to: pre-messenger RNA (pre-mRNA), messenger RNA (mRNA), RNA, genomic DNA (gDNA), PCR amplified DNA, complementary DNA (cDNA), synthetic DNA, or recombinant DNA. Polynucleotides refer to a polymeric form of nucleotides of at least 5, at least 10, at least 15, at least 20, at least 25, at least 30, at least 40, at least 50, at least 100, at least 200, at least 300, at least 400, at least 500, at least 1000, at least 5000, at least 10000, or at least 15000 or more nucleotides in length, either ribonucleotides or deoxyribonucleotides or a modified form of either type of nucleotide, as well as all intermediate lengths. It will be readily understood that intermediate lengths, in this context, means any length between the quoted values, such as 6, 7, 8, 9, etc., 101, 102, 103, etc.; 151, 152, 153, etc.; 201, 202, 203, etc. In particular embodiments, polynucleotides or variants have at least or about 50%, 55%, 60%, 65%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a reference sequence.

    [0276] As used herein, isolated polynucleotide refers to a polynucleotide that has been purified from the sequences which flank it in a naturally-occurring state, e.g., a DNA fragment that has been removed from the sequences that are normally adjacent to the fragment. In particular embodiments, an isolated polynucleotide also refers to a complementary DNA (cDNA), a recombinant DNA, or other polynucleotide that does not exist in nature and that has been made by the hand of man. In particular embodiments, an isolated polynucleotide is a synthetic polynucleotide, a recombinant polynucleotide, a semi-synthetic polynucleotide, or a polynucleotide obtained or derived from a recombinant source.

    [0277] In various embodiments, a polynucleotide comprises an mRNA encoding a polypeptide contemplated herein. In certain embodiments, the mRNA comprises a cap, one or more nucleotides, and a poly(A) tail.

    [0278] In various embodiments, the polynucleotide is an mRNA that is introduced into a cell in order to transiently express a desired polypeptide.

    [0279] As used herein, transient refers to expression of a non-integrated transgene for a period of hours, days or weeks, wherein the period of time of expression is less than the period of time for expression of the polynucleotide if integrated into the genome or contained within a stable plasmid replicon in the cell.

    [0280] In particular embodiments, the mRNA encoding a polypeptide is an in vitro transcribed mRNA. As used herein, in vitro transcribed RNA refers to RNA, preferably mRNA that has been synthesized in vitro. Generally, the in vitro transcribed RNA is generated from an in vitro transcription vector. The in vitro transcription vector comprises a template that is used to generate the in vitro transcribed RNA.

    [0281] In particular embodiments, mRNAs may further comprise a comprise a 5 cap or modified 5 cap and/or a poly(A) sequence. As used herein, a 5 cap (also termed an RNA cap, an RNA 7-methylguanosine cap or an RNA m.sup.7G cap) is a modified guanine nucleotide that has been added to the front or 5 end of a eukaryotic messenger RNA shortly after the start of transcription. The 5 cap comprises a terminal group which is linked to the first transcribed nucleotide and recognized by the ribosome and protected from RNases. The capping moiety can be modified to modulate functionality of mRNA such as its stability or efficiency of translation. In a particular embodiment, the mRNA comprises a poly(A) sequence of between about 50 and about 5000 adenines. In one embodiment, the mRNA comprises a poly(A) sequence of between about 100 and about 1000 bases, between about 200 and about 500 bases, or between about 300 and about 400 bases. In one embodiment, the mRNA comprises a poly(A) sequence of about 65 bases, about 100 bases, about 200 bases, about 300 bases, about 400 bases, about 500 bases, about 600 bases, about 700 bases, about 800 bases, about 900 bases, or about 1000 or more bases. poly(A) sequences can be modified chemically or enzymatically to modulate mRNA functionality such as localization, stability or efficiency of translation. In particular embodiments, polynucleotides may be codon-optimized. As used herein, the term codon-optimized refers to substituting codons in a polynucleotide encoding a polypeptide in order to increase the expression, stability and/or activity of the polypeptide. Factors that influence codon optimization include, but are not limited to one or more of: (i) variation of codon biases between two or more organisms or genes or synthetically constructed bias tables, (ii) variation in the degree of codon bias within an organism, gene, or set of genes, (iii) systematic variation of codons including context, (iv) variation of codons according to their decoding tRNAs, (v) variation of codons according to GC %, either overall or in one position of the triplet, (vi) variation in degree of similarity to a reference sequence for example a naturally occurring sequence, (vii) variation in the codon frequency cutoff, (viii) structural properties of mRNAs transcribed from the DNA sequence, (ix) prior knowledge about the function of the DNA sequences upon which design of the codon substitution set is to be based, (x) systematic variation of codon sets for each amino acid, and/or (xi) isolated removal of spurious translation initiation sites.

    [0282] As used herein, the terms polynucleotide variant and variant and the like refer to polynucleotides displaying substantial sequence identity with a reference polynucleotide sequence or polynucleotides that hybridize with a reference sequence under stringent conditions that are defined hereinafter. These terms include polynucleotides in which one or more nucleotides have been added or deleted or replaced with different nucleotides compared to a reference polynucleotide. In this regard, it is well understood in the art that certain alterations inclusive of mutations, additions, deletions and substitutions can be made to a reference polynucleotide whereby the altered polynucleotide retains the biological function or activity of the reference polynucleotide.

    [0283] Polynucleotide variants include polynucleotide fragments that encode biologically active polypeptide fragments or variants. As used herein, the term polynucleotide fragment refers to a polynucleotide fragment at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 150, 200,250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700 or more nucleotides in length that encodes a polypeptide variant that retains at least 100%, at least 90%, at least 80%, at least 70%, at least 60%, at least 50%, at least 40%, at least 30%, at least 20%, at least 10%, or at least 5% of the naturally occurring polypeptide activity. Polynucleotide fragments refer to a polynucleotide that encodes a polypeptide that has an amino-terminal deletion, a carboxyl-terminal deletion, and/or an internal deletion or substitution of one or more amino acids of a naturally-occurring or recombinantly-produced polypeptide.

    [0284] The recitations sequence identity or, for example, comprising a sequence 50% identical to, as used herein, refer to the extent that sequences are identical on a nucleotide-by-nucleotide basis or an amino acid-by-amino acid basis over a window of comparison. Thus, a percentage of sequence identity may be calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, I) or the identical amino acid residue (e.g., Ala, Pro, Ser, Thr, Gly, Val, Leu, Ile, Phe, Tyr, Trp, Lys, Arg, His, Asp, Glu, Asn, Gln, Cys and Met) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity. Included are nucleotides and polypeptides having at least about 50%, 55%, 60%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any of the reference sequences described herein, typically where the polypeptide variant maintains at least one biological activity of the reference polypeptide.

    [0285] Terms used to describe sequence relationships between two or more polynucleotides or polypeptides include reference sequence, comparison window, sequence identity, percentage of sequence identity, and substantial identity. A reference sequence is at least 12 but frequently 15 to 18 and often at least 25 monomer units, inclusive of nucleotides and amino acid residues, in length. Because two polynucleotides may each comprise (1) a sequence (i.e., only a portion of the complete polynucleotide sequence) that is similar between the two polynucleotides, and (2) a sequence that is divergent between the two polynucleotides, sequence comparisons between two (or more) polynucleotides are typically performed by comparing sequences of the two polynucleotides over a comparison window to identify and compare local regions of sequence similarity. A comparison window refers to a conceptual segment of at least 6 contiguous positions, usually about 50 to about 100, more usually about 100 to about 150 in which a sequence is compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. The comparison window may comprise additions or deletions (i.e., gaps) of about 20% or less as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. Optimal alignment of sequences for aligning a comparison window may be conducted by computerized implementations of algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package Release 7.0, Genetics Computer Group, 575 Science Drive Madison, WI, USA) or by inspection and the best alignment (i.e., resulting in the highest percentage homology over the comparison window) generated by any of the various methods selected. Reference also may be made to the BLAST family of programs as for example disclosed by Altschul et al., 1997, Nucl. Acids Res. 25:3389. A detailed discussion of sequence analysis can be found in Unit 19.3 of Ausubel et al., Current Protocols in Molecular Biology, John Wiley & Sons Inc, 1994-1998, Chapter 15.

    [0286] Terms that describe the orientation of polynucleotides include: 5 (normally the end of the polynucleotide having a free phosphate group) and 3 (normally the end of the polynucleotide having a free hydroxyl (OH) group). Polynucleotide sequences can be annotated in the 5 to 3 orientation or the 3 to 5 orientation. For DNA and mRNA, the 5 to 3 strand is designated the sense, plus, or coding strand because its sequence is identical to the sequence of the premessenger (premRNA) [except for uracil (U) in RNA, instead of thymine (T) in DNA]. For DNA and mRNA, the complementary 3 to 5 strand which is the strand transcribed by the RNA polymerase is designated as template, antisense, minus, or non-coding strand. As used herein, the term reverse orientation refers to a 5 to 3 sequence written in the 3 to 5 orientation or a 3 to 5 sequence written in the 5 to 3 orientation.

    [0287] Moreover, it will be appreciated by those of ordinary skill in the art that, as a result of the degeneracy of the genetic code, there are many nucleotide sequences that encode a polypeptide, or fragment of variant thereof, as described herein. Some of these polynucleotides bear minimal homology to the nucleotide sequence of any native gene. Nonetheless, polynucleotides that vary due to differences in codon usage are specifically contemplated in particular embodiments, for example polynucleotides that are optimized for human and/or primate codon selection. Further, alleles of the genes comprising the polynucleotide sequences provided herein may also be used. Alleles are endogenous genes that are altered as a result of one or more mutations, such as deletions, additions and/or substitutions of nucleotides.

    [0288] The term nucleic acid cassette or expression cassette as used herein refers to genetic sequences within the vector which can express an RNA, and subsequently a polypeptide. In one embodiment, the nucleic acid cassette contains a gene(s)-of-interest, e.g., a polynucleotide(s)-of-interest. In another embodiment, the nucleic acid cassette contains one or more expression control sequences, e.g., a promoter, enhancer, poly(A) sequence, and a gene(s)-of-interest, e.g., a polynucleotide(s)-of-interest. Vectors may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 or more nucleic acid cassettes. The nucleic acid cassette is positionally and sequentially oriented within the vector such that the nucleic acid in the cassette can be transcribed into RNA, and when necessary, translated into a protein or a polypeptide, undergo appropriate post-translational modifications required for activity in the transformed cell, and be translocated to the appropriate compartment for biological activity by targeting to appropriate intracellular compartments or secretion into extracellular compartments. Preferably, the cassette has its 3 and 5 ends adapted for ready insertion into a vector, e.g., it has restriction endonuclease sites at each end. In a preferred embodiment, the nucleic acid cassette encodes one or more chains of a TCR. The cassette can be removed and inserted into a plasmid or viral vector as a single unit.

    [0289] Polynucleotides include polynucleotide(s)-of-interest. As used herein, the term polynucleotide-of-interest refers to a polynucleotide encoding a polypeptide, polypeptide variant, or fusion polypeptide. A vector may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 polynucleotides-of-interest. In certain embodiments, the polynucleotide-of-interest encodes a polypeptide that provides a therapeutic effect in the treatment or prevention of a disease or disorder. Polynucleotides-of-interest, and polypeptides encoded therefrom, include both polynucleotides that encode wild-type polypeptides, as well as functional variants and fragments thereof. In particular embodiments, a functional variant has at least 80%, at least 90%, at least 95%, or at least 99% identity to a corresponding wild-type reference polynucleotide or polypeptide sequence. In certain embodiments, a functional variant or fragment has at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% of a biological activity of a corresponding wild-type polypeptide.

    [0290] The polynucleotides contemplated herein, regardless of the length of the coding sequence itself, may be combined with other DNA sequences, such as promoters and/or enhancers, untranslated regions (UTRs), signal sequences, Kozak sequences, polyadenylation signals, additional restriction enzyme sites, multiple cloning sites, internal ribosomal entry sites (IRES), recombinase recognition sites (e.g., LoxP, FRT, and Att sites), termination codons, transcriptional termination signals, and polynucleotides encoding self-cleaving polypeptides, epitope tags, as disclosed elsewhere herein or as known in the art, such that their overall length may vary considerably. It is therefore contemplated that a polynucleotide fragment of almost any length may be employed in particular embodiments, with the total length preferably being limited by the ease of preparation and use in the intended recombinant DNA protocol.

    [0291] Polynucleotides can be prepared, manipulated and/or expressed using any of a variety of well-established techniques known and available in the art. In order to express a desired polypeptide, a nucleotide sequence encoding the polypeptide, can be inserted into appropriate vector as discussed further below.

    [0292] Illustrative examples of vectors include, but are not limited to plasmid, autonomously replicating sequences, and transposable elements, e.g., piggyBac, Sleeping Beauty, Mos1, Tc1/mariner, Tol2, mini-Tol2, Tc3, MuA, Himar I, Frog Prince, and derivatives thereof.

    [0293] Additional Illustrative examples of vectors include, without limitation, plasmids, phagemids, cosmids, artificial chromosomes such as yeast artificial chromosome (YAC), bacterial artificial chromosome (BAC), or P1-derived artificial chromosome (PAC), bacteriophages such as lambda phage or M13 phage, and animal viruses.

    [0294] Illustrative examples of viruses useful as vectors include, without limitation, retrovirus (including lentivirus), adenovirus, adeno-associated virus, herpesvirus (e.g., herpes simplex virus), poxvirus, baculovirus, papillomavirus, and papovavirus (e.g., SV40).

    [0295] Illustrative examples of expression vectors include, but are not limited to, pClneo vectors (Promega) for expression in mammalian cells; pLenti4/V5-DEST?, pLenti6/V5-DEST?, and pLenti6.2/V5-GW/lacZ (Invitrogen) for lentivirus-mediated gene transfer and expression in mammalian cells. In particular embodiments, coding sequences of polypeptides disclosed herein can be ligated into such expression vectors for the expression of the polypeptides in mammalian cells.

    [0296] In particular embodiments, the vector is an episomal vector or a vector that is maintained extrachromosomally. As used herein, the term episomal refers to a vector that is able to replicate without integration into host's chromosomal DNA and without gradual loss from a dividing host cell also meaning that said vector replicates extrachromosomally or episomally.

    [0297] The control elements or regulatory sequences present in an expression vector are those non-translated regions of the vector-origin of replication, selection cassettes, promoters, enhancers, translation initiation signals (Shine Dalgarno sequence or Kozak sequence) introns, a polyadenylation sequence, 5 and 3 untranslated regions-which interact with host cellular proteins to carry out transcription and translation. Such elements may vary in their strength and specificity. Depending on the vector system and host utilized, any number of suitable transcription and translation elements, including ubiquitous promoters and inducible promoters may be used.

    [0298] In particular embodiments, vectors include, but are not limited to expression vectors and viral vectors, and will include exogenous, endogenous, or heterologous control sequences such as promoters and/or enhancers. An endogenous control sequence is one which is naturally linked with a given gene in the genome. An exogenous control sequence is one which is placed in juxtaposition to a gene by means of genetic manipulation (i.e., molecular biological techniques) such that transcription of that gene is directed by the linked enhancer/promoter. A heterologous control sequence is an exogenous sequence that is from a different species than the cell being genetically manipulated.

    [0299] The term promoter as used herein refers to a recognition site of a polynucleotide (DNA or RNA) to which an RNA polymerase binds. An RNA polymerase initiates and transcribes polynucleotides operably linked to the promoter. In particular embodiments, promoters operative in mammalian cells comprise an AT-rich region located approximately to 30 bases upstream from the site where transcription is initiated and/or another sequence found 70 to 80 bases upstream from the start of transcription, a CNCAAT region where N may be any nucleotide.

    [0300] The term enhancer refers to a segment of DNA which contains sequences capable of providing enhanced transcription and in some instances can function independent of their orientation relative to another control sequence. An enhancer can function cooperatively or additively with promoters and/or other enhancer elements. The term promoter/enhancer refers to a segment of DNA which contains sequences capable of providing both promoter and enhancer functions.

    [0301] The term operably linked, refers to a juxtaposition wherein the components described are in a relationship permitting them to function in their intended manner. In one embodiment, the term refers to a functional linkage between a nucleic acid expression control sequence (such as a promoter, and/or enhancer) and a second polynucleotide sequence, e.g., a polynucleotide-of-interest, wherein the expression control sequence directs transcription of the nucleic acid corresponding to the second sequence.

    [0302] As used herein, the term constitutive expression control sequence refers to a promoter, enhancer, or promoter/enhancer that continually or continuously allows for transcription of an operably linked sequence. A constitutive expression control sequence may be a ubiquitous promoter, enhancer, or promoter/enhancer that allows expression in a wide variety of cell and tissue types or a cell specific, cell type specific, cell lineage specific, or tissue specific promoter, enhancer, or promoter/enhancer that allows expression in a restricted variety of cell and tissue types, respectively.

    [0303] Illustrative ubiquitous expression control sequences suitable for use in particular embodiments include, but are not limited to, a cytomegalovirus (CMV) immediate early promoter, a viral simian virus 40 (SV40) (e.g., early or late), a Moloney murine leukemia virus (MoMLV) LTR promoter, a Rous sarcoma virus (RSV) LTR, a herpes simplex virus (HSV) (thymidine kinase) promoter, H5, P7.5, and P11 promoters from vaccinia virus, an elongation factor 1-alpha (EF1a) promoter, early growth response 1 (EGR1), ferritin H (FerH), ferritin L (FerL), Glyceraldehyde 3-phosphate dehydrogenase (GAPDH), eukaryotic translation initiation factor 4A1 (EIF4A1), heat shock 70 kDa protein 5 (HSPA5), heat shock protein 90 kDa beta, member 1 (HSP90B1), heat shock protein 70 kDa (HSP70), 0-kinesin (0-KIN), the human ROSA 26 locus (Irions et al., Nature Biotechnology 25, 1477-1482 (2007)), a Ubiquitin C promoter (UBC), a phosphoglycerate kinase-1 (PGK) promoter, a cytomegalovirus enhancer/chicken ?-actin (CAG) promoter, a ?-actin promoter and a myeloproliferative sarcoma virus enhancer, negative control region deleted, d1587rev primer-binding site substituted (MND) U3 promoter (Haas et al. Journal of Virology. 2003; 77(17): 9439-9450).

    [0304] In one embodiment, a vector comprises an MNDU3 promoter.

    [0305] In one embodiment, a vector comprises an EF1a promoter comprising the first intron of the human EF1a gene.

    [0306] In one embodiment, a vector comprises an EF1a promoter that lacks the first intron of the human EF1a gene.

    [0307] In a particular embodiment, it may be desirable to express a polynucleotide comprising an engineered TCR from a T cell specific promoter.

    [0308] As used herein, conditional expression may refer to any type of conditional expression including, but not limited to, inducible expression; repressible expression; expression in cells or tissues having a particular physiological, biological, or disease state, etc. This definition is not intended to exclude cell type or tissue specific expression. Certain embodiments provide conditional expression of a polynucleotide-of-interest, e.g., expression is controlled by subjecting a cell, tissue, organism, etc., to a treatment or condition that causes the polynucleotide to be expressed or that causes an increase or decrease in expression of the polynucleotide encoded by the polynucleotide-of-interest.

    [0309] Illustrative examples of inducible promoters/systems include, but are not limited to, steroid-inducible promoters such as promoters for genes encoding glucocorticoid or estrogen receptors (inducible by treatment with the corresponding hormone), metallothionine promoter (inducible by treatment with various heavy metals), MX-1 promoter (inducible by interferon), the GeneSwitch mifepristone-regulatable system (Sirin et al., 2003, Gene, 323:67), the cumate inducible gene switch (WO 2002/088346), tetracycline-dependent regulatory systems, etc.

    [0310] Conditional expression can also be achieved by using a site-specific DNA recombinase. According to certain embodiments the vector comprises at least one (typically two) site(s) for recombination mediated by a site-specific recombinase. As used herein, the terms recombinase or site specific recombinase include excusive or integrative proteins, enzymes, co-factors or associated proteins that are involved in recombination reactions involving one or more recombination sites (e.g., two, three, four, five, seven, ten, twelve, fifteen, twenty, thirty, fifty, etc.), which may be wild-type proteins (see Landy, Current Opinion in Biotechnology 3:699-707 (1993)), or mutants, derivatives (e.g., fusion proteins containing the recombination protein sequences or fragments thereof), fragments, and variants thereof. Illustrative examples of recombinases suitable for use in particular embodiments include, but are not limited to: Cre, Int, IHF, Xis, Flp, Fis, Hin, Gin, ?C31, Cin, Tn3 resolvase, TndX, XerC, XerD, TnpX, Hjc, Gin, SpCCE1, and ParA.

    [0311] The vectors may comprise one or more recombination sites for any of a wide variety of site-specific recombinases. It is to be understood that the target site for a site-specific recombinase is in addition to any site(s) required for integration of a vector, e.g., a retroviral vector or lentiviral vector. As used herein, the terms recombination sequence, recombination site, or site specific recombination site refer to a particular nucleic acid sequence to which a recombinase recognizes and binds.

    [0312] For example, one recombination site for Cre recombinase is loxP which is a 34 base pair sequence comprising two 13 base pair inverted repeats (serving as the recombinase binding sites) flanking an 8 base pair core sequence (see FIG. 1 of Sauer, B., Current Opinion in Biotechnology 5:521-527 (1994)). Other exemplary loxP sites include, but are not limited to: lox511 (Hoess et al., 1996; Bethke and Sauer, 1997), lox5171 (Lee and Saito, 1998), lox2272 (Lee and Saito, 1998), m2 (Langer et al., 2002), lox71 (Albert et al., 1995), and lox66 (Albert et al., 1995).

    [0313] Suitable recognition sites for the FLP recombinase include, but are not limited to: FRT (McLeod, et al., 1996), F.sub.1, F.sub.2, F.sub.3 (Schlake and Bode, 1994), F.sub.4, F.sub.5 (Schlake and Bode, 1994), FRT(LE) (Senecoff et al., 1988), FRT(RE) (Senecoff et al., 1988).

    [0314] Other examples of recognition sequences are the attB, attP, attL, and attR sequences, which are recognized by the recombinase enzyme ? Integrase, e.g., phi-c31. The ?C31 SSR mediates recombination only between the heterotypic sites attB (34 bp in length) and attP (39 bp64aposiength) (Groth et al., 2000). attB and attP, named for the attachment sites for the phage integrase on the bacterial and phage genomes, respectively, both contain imperfect inverted repeats that are likely bound by ?C3164aposidimers (Groth et al., 2000). The product sites, attL and attR, are effectively inert to further ?C31-mediated recombination (Belteki et al., 2003), making the reaction irreversible. For catalyzing insertions, it has been found that attB-bearing DNA inserts into a genomic attP site more readily than an attP site into a genomic attB site (Thyagarajan et al., 2001; Belteki et al., 2003). Thus, typical strategies position by homologous recombination an attP-bearing docking site into a defined locus, which is then partnered with an attB-bearing incoming sequence for insertion.

    [0315] As used herein, an internal ribosome entry site or IRES refers to an element that promotes direct internal ribosome entry to the initiation codon, such as ATG, of a cistron (a protein encoding region), thereby leading to the cap-independent translation of the gene. See, e.g., Jackson et al., 1990. Trends Biochem Sci 15(12):477-83) and Jackson and Kaminski. 1995. RNA 1(10):985-1000. In particular embodiments, vectors include one or more polynucleotides-of-interest that encode one or more polypeptides. In particular embodiments, to achieve efficient translation of each of the plurality of polypeptides, the polynucleotide sequences can be separated by one or more IRES sequences or polynucleotide sequences encoding self-cleaving polypeptides. In one embodiment, the IRES used in polynucleotides contemplated herein is an EMCV IRES.

    [0316] As used herein, the term Kozak sequence refers to a short nucleotide sequence that greatly facilitates the initial binding of mRNA to the small subunit of the ribosome and increases translation. The consensus Kozak sequence is (GCC)RCCATGG (SEQ ID NO: 139), where R is a purine (A or G) (Kozak, 1986. Cell. 44(2):283-92, and Kozak, 1987. Nucleic Acids Res. 15(20):8125-48). In particular embodiments, the vectors comprise polynucleotides that have a consensus Kozak sequence and that encode a desired polypeptide, e.g., a TCR.

    [0317] Elements directing the efficient termination and polyadenylation of the heterologous nucleic acid transcripts increases heterologous gene expression. Transcription termination signals are generally found downstream of the polyadenylation signal. In particular embodiments, vectors comprise a polyadenylation sequence 3 of a polynucleotide encoding a polypeptide to be expressed. The term polyA site or polyA sequence as used herein denotes a DNA sequence which directs both the termination and polyadenylation of the nascent RNA transcript by RNA polymerase II. Polyadenylation sequences can promote mRNA stability by addition of a polyA tail to the 3 end of the coding sequence and thus, contribute to increased translational efficiency. Cleavage and polyadenylation is directed by a poly(A) sequence in the RNA. The core poly(A) sequence for mammalian pre-mRNAs has two recognition elements flanking a cleavage-polyadenylation site. Typically, an almost invariant AAUAAA hexamer lies 20-50 nucleotides upstream of a more variable element rich in U or GU residues. Cleavage of the nascent transcript occurs between these two elements and is coupled to the addition of up to 250 adenosines to the 5 cleavage product. In particular embodiments, the core poly(A) sequence is an ideal polyA sequence (e.g., AATAAA, ATTAAA, AGTAAA). In particular embodiments, the poly(A) sequence is an SV40 polyA sequence, a bovine growth hormone polyA sequence (BGHpA), a rabbit ?-globin polyA sequence (rpgpA), variants thereof, or another suitable heterologous or endogenous polyA sequence known in the art.

    [0318] In some embodiments, a polynucleotide or cell harboring the polynucleotide utilizes a suicide gene, including an inducible suicide gene to reduce the risk of direct toxicity and/or uncontrolled proliferation. In specific aspects, the suicide gene is not immunogenic to the host harboring the polynucleotide or cell. A certain example of a suicide gene that may be used is caspase-9 or caspase-8 or cytosine deaminase. Caspase-9 can be activated using a specific chemical inducer of dimerization (CID).

    [0319] In certain embodiments, a polycistronic polynucleotide encoding a fusion protein encoding a TCR is contemplated herein. In some embodiments, a polycistronic polynucleotide encoding a TCR comprising a TCR? polypeptide/chain and a TCR? polypeptide/chain is introduced into a cell. In some embodiments, a polycistronic polynucleotide encoding a TCR comprising a TCR? polypeptide/chain and a TCR? polypeptide/chain is introduced into a cell.

    [0320] In particular embodiments, the polycistronic polynucleotide comprises the TCR? polypeptide/chain 5 to the TCR? polypeptide/chain. In other embodiments, the polycistronic polynucleotide comprises the TCR? polypeptide/chain 5 to the TCR? polypeptide/chain. In other embodiments, the polycistronic polynucleotide comprises the TCR? polypeptide/chain 5 to the TCR? polypeptide/chain. In other embodiments, the polycistronic polynucleotide comprises the TCR? polypeptide/chain 5 to the TCR? polypeptide/chain.

    G. Vectors

    [0321] In particular embodiments, one or more polynucleotides encoding a TCR? polypeptide/chain and a TCR? polypeptide/chain are introduced into a cell (e.g., an immune effector cell) by non-viral or viral vectors.

    [0322] The term vector is used herein to refer to a nucleic acid molecule capable transferring or transporting another nucleic acid molecule. The transferred nucleic acid is generally linked to, e.g., inserted into, the vector nucleic acid molecule. A vector may include sequences that direct autonomous replication in a cell, or may include sequences sufficient to allow integration into host cell DNA. In particular embodiments, non-viral vectors are used to deliver one or more polynucleotides contemplated herein to a T cell.

    [0323] Illustrative examples of non-viral vectors include, but are not limited to mRNA, plasmids (e.g., DNA plasmids or RNA plasmids), transposons, cosmids, and bacterial artificial chromosomes. Other non-viral vectors are discussed above.

    [0324] Illustrative methods of non-viral delivery of polynucleotides contemplated in particular embodiments include, but are not limited to: electroporation, sonoporation, lipofection, microinjection, biolistics, virosomes, liposomes, immunoliposomes, nanoparticles, polycation or lipid:nucleic acid conjugates, naked DNA, artificial virions, DEAE-dextran-mediated transfer, gene gun, and heat-shock.

    [0325] Illustrative examples of non-viral/polynucleotide delivery systems suitable for use in particular embodiments contemplated in particular embodiments include, but are not limited to those provided by Amaxa Biosystems, Maxcyte, Inc., BTX Molecular Delivery Systems, and Copernicus Therapeutics Inc. Lipofection reagents are sold commercially (e.g., Transfectam? and Lipofectin?). Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides have been described in the literature. See e.g., Liu et al. (2003) Gene Therapy. 10:180-187; and Balazs et al. (2011) Journal of Drug Delivery. 2011:1-12. Antibody-targeted, bacterially derived, non-living nanocell-based delivery is also contemplated in particular embodiments.

    [0326] In various embodiments, the polynucleotide is an mRNA that is introduced into a cell in order to transiently express a desired polypeptide. As used herein, transient refers to expression of a non-integrated transgene for a period of hours, days or weeks, wherein the period of time of expression is less than the period of time for expression of the polynucleotide if integrated into the genome or contained within a stable plasmid replicon in the cell.

    [0327] In particular embodiments, viral vectors are used to deliver one or more polynucleotides contemplated herein to a T cell.

    [0328] Viral vectors comprising polynucleotides contemplated in particular embodiments can be delivered in vivo by administration to an individual patient, typically by systemic administration (e.g., intravenous, intraperitoneal, intramuscular, subdermal, or intracranial infusion) or topical application, as described below. Alternatively, vectors can be delivered to cells ex vivo, such as cells explanted from an individual patient (e.g., mobilized peripheral blood, lymphocytes, bone marrow aspirates, tissue biopsy, etc.) or universal donor hematopoietic stem cells, followed by reimplantation of the cells into a patient.

    [0329] In one embodiment, viral vectors comprising nuclease variants and/or donor repair templates are administered directly to an organism for transduction of cells in vivo. Alternatively, naked DNA can be administered. Administration is by any of the routes normally used for introducing a molecule into ultimate contact with blood or tissue cells including, but not limited to, injection, infusion, topical application and electroporation. Suitable methods of administering such nucleic acids are available and well known to those of skill in the art, and, although more than one route can be used to administer a particular composition, a particular route can often provide a more immediate and more effective reaction than another route.

    [0330] Illustrative examples of viral vector systems suitable for use in particular embodiments contemplated in particular embodiments include, but are not limited to adeno-associated virus (AAV), retrovirus, herpes simplex virus, adenovirus, and vaccinia virus vectors.

    [0331] In certain embodiments, a polycistronic polynucleotide encoding a TCR comprising a TCR? polypeptide/chain and a TCR? polypeptide/chain is introduced into a cell by a non-viral or viral vector. In particular embodiments, the polycistronic polynucleotide comprises the TCR? polypeptide/chain 5 to the TCR? polypeptide/chain. In other embodiments, the polycistronic polynucleotide comprises the TCR? polypeptide/chain 5 to the TCR? polypeptide/chain.

    [0332] In some embodiments, a polycistronic polynucleotide encoding a TCR comprising a TCR? polypeptide/chain and a TCR? polypeptide/chain is introduced into a cell by a non-viral or viral vector. In some embodiments, a polycistronic polynucleotide encoding a TCR comprising a TCR? polypeptide/chain and a TCR? polypeptide/chain is introduced into a cell by a non-viral or viral vector.

    [0333] In certain embodiments, the polycistronic polynucleotide comprises the TCR? polypeptide/chain 5 to the TCR? polypeptide/chain. In other embodiments, the polycistronic polynucleotide comprises the TCR? polypeptide/chain 5 to the TCR? polypeptide/chain. In other embodiments, the polycistronic polynucleotide comprises the TCR? polypeptide/chain 5 to the TCR? polypeptide/chain. In other embodiments, the polycistronic polynucleotide comprises the TCR? polypeptide/chain 5 to the TCR? polypeptide/chain.

    [0334] In various embodiments, one or more polynucleotides are introduced into an immune effector cell, e.g., T cell, by transducing the cell with a recombinant adeno-associated virus (rAAV), comprising the one or more polynucleotides.

    [0335] AAV is a small (?26 nm) replication-defective, primarily episomal, non-enveloped virus. AAV can infect both dividing and non-dividing cells and may incorporate its genome into that of the host cell. Recombinant AAV (rAAV) are typically composed of, at a minimum, a transgene and its regulatory sequences, and 5 and 3 AAV inverted terminal repeats (ITRs). The ITR sequences are about 145 bp in length. In particular embodiments, the rAAV comprises ITRs and capsid sequences isolated from AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, or AAV10.

    [0336] In some embodiments, a chimeric rAAV is used the ITR sequences are isolated from one AAV serotype and the capsid sequences are isolated from a different AAV serotype. For example, a rAAV with ITR sequences derived from AAV2 and capsid sequences derived from AAV6 is referred to as AAV2/AAV6. In particular embodiments, the rAAV vector may comprise ITRs from AAV2, and capsid proteins from any one of AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, or AAV10. In a preferred embodiment, the rAAV comprises ITR sequences derived from AAV2 and capsid sequences derived from AAV6. In a preferred embodiment, the rAAV comprises ITR sequences derived from AAV2 and capsid sequences derived from AAV2.

    [0337] In some embodiments, engineering and selection methods can be applied to AAV capsids to make them more likely to transduce cells of interest.

    [0338] Construction of rAAV vectors, production, and purification thereof have been disclosed, e.g., in U.S. Pat. Nos. 9,169,494; 9,169,492; 9,012,224; 8,889,641; 8,809,058; and 8,784,799, each of which is incorporated by reference herein, in its entirety.

    [0339] In various embodiments, one or more polynucleotides are introduced into an immune effector cell, e.g., T cell, by transducing the cell with a retrovirus, e.g., lentivirus, comprising the one or more polynucleotides.

    [0340] As used herein, the term retrovirus refers to an RNA virus that reverse transcribes its genomic RNA into a linear double-stranded DNA copy and subsequently covalently integrates its genomic DNA into a host genome. Illustrative retroviruses suitable for use in particular embodiments, include, but are not limited to: Moloney murine leukemia virus (M-MuLV), Moloney murine sarcoma virus (MoMSV), Harvey murine sarcoma virus (HaMuSV), murine mammary tumor virus (MuMTV), gibbon ape leukemia virus (GaLV), feline leukemia virus (FLV), spumavirus, Friend murine leukemia virus, Murine Stem Cell Virus (MSCV) and Rous Sarcoma Virus (RSV)) and lentivirus.

    [0341] As used herein, the term lentivirus refers to a group (or genus) of complex retroviruses. Illustrative lentiviruses include, but are not limited to: HIV (human immunodeficiency virus; including HIV type 1, and HIV type 2); visna-maedi virus (VMV) virus; the caprine arthritis-encephalitis virus (CAEV); equine infectious anemia virus (EIAV); feline immunodeficiency virus (FIV); bovine immune deficiency virus (BIV); and simian immunodeficiency virus (SIV). In one embodiment, HIV based vector backbones (i.e., HIV cis-acting sequence elements) are preferred.

    [0342] In various embodiments, a lentiviral vector contemplated herein comprises one or more LTRs, and one or more, or all, of the following accessory elements: a cPPT/FLAP, a Psi (?) packaging signal, an export element, poly (A) sequences, and may optionally comprise a WPRE or HPRE, an insulator element, a selectable marker, and a cell suicide gene, as discussed elsewhere herein.

    [0343] In particular embodiments, lentiviral vectors contemplated herein may be integrative or non-integrating or integration defective lentivirus. As used herein, the term integration defective lentivirus or IDLV refers to a lentivirus having an integrase that lacks the capacity to integrate the viral genome into the genome of the host cells. Integration-incompetent viral vectors have been described in patent application WO 2006/010834, which is herein incorporated by reference in its entirety.

    [0344] Illustrative mutations in the HIV-1 pol gene suitable to reduce integrase activity include, but are not limited to: H12N, H12C, H16C, H16V, S81 R, D41A, K42A, H51A, Q53C, D55V, D64E, D64V, E69A, K71A, E85A, E87A, D116N, D1161, D116A, N120G, N1201, N120E, E152G, E152A, D35E, K156E, K156A, E157A, K159E, K159A, K160A, R166A, D167A, E170A, H171A, K173A, K186Q, K186T, K188T, E198A, R199c, R199T, R199A, D202A, K211A, Q214L, Q216L, Q221 L, W235F, W235E, K236S, K236A, K246A, G247W, D253A, R262A, R263A and K264H.

    [0345] In one embodiment, the HIV-1 integrase deficient pol gene comprises a D64V, D116I, D116A, E152G, or E152A mutation; D64V, D116I, and E152G mutations; or D64V, D116A, and E152A mutations.

    [0346] In one embodiment, the HIV-1 integrase deficient pol gene comprises a D64V mutation.

    [0347] The term long terminal repeat (LTR) refers to domains of base pairs located at the ends of retroviral DNAs which, in their natural sequence context, are direct repeats and contain U3, R and U5 regions.

    [0348] As used herein, the term FLAP element or cPPT/FLAP refers to a nucleic acid whose sequence includes the central polypurine tract and central termination sequences (cPPT and CTS) of a retrovirus, e.g., HIV-1 or HIV-2. Suitable FLAP elements are described in U.S. Pat. No. 6,682,907 and in Zennou, et al., 2000, Cell, 101:173. In another embodiment, a lentiviral vector contains a FLAP element with one or more mutations in the cPPT and/or CTS elements. In yet another embodiment, a lentiviral vector comprises either a cPPT or CTS element. In yet another embodiment, a lentiviral vector does not comprise a cPPT or CTS element.

    [0349] As used herein, the term packaging signal or packaging sequence refers to psi [?] sequences located within the retroviral genome which are required for insertion of the viral RNA into the viral capsid or particle, see e.g., Clever et al., 1995. J. of Virology, Vol. 69, No. 4; pp. 2101-2109.

    [0350] The term export element refers to a cis-acting post-transcriptional regulatory element which regulates the transport of an RNA transcript from the nucleus to the cytoplasm of a cell. Examples of RNA export elements include, but are not limited to, the human immunodeficiency virus (HIV) rev response element (RRE) (see e.g., Cullen et al., 1991. J. Virol. 65: 1053; and Cullen et al., 1991. Cell 58: 423), and the hepatitis B virus post-transcriptional regulatory element (HPRE).

    [0351] In particular embodiments, expression of heterologous sequences in viral vectors is increased by incorporating posttranscriptional regulatory elements, efficient polyadenylation sites, and optionally, transcription termination signals into the vectors. A variety of posttranscriptional regulatory elements can increase expression of a heterologous nucleic acid at the protein, e.g., woodchuck hepatitis virus posttranscriptional regulatory element (WPRE; Zufferey et al., 1999, J. Virol., 73:2886); the posttranscriptional regulatory element present in hepatitis B virus (HPRE) (Huang et al., Mol. Cell. Biol., 5:3864); and the like (Liu et al., 1995, Genes Dev., 9:1766).

    [0352] Lentiviral vectors preferably contain several safety enhancements as a result of modifying the LTRs. Self-inactivating (SIN) vectors refers to replication-defective vectors, e.g., retroviral or lentiviral vectors, in which the right (3) LTR enhancer-promoter region, known as the U3 region, has been modified (e.g., by deletion or substitution) to prevent viral transcription beyond the first round of viral replication. Self-inactivation is preferably achieved through in the introduction of a deletion in the U3 region of the 3 LTR of the vector DNA, i.e., the DNA used to produce the vector RNA. Thus, during reverse transcription, this deletion is transferred to the 5 LTR of the proviral DNA. In particular embodiments, it is desirable to eliminate enough of the U3 sequence to greatly diminish or abolish altogether the transcriptional activity of the LTR, thereby greatly diminishing or abolishing the production of full-length vector RNA in transduced cells. In the case of HIV based lentivectors, it has been discovered that such vectors tolerate significant U3 deletions, including the removal of the LTR TATA box (e.g., deletions from ?418 to ?18), without significant reductions in vector titers.

    [0353] An additional safety enhancement is provided by replacing the U3 region of the 5 LTR with a heterologous promoter to drive transcription of the viral genome during production of viral particles. Examples of heterologous promoters which can be used include, for example, viral simian virus 40 (SV40) (e.g., early or late), cytomegalovirus (CMV) (e.g., immediate early), Moloney murine leukemia virus (MoMLV), Rous sarcoma virus (RSV), and herpes simplex virus (HSV) (thymidine kinase) promoters.

    [0354] The terms pseudotype or pseudotyping as used herein, refer to a virus whose viral envelope proteins have been substituted with those of another virus possessing preferable characteristics. For example, HIV can be pseudotyped with vesicular stomatitis virus G-protein (VSV-G) envelope proteins, which allows HIV to infect a wider range of cells because HIV envelope proteins (encoded by the env gene) normally target the virus to CD4.sup.+ presenting cells.

    [0355] In certain embodiments, lentiviral vectors are produced according to known methods. See e.g., Kutner et al., BMC Biotechnol. 2009; 9:10. doi: 10.1186/1472-6750-9-10; Kutner et al. Nat. Protoc. 2009; 4(4):495-505. doi: 10.1038/nprot.2009.22.

    [0356] According to certain specific embodiments contemplated herein, most or all of the viral vector backbone sequences are derived from a lentivirus, e.g., HIV-1. However, it is to be understood that many different sources of retroviral and/or lentiviral sequences can be used, or combined and numerous substitutions and alterations in certain of the lentiviral sequences may be accommodated without impairing the ability of a transfer vector to perform the functions described herein. Moreover, a variety of lentiviral vectors are known in the art, see Naldini et al., (1996a, 1996b, and 1998); Zufferey et al., (1997); Dull et al., 1998, U.S. Pat. Nos. 6,013,516; and 5,994,136, many of which may be adapted to produce a viral vector or transfer plasmid contemplated herein.

    [0357] In various embodiments, one or more polynucleotides are introduced into an immune effector cell, by transducing the cell with an adenovirus comprising the one or more polynucleotides.

    [0358] Adenoviral based vectors are capable of very high transduction efficiency in many cell types and do not require cell division. With such vectors, high titer and high levels of expression have been obtained. This vector can be produced in large quantities in a relatively simple system. Most adenovirus vectors are engineered such that a transgene replaces the Ad E1a, E1b, and/or E3 genes; subsequently the replication defective vector is propagated in human 293 cells that supply deleted gene function in trans. Ad vectors can transduce multiple types of tissues in vivo, including non-dividing, differentiated cells such as those found in liver, kidney and muscle. Conventional Ad vectors have a large carrying capacity.

    [0359] Generation and propagation of the current adenovirus vectors, which are replication deficient, may utilize a unique helper cell line, designated 293, which was transformed from human embryonic kidney cells by Ad5 DNA fragments and constitutively expresses E1 proteins (Graham et al., 1977). Since the E3 region is dispensable from the adenovirus genome (Jones & Shenk, 1978), the current adenovirus vectors, with the help of 293 cells, carry foreign DNA in either the E1, the D3 or both regions (Graham & Prevec, 1991). Adenovirus vectors have been used in eukaryotic gene expression (Levrero et al., 1991; Gomez-Foix et al., 1992) and vaccine development (Grunhaus & Horwitz, 1992; Graham & Prevec, 1992). Studies in administering recombinant adenovirus to different tissues include trachea instillation (Rosenfeld et al., 1991; Rosenfeld et al., 1992), muscle injection (Ragot et al., 1993), peripheral intravenous injections (Herz & Gerard, 1993) and stereotactic inoculation into the brain (Le Gal La Salle et al., 1993). An example of the use of an Ad vector in a clinical trial involved polynucleotide therapy for antitumor immunization with intramuscular injection (Sterman et al., Hum. Gene Ther. 7:1083-9 (1998)).

    [0360] In various embodiments, one or more polynucleotides are introduced into an immune effector cell by transducing the cell with a herpes simplex virus, e.g., HSV-1, HSV-2, comprising the one or more polynucleotides.

    [0361] The mature HSV virion consists of an enveloped icosahedral capsid with a viral genome consisting of a linear double-stranded DNA molecule that is 152 kb. In one embodiment, the HSV based viral vector is deficient in one or more essential or non-essential HSV genes. In one embodiment, the HSV based viral vector is replication deficient. Most replication deficient HSV vectors contain a deletion to remove one or more intermediate-early, early, or late HSV genes to prevent replication. For example, the HSV vector may be deficient in an immediate early gene selected from the group consisting of: ICP4, ICP22, ICP27, ICP47, and a combination thereof. Advantages of the HSV vector are its ability to enter a latent stage that can result in long-term DNA expression and its large viral DNA genome that can accommodate exogenous DNA inserts of up to 25 kb. HSV-based vectors are described in, for example, U.S. Pat. Nos. 5,837,532, 5,846,782, and 5,804,413, and International Patent Applications WO 91/02788, WO 96/04394, WO 98/15637, and WO 99/06583, each of which are incorporated by reference herein in its entirety.

    H. Genetically Modified Cells

    [0362] In various embodiments, cells genetically modified to express an engineered TCR are contemplated herein. In some embodiments, the immune effector cells genetically modified to express an engineered TCR as contemplated herein are used in preparation or manufacture of a medicament for the treatment of cancer.

    [0363] As used herein, the term genetically engineered or genetically modified refers to the addition of extra genetic material in the form of DNA or RNA into the total genetic material in a cell. The terms, genetically modified cells, modified cells, and, redirected cells, are used interchangeably. As used herein, the term gene therapy refers to the introduction of extra genetic material in the form of DNA or RNA into the total genetic material in a cell that restores, corrects, or modifies expression of a gene, or for the purpose of expressing a therapeutic polypeptide, e.g., an engineered TCR.

    [0364] In particular embodiments, a polynucleotide encoding an engineered TCR contemplated herein is introduced into immune effector cells so as express the engineered TCR and to redirect the immune effector cells to target cells expressing a target antigen. An immune effector cell, is any cell of the immune system that has one or more effector functions (e.g., cytotoxic cell killing activity, secretion of cytokines, induction of ADCC and/or CDC). Illustrative immune effector cells contemplated herein are T lymphocytes, including but not limited to cytotoxic T cells (CTLs; CD8.sup.+ T cells), TILs, and helper T cells (HTLs; CD4.sup.+ T cells. In a particular embodiment, the cells comprise ?? T cells. In a particular embodiment, the cells comprise 76 T cells modified to express an ?? TCR. In one embodiment, immune effector cells include natural killer (NK) cells. In one embodiment, immune effector cells include natural killer T (NKT) cells.

    [0365] Immune effector cells can be autologous/autogeneic (self) or non-autologous (non-self, e.g., allogeneic, syngeneic or xenogeneic). Autologous, as used herein, refers to cells from the same subject. Allogeneic, as used herein, refers to cells of the same species that differ genetically to the cell in comparison. Syngeneic, as used herein, refers to cells of a different subject that are genetically identical to the cell in comparison. Xenogeneic, as used herein, refers to cells of a different species to the cell in comparison. In preferred embodiments, the cells are autologous.

    [0366] Illustrative immune effector cells used with the engineered TCRs contemplated in particular embodiments include T lymphocytes. The terms T cell or T lymphocyte are art-recognized and are intended to include thymocytes, immature T lymphocytes, mature T lymphocytes, resting T lymphocytes, or activated T lymphocytes. A T cell can be a T helper (Th) cell, for example a T helper 1 (Th1) or a T helper 2 (Th2) cell. The T cell can be a helper T cell (HTL; CD4.sup.+ T cell) CD4.sup.+ T cell, a cytotoxic T cell (CTL; CD8.sup.+ T cell), CD4.sup.+CD8.sup.+ T cell, CD4.sup.?CD8.sup.? T cell, or any other subset of T cells. Other illustrative populations of T cells suitable for use in particular embodiments include na?ve T cells (T.sub.N), T memory stem cells (T.sub.SCM), central memory T cells (T.sub.CM), effector memory T cells (T.sub.EM), and effector T cells (T.sub.EFF).

    [0367] As would be understood by the skilled person, other cells may also be used as immune effector cells with the engineered TCRs contemplated herein. In particular, immune effector cells also include NK cells, NKT cells, neutrophils, and macrophages. Immune effector cells also include progenitors of effector cells wherein such progenitor cells can be induced to differentiate into an immune effector cells in vivo or in vitro. Thus, in particular embodiments, immune effector cell includes progenitors of immune effectors cells such as hematopoietic stem cells (HSCs) contained within the CD34.sup.+ population of cells derived from cord blood, bone marrow or mobilized peripheral blood which upon administration in a subject differentiate into mature immune effector cells, or which can be induced in vitro to differentiate into mature immune effector cells.

    [0368] The term, CD34.sup.+ cell, as used herein refers to a cell expressing the CD34 protein on its cell surface. CD34, as used herein refers to a cell surface glycoprotein (e.g., sialomucin protein) that often acts as a cell-cell adhesion factor and is involved in T cell entrance into lymph nodes. The CD34.sup.+ cell population contains hematopoietic stem cells (HSC), which upon administration to a patient differentiate and contribute to all hematopoietic lineages, including T cells, NK cells, NKT cells, neutrophils and cells of the monocyte/macrophage lineage.

    [0369] Methods for making the immune effector cells that express an engineered TCR contemplated herein are provided in particular embodiments. In one embodiment, the method comprises transfecting or transducing immune effector cells isolated from an individual such that the immune effector cells express a polynucleotide or polycistronic message encoding an engineered TCR as contemplated herein or a fusion protein encoding an engineered TCR contemplated herein. In particular embodiments, the transduced cells are subsequently cultured for expansion, prior to administration to a subject.

    [0370] In certain embodiments, the immune effector cells are isolated from an individual and genetically modified without further manipulation in vitro. Such cells can then be directly re-administered into the individual. In further embodiments, the immune effector cells are first activated and stimulated to proliferate in vitro prior to being genetically modified to express an engineered TCR contemplated herein. In this regard, the immune effector cells may be cultured before and/or after being genetically modified.

    [0371] In particular embodiments, prior to in vitro manipulation or genetic modification of the immune effector cells described herein, the source of cells is obtained from a subject. In particular embodiments, modified immune effector cells comprise T cells.

    [0372] In particular embodiments, PBMCs may be directly genetically modified to express a polycistronic message encoding an engineered TCR contemplated herein. In certain embodiments, after isolation of PBMC, T lymphocytes are further isolated and in certain embodiments, both cytotoxic and helper T lymphocytes can be sorted into na?ve, memory, and effector T cell subpopulations either before or after genetic modification and/or expansion.

    [0373] The immune effector cells, such as T cells, can be genetically modified following isolation using known methods, or the immune effector cells can be activated and expanded (or differentiated in the case of progenitors) in vitro prior to being genetically modified. In a particular embodiment, the immune effector cells, such as T cells, are activated and stimulated for expansion and then genetically modified with the TCRs contemplated herein (e.g., transduced with a viral vector comprising a nucleic acid encoding a polycistronic message encoding an engineered TCR contemplated herein comprising. In various embodiments, T cells can be activated and expanded before or after genetic modification, using methods as described, for example, in U.S. Pat. Nos. 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7, 175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041; and U.S. Patent Application Publication No. 20060121005.

    [0374] In one embodiment, CD34.sup.+ cells are transduced with a nucleic acid construct contemplated herein. In certain embodiments, the transduced CD34.sup.+ cells differentiate into mature immune effector cells in vivo following administration into a subject, generally the subject from whom the cells were originally isolated. In another embodiment, CD34.sup.+ cells may be stimulated in vitro prior to exposure to or after being genetically modified with one or more of the following cytokines: Flt-3 ligand (FLT3), stem cell factor (SCF), megakaryocyte growth and differentiation factor (TPO), IL-3 and IL-6 according to the methods described previously (Asheuer et al., 2004; Imren, et al., 2004).

    [0375] In particular embodiments, a population of modified immune effector cells for the treatment of cancer comprises an engineered TCR contemplated herein. For example, a population of modified immune effector cells are prepared from peripheral blood mononuclear cells (PBMCs) obtained from a patient diagnosed with B cell malignancy described herein (autologous donors). The PBMCs form a heterogeneous population of T lymphocytes that can be CD4.sup.+, CD8.sup.+, or CD4.sup.+ and CD8.sup.+.

    [0376] The PBMCs also can include other cytotoxic lymphocytes such as NK cells or NKT cells. An expression vector carrying the coding sequence of an engineered TCR contemplated in particular embodiments is introduced into a population of human donor T cells, NK cells or NKT cells. In particular embodiments, successfully transduced T cells that carry the expression vector can be sorted using flow cytometry to isolate CD3 positive T cells and then further propagated to increase the number of these CAR protein expressing T cells in addition to cell activation using anti-CD3 antibodies and or anti-CD28 antibodies and IL-2 or any other methods known in the art as described elsewhere herein. Standard procedures are used for cryopreservation of T cells expressing the CAR protein T cells for storage and/or preparation for use in a human subject. In one embodiment, the in vitro transduction, culture and/or expansion of T cells are performed in the absence of non-human animal derived products such as fetal calf serum and fetal bovine serum. Since a heterogeneous population of PBMCs is genetically modified, the resultant transduced cells are a heterogeneous population of modified cells comprising a BCMA targeting CAR as contemplated herein.

    [0377] In a further embodiment, a mixture of, e.g., one, two, three, four, five or more, different expression vectors can be used in genetically modifying a donor population of immune effector cells wherein each vector encodes a different chimeric antigen receptor protein as contemplated herein. The resulting modified immune effector cells forms a mixed population of modified cells.

    [0378] Genetically engineered cells, including T cells, can be manufactured using various methods known in the art, see, e.g., WO 2016/094304 which is incorporated herein by reference in its entirety.

    I. Compositions and Formulations

    [0379] The compositions contemplated herein may comprise one or more engineered TCR polypeptides, TCR? polypeptides, TCR? polypeptides, TCR? polypeptides, TCR? polypeptides, TCR fusion polypeptides, polynucleotides, vectors comprising same, genetically modified immune effector cells, etc., as contemplated herein. Compositions include, but are not limited to pharmaceutical compositions. In preferred embodiments, a composition comprises one or more cells modified to express an engineered TCR contemplated herein.

    [0380] A pharmaceutical composition refers to a composition formulated in pharmaceutically-acceptable or physiologically-acceptable solutions for administration to a cell or an animal, either alone, or in combination with one or more other modalities of therapy. It will also be understood that, if desired, the compositions may be administered in combination with other agents as well, such as, e.g., cytokines, growth factors, hormones, small molecules, chemotherapeutics, pro-drugs, drugs, antibodies, or other various pharmaceutically-active agents. There is virtually no limit to other components that may also be included in the compositions, provided that the additional agents do not adversely affect the ability of the composition to deliver the intended therapy. In preferred embodiments, a pharmaceutical composition comprises a pharmaceutically acceptable carrier, diluent or excipient, and one or more cells modified to express an engineered TCR as contemplated herein.

    [0381] The phrase pharmaceutically acceptable is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.

    [0382] As used herein pharmaceutically acceptable carrier, diluent or excipient includes without limitation any adjuvant, carrier, excipient, glidant, sweetening agent, diluent, preservative, dye/colorant, flavor enhancer, surfactant, wetting agent, dispersing agent, suspending agent, stabilizer, isotonic agent, solvent, surfactant, or emulsifier which has been approved by the United States Food and Drug Administration as being acceptable for use in humans or domestic animals. Exemplary pharmaceutically acceptable carriers include, but are not limited to, to sugars, such as lactose, glucose and sucrose; starches, such as corn starch and potato starch; cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; tragacanth; malt; gelatin; talc; cocoa butter, waxes, animal and vegetable fats, paraffins, silicones, bentonites, silicic acid, zinc oxide; oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; glycols, such as propylene glycol; polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; esters, such as ethyl oleate and ethyl laurate; agar; buffering agents, such as magnesium hydroxide and aluminum hydroxide; alginic acid; pyrogen-free water; isotonic saline; Ringer's solution; ethyl alcohol; phosphate buffer solutions; and any other compatible substances employed in pharmaceutical formulations.

    [0383] In particular embodiments, formulation of pharmaceutically-acceptable carrier solutions is well-known to those of skill in the art, as is the development of suitable dosing and treatment regimens for using the particular compositions described herein in a variety of treatment regimens, including e.g., enteral and parenteral, e.g., intravascular, intravenous, intrarterial, intrarterial, intraosseously, intraventricular, intracerebral, intracranial, intraspinal, intrathecal, and intramedullary administration and formulation. It would be understood by the skilled artisan that particular embodiments contemplated herein may comprise other formulations, such as those that are well known in the pharmaceutical art, and are described, for example, in Remington: The Science and Practice of Pharmacy, volume I and volume II. 22.sup.nd Edition. Edited by Loyd V. Allen Jr. Philadelphia, PA: Pharmaceutical Press; 2012, which is incorporated by reference herein, in its entirety.

    [0384] In particular embodiments, compositions comprise an amount of immune effector cells expressing an engineered TCR contemplated herein. As used herein, the term amount refers to an amount effective or an effective amount of a genetically modified therapeutic cell, e.g., T cell, to achieve a beneficial or desired prophylactic or therapeutic result, including clinical results.

    [0385] A prophylactically effective amount refers to an amount of a genetically modified therapeutic cells effective to achieve the desired prophylactic result. Typically, but not necessarily, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount is less than the therapeutically effective amount.

    [0386] A therapeutically effective amount of a genetically modified therapeutic cell may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the stem and progenitor cells to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the virus or transduced therapeutic cells are outweighed by the therapeutically beneficial effects. The term therapeutically effective amount includes an amount that is effective to treat a subject (e.g., a patient). When a therapeutic amount is indicated, the precise amount of the compositions to be administered can be determined by a physician with consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject).

    [0387] It can generally be stated that a pharmaceutical composition comprising the T cells described herein may be administered at a dosage of 10.sup.6 to 10.sup.13 cells/kg body weight, preferably 10.sup.8 to 10.sup.13 cells/kg body weight, including all integer values within those ranges. The number of cells will depend upon the ultimate use for which the composition is intended as will the type of cells included therein. For uses provided herein, the cells are generally in a volume of a liter or less, can be 500 mLs or less, even 250 mLs or 100 mLs or less. Hence the density of the desired cells is typically greater than 10.sup.6 cells/ml and generally is greater than 10.sup.7 cells/ml, generally 10.sup.8 cells/ml or greater. The clinically relevant number of immune cells can be apportioned into multiple infusions that cumulatively equal or exceed 10.sup.6, 10.sup.7, 10.sup.8, 10.sup.9, 10.sup.10, 10.sup.11, 10.sup.12 or 10.sup.13 cells. Compositions may be administered multiple times at dosages within these ranges. The cells may be allogeneic, syngeneic, xenogeneic, or autologous to the patient undergoing therapy. If desired, the treatment may also include administration of mitogens (e.g., PHA) or lymphokines, cytokines, and/or chemokines (e.g., IFN-?, IL-2, IL-12, TNF-alpha, IL-18, and TNF-beta, GM-CSF, IL-4, IL-13, Flt3-L, RANTES, MIP1?, etc.) as contemplated herein to enhance induction of the immune response.

    [0388] Generally, compositions comprising the cells activated and expanded as contemplated herein may be utilized in the treatment and prevention of diseases that arise in individuals who are immunocompromised. In particular embodiments, compositions comprising immune effector cells modified to express an engineered TCR contemplated herein are used in the treatment of cancer. The modified immune effector cells may be administered either alone, or as a pharmaceutical composition in combination with carriers, diluents, excipients, and/or with other components such as IL-2 or other cytokines or cell populations. In particular embodiments, pharmaceutical compositions comprise an amount of genetically modified T cells, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients.

    [0389] Pharmaceutical compositions comprising an immune effector cell population modified to express an engineered TCR (e.g., T cells), may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives.

    [0390] Compositions are preferably formulated for parenteral administration, e.g., intravascular (intravenous or intraarterial), intraperitoneal or intramuscular administration.

    [0391] The liquid pharmaceutical compositions, whether they be solutions, suspensions or other like form, may include one or more of the following: sterile diluents such as water for injection, saline solution, preferably physiological saline, Ringer's solution, or isotonic sodium chloride, fixed oils such as synthetic mono or diglycerides which may serve as the solvent or suspending medium, polyethylene glycols, glycerin, propylene glycol or other solvents; antibacterial agents such as benzyl alcohol or methyl paraben; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic. An injectable pharmaceutical composition is preferably sterile.

    [0392] In one embodiment, the T cell compositions contemplated herein are formulated in a pharmaceutically acceptable cell culture medium. Such compositions are suitable for administration to human subjects. In particular embodiments, the pharmaceutically acceptable cell culture medium is a serum free medium.

    [0393] Serum-free medium has several advantages over serum containing medium, including a simplified and better-defined composition, a reduced degree of contaminants, elimination of a potential source of infectious agents, and lower cost. In various embodiments, the serum-free medium is animal-free, and may optionally be protein-free. Optionally, the medium may contain biopharmaceutically acceptable recombinant proteins. Animal-free medium refers to medium wherein the components are derived from non-animal sources. Recombinant proteins replace native animal proteins in animal-free medium and the nutrients are obtained from synthetic, plant or microbial sources. Protein-free medium, in contrast, is defined as substantially free of protein.

    [0394] Illustrative examples of serum-free media used in particular compositions includes, but is not limited to QBSF-60 (Quality Biological, Inc.), StemPro-34 (Life Technologies), and X-VIVO 10.

    [0395] In one preferred embodiment, compositions comprising immune effector cells contemplated herein are formulated in a solution comprising PlasmaLyte A.

    [0396] In another preferred embodiment, compositions comprising immune effector cells contemplated herein are formulated in a solution comprising a cryopreservation medium. For example, cryopreservation media with cryopreservation agents may be used to maintain a high cell viability outcome post-thaw. Illustrative examples of cryopreservation media used in particular compositions includes, but is not limited to, CryoStor CS10, CryoStor CS5, and CryoStor CS2.

    [0397] In a more preferred embodiment, compositions comprising immune effector cells contemplated herein are formulated in a solution comprising 50:50 PlasmaLyte A to CryoStor CS10.

    [0398] In a particular embodiment, compositions comprise an effective amount of genome edited immune effector cells modified to express an engineered TCR contemplated herein. Thus, the immune effector cell compositions may be administered alone or in combination with other known cancer treatments, such as radiation therapy, chemotherapy, transplantation, immunotherapy, hormone therapy, photodynamic therapy, etc. The compositions may also be administered in combination with antibiotics. Such therapeutic agents may be accepted in the art as a standard treatment for a particular disease state as described herein, such as a particular cancer. Exemplary therapeutic agents contemplated in particular embodiments include cytokines, growth factors, steroids, NSAIDs, DMARDs, anti-inflammatories, chemotherapeutics, radiotherapeutics, therapeutic antibodies, or other active and ancillary agents.

    [0399] In certain embodiments, compositions comprising genome edited immune effector cells modified to express an engineered TCR contemplated herein may be administered in conjunction with any number of chemotherapeutic agents. A variety of other therapeutic agents may be used in conjunction with the compositions contemplated herein. In one embodiment, the composition comprising immune effector cells expressing an engineered TCR is administered with an anti-inflammatory agent.

    [0400] In particular embodiments, a composition comprising immune effector modified to express an engineered TCR contemplated herein is administered with a therapeutic antibody (e.g., mono or bispecific antibody or fragment thereof) and/or an immune cell engager (NK engager). Illustrative examples of therapeutic antibodies suitable for combination with the CAR modified T cells contemplated in particular embodiments, include but are not limited to, atezolizumab, avelumab, bavituximab, bevacizumab (avastin), bivatuzumab, blinatumomab, conatumumab, crizotinib, daratumumab, duligotumab, dacetuzumab, dalotuzumab, durvalumab, elotuzumab (HuLuc63), gemtuzumab, ibritumomab, indatuximab, inotuzumab, ipilimumab, lorvotuzumab, lucatumumab, milatuzumab, moxetumomab, nivolumab, ocaratuzumab, ofatumumab, pembrolizumab, rituximab, siltuximab, teprotumumab, and ublituximab.

    J. Therapeutic Methods

    [0401] The genetically modified immune effector cells expressing an engineered TCR contemplated herein provide improved methods of adoptive immunotherapy for use in the prevention, treatment, and amelioration cancers or for preventing, treating, or ameliorating at least one symptom associated with cancer.

    [0402] In various embodiments, the genetically modified immune effector cells contemplated herein provide improved methods of adoptive immunotherapy for use in increasing the cytotoxicity in cancer cells in a subject or for use in decreasing the number of cancer cells in a subject.

    [0403] In particular embodiments, the specificity of a primary immune effector cell is redirected to cells expressing a particular antigen, e.g., cancer cells, by genetically modifying the primary immune effector cell with an engineered TCR as contemplated herein. In various embodiments, a viral vector is used to genetically modify an immune effector cell with a particular polynucleotide encoding an engineered TCR. In some embodiments, the engineered TCR comprises (a) a TCR? polypeptide comprising a TCR? variable domain; (b) a TCR? polypeptide comprising a TCR? variable domain; and (c) one or more antigen-binding domains linked to the TCR? variable domain and/or TCR? variable domain. In some embodiments, the engineered TCR comprises (a) a TCR? polypeptide comprising a TCR? variable domain; (b) a TCR? polypeptide comprising a TCR? variable domain; and (c) one or more antigen-binding domains linked to the TCR? variable domain and/or TCR? variable domain. In certain embodiments, the linker is a polypeptide linker. In particular embodiments, the polypeptide linker comprises an amino acid sequence as set forth in any one or more of SEQ ID NOs: 33-53.

    [0404] In one embodiment, a type of cellular therapy where T cells are genetically modified to express an engineered TCR contemplated herein are infused to a recipient in need thereof is provided. The infused cell is able to kill disease causing cells in the recipient. Unlike antibody therapies, T cell therapies are able to replicate in vivo resulting in long-term persistence that can lead to sustained cancer therapy.

    [0405] In one embodiment, T cells that express an engineered TCR contemplated herein can undergo robust in vivo T cell expansion and can persist for an extended amount of time. In another embodiment, T cells that express an engineered TCR contemplated herein evolve into specific memory T cells or stem cell memory T cells that can be reactivated to inhibit any additional tumor formation or growth.

    [0406] In particular embodiments, modified immune effector cells that express an engineered TCR contemplated herein are used in the treatment of solid tumors or cancers.

    [0407] In particular embodiments, the modified immune effector cells contemplated herein are used in the treatment of solid tumors or cancers including, but not limited to: adrenal cancer, adrenocortical carcinoma, anal cancer, appendix cancer, astrocytoma, atypical teratoid/rhabdoid tumor, basal cell carcinoma, bile duct cancer, bladder cancer, bone cancer, brain/CNS cancer, breast cancer, bronchial tumors, cardiac tumors, cervical cancer, cholangiocarcinoma, chondrosarcoma, chordoma, colon cancer, colorectal cancer, craniopharyngioma, ductal carcinoma in situ (DCIS) endometrial cancer, ependymoma, esophageal cancer, esthesioneuroblastoma, Ewing's sarcoma, extracranial germ cell tumor, extragonadal germ cell tumor, eye cancer, fallopian tube cancer, fibrous histiosarcoma, fibrosarcoma, gallbladder cancer, gastric cancer, gastrointestinal carcinoid tumors, gastrointestinal stromal tumor (GIST), germ cell tumors, glioma, glioblastoma, head and neck cancer, hemangioblastoma, hepatocellular cancer, hypopharyngeal cancer, intraocular melanoma, kaposi sarcoma, kidney cancer, laryngeal cancer, leiomyosarcoma, lip cancer, liposarcoma, liver cancer, lung cancer, non-small cell lung cancer, lung carcinoid tumor, malignant mesothelioma, medullary carcinoma, medulloblastoma, menangioma, melanoma, Merkel cell carcinoma, midline tract carcinoma, mouth cancer, myxosarcoma, myelodysplastic syndrome, myeloproliferative neoplasms, nasal cavity and paranasal sinus cancer, nasopharyngeal cancer, neuroblastoma, oligodendroglioma, oral cancer, oral cavity cancer, oropharyngeal cancer, osteosarcoma, ovarian cancer, pancreatic cancer, pancreatic islet cell tumors, papillary carcinoma, paraganglioma, parathyroid cancer, penile cancer, pharyngeal cancer, pheochromocytoma, pinealoma, pituitary tumor, pleuropulmonary blastoma, primary peritoneal cancer, prostate cancer, rectal cancer, retinoblastoma, renal cell carcinoma, renal pelvis and ureter cancer, rhabdomyosarcoma, salivary gland cancer, sebaceous gland carcinoma, skin cancer, soft tissue sarcoma, squamous cell carcinoma, small cell lung cancer, small intestine cancer, stomach cancer, sweat gland carcinoma, synovioma, testicular cancer, throat cancer, thymus cancer, thyroid cancer, urethral cancer, uterine cancer, uterine sarcoma, vaginal cancer, vascular cancer, vulvar cancer, and Wilms Tumor.

    [0408] In particular embodiments, the modified immune effector cells contemplated herein are used in the treatment of solid tumors or cancers including, without limitation, non-small cell lung carcinoma, head and neck squamous cell carcinoma, colorectal cancer, pancreatic cancer, breast cancer, thyroid cancer, bladder cancer, cervical cancer, esophageal cancer, ovarian cancer, gastric cancer endometrial cancer, gliomas, glioblastomas, and oligodendroglioma.

    [0409] In particular embodiments, the modified immune effector cells contemplated herein are used in the treatment of solid tumors or cancers including, without limitation, non-small-cell lung cancer, metastatic colorectal cancer, glioblastoma, head and neck cancer, pancreatic cancer, and breast cancer.

    [0410] In particular embodiments, the modified immune effector cells contemplated herein are used in the treatment of glioblastoma.

    [0411] In particular embodiments, the modified immune effector cells that express an engineered TCR contemplated herein are used in the treatment of liquid cancers or hematological cancers.

    [0412] In particular embodiments, the modified immune effector cells contemplated herein are used in the treatment of B-cell malignancies, including but not limited to: leukemias, lymphomas, and multiple myeloma.

    [0413] In particular embodiments, the modified immune effector cells contemplated herein are used in the treatment of liquid cancers including, but not limited to leukemias, lymphomas, and multiple myelomas: acute lymphocytic leukemia (ALL), acute myeloid leukemia (AML), myeloblastic, promyelocytic, myelomonocytic, monocytic, erythroleukemia, hairy cell leukemia (HCL), chronic lymphocytic leukemia (CLL), and chronic myeloid leukemia (CML), chronic myelomonocytic leukemia (CMML) and polycythemia vera, Hodgkin lymphoma, nodular lymphocyte-predominant Hodgkin lymphoma, Burkitt lymphoma, small lymphocytic lymphoma (SLL), diffuse large B-cell lymphoma, follicular lymphoma, immunoblastic large cell lymphoma, precursor B-lymphoblastic lymphoma, mantle cell lymphoma, marginal zone lymphoma, mycosis fungoides, anaplastic large cell lymphoma, S?zary syndrome, precursor T-lymphoblastic lymphoma, multiple myeloma, overt multiple myeloma, smoldering multiple myeloma, plasma cell leukemia, non-secretory myeloma, IgD myeloma, osteosclerotic myeloma, solitary plasmacytoma of bone, and extramedullary plasmacytoma.

    [0414] In certain embodiments, the liquid or hematological cancer is selected from the group consisting of: acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL), hairy cell leukemia (HCL), multiple myeloma (MM), acute myeloid leukemia (AML), or chronic myeloid leukemia (CML).

    [0415] In preferred embodiments, the liquid or hematological cancer is multiple myeloma (MM).

    [0416] In preferred embodiments, the liquid or hematological cancer is relapsed/refractory multiple myeloma (MM).

    [0417] In particular embodiments, the modified immune effector cells contemplated herein are used in the treatment of acute myeloid leukemia (AML).

    [0418] In particular embodiments, the modified immune effector cells contemplated herein are used in the treatment of lymphoma (e.g., non-hogkin's lymphoma or DLBCL).

    [0419] As used herein, the terms individual and subject are often used interchangeably and refer to any animal that exhibits a symptom of a disease, disorder, or condition that can be treated with the gene therapy vectors, cell-based therapeutics, and methods contemplated elsewhere herein. In preferred embodiments, a subject includes any animal that exhibits symptoms of a disease, disorder, or condition related to cancer that can be treated with the gene therapy vectors, cell-based therapeutics, and methods contemplated elsewhere herein. Suitable subjects (e.g., patients) include laboratory animals (such as mouse, rat, rabbit, or guinea pig), farm animals, and domestic animals or pets (such as a cat or dog). Non-human primates and, preferably, human patients, are included.

    [0420] As used herein, the term patient refers to a subject that has been diagnosed with a particular disease, disorder, or condition that can be treated with the gene therapy vectors, cell-based therapeutics, and methods disclosed elsewhere herein.

    [0421] As used herein treatment or treating, includes any beneficial or desirable effect on the symptoms or pathology of a disease or pathological condition, and may include even minimal reductions in one or more measurable markers of the disease or condition being treated. Treatment can involve optionally either the reduction the disease or condition, or the delaying of the progression of the disease or condition. Treatment does not necessarily indicate complete eradication or cure of the disease or condition, or associated symptoms thereof.

    [0422] As used herein, prevent, and similar words such as prevented, preventing etc., indicate an approach for preventing, inhibiting, or reducing the likelihood of the occurrence or recurrence of, a disease or condition. It also refers to delaying the onset or recurrence of a disease or condition or delaying the occurrence or recurrence of the symptoms of a disease or condition. As used herein, prevention and similar words also includes reducing the intensity, effect, symptoms and/or burden of a disease or condition prior to onset or recurrence of the disease or condition.

    [0423] As used herein, the phrase ameliorating at least one symptom of refers to decreasing one or more symptoms of the disease or condition for which the subject is being treated. In particular embodiments, the disease or condition being treated is a cancer, wherein the one or more symptoms ameliorated include, but are not limited to, weakness, fatigue, shortness of breath, easy bruising and bleeding, frequent infections, enlarged lymph nodes, distended or painful abdomen (due to enlarged abdominal organs), bone or joint pain, fractures, unplanned weight loss, poor appetite, night sweats, persistent mild fever, and decreased urination (due to impaired kidney function).

    [0424] By enhance or promote, or increase or expand refers generally to the ability of a composition contemplated herein, e.g., genetically modified T cells that express an engineered TCR contemplated herein, to produce, elicit, or cause a greater physiological response (i.e., downstream effects) compared to the response caused by either vehicle or a control molecule/composition. A measurable physiological response may include an increase in T cell expansion, activation, persistence, and/or an increase in cancer cell killing ability, among others apparent from the understanding in the art and the description herein. An increased or enhanced amount is typically a statistically significant amount, and may include an increase that is 1.1, 1.2, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30 or more times (e.g., 500, 1000 times) (including all integers and decimal points in between and above 1, e.g., 1.5, 1.6, 1.7. 1.8, etc.) the response produced by vehicle or a control composition.

    [0425] By decrease or lower, or lessen, or reduce, or abate refers generally to the ability of composition contemplated herein to produce, elicit, or cause a lesser physiological response (i.e., downstream effects) compared to the response caused by either vehicle or a control molecule/composition. A decrease or reduced amount is typically a statistically significant amount, and may include an decrease that is 1.1, 1.2, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30 or more times (e.g., 500, 1000 times) (including all integers and decimal points in between and above 1, e.g., 1.5, 1.6, 1.7. 1.8, etc.) the response (reference response) produced by vehicle, a control composition, or the response in a particular cell lineage.

    [0426] By maintain, or preserve, or maintenance, or no change, or no substantial change, or no substantial decrease refers generally to the ability of a composition contemplated herein to produce, elicit, or cause a similar physiological response (i.e., downstream effects) in a cell, as compared to the response caused by either vehicle, a control molecule/composition, or the response in a particular cell lineage. A comparable response is one that is not significantly different or measurable different from the reference response.

    [0427] In one embodiment, a method of treating cancer in a subject in need thereof comprises administering an effective amount, e.g., therapeutically effective amount of a composition comprising genetically modified immune effector cells contemplated herein. The quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.

    [0428] In one embodiment, the amount of immune effector cells, e.g., T cells that express an engineered TCR, in the composition administered to a subject is at least 1?10.sup.7 cells, at least 0.5?10.sup.8 cells, at least 1?10.sup.8 cells, at least 0.5?10.sup.9 cells, at least 1?10.sup.9 cells, at least 1?10.sup.10 cells, at least 1?10.sup.11 cells, at least 1?10.sup.12 cells, at least 5?10.sup.12 cells, or at least 1?10.sup.13 cells.

    [0429] In particular embodiments, about 1?10.sup.7 T cells to about 1?10.sup.13 T cells, about 1?10.sup.8 T cells to about 1?10.sup.13 T cells, about 1?10.sup.9 T cells to about 1?10.sup.13 T cells, about 1?10.sup.10 T cells to about 1?10.sup.13 T cells, about 1?10.sup.11 T cells to about 1?10.sup.13 T cells, or about 1?10.sup.12 T cells to about 1?10.sup.13 T cells are administered to a subject.

    [0430] In one embodiment, the amount of immune effector cells, e.g., T cells that express an engineered TCR, in the composition administered to a subject is at least 0.1?10.sup.4 cells/kg of bodyweight, at least 0.5?10.sup.4 cells/kg of bodyweight, at least 1?10.sup.4 cells/kg of bodyweight, at least 5?10.sup.4 cells/kg of bodyweight, at least 1?10.sup.5 cells/kg of bodyweight, at least 0.5?10.sup.6 cells/kg of bodyweight, at least 1?10.sup.6 cells/kg of bodyweight, at least 0.5?10.sup.7 cells/kg of bodyweight, at least 1?10.sup.7 cells/kg of bodyweight, at least 0.5?10.sup.8 cells/kg of bodyweight, at least 1?10.sup.8 cells/kg of bodyweight, at least 2?10.sup.8 cells/kg of bodyweight, at least 3?10.sup.8 cells/kg of bodyweight, at least 4?10.sup.8 cells/kg of bodyweight, at least 5?10.sup.8 cells/kg of bodyweight, or at least 1?10.sup.9 cells/kg of bodyweight.

    [0431] In particular embodiments, about 1?10.sup.6 T cells/kg of bodyweight to about 1?10.sup.8 T cells/kg of bodyweight, about 2?10.sup.6 T cells/kg of bodyweight to about 0.9?10.sup.8 T cells/kg of bodyweight, about 3?10.sup.6 T cells/kg of bodyweight to about 0.8?10.sup.8 T cells/kg of bodyweight, about 4?10.sup.6 T cells/kg of bodyweight to about 0.7?10.sup.8 T cells/kg of bodyweight, about 5?10.sup.6 T cells/kg of bodyweight to about 0.6?10.sup.8 T cells/kg of bodyweight, or about 5?10.sup.6 T cells/kg of bodyweight to about 0.5?10.sup.8 T cells/kg of bodyweight are administered to a subject.

    [0432] One of ordinary skill in the art would recognize that multiple administrations of the compositions contemplated herein may be required to effect the desired therapy. For example a composition may be administered 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more times over a span of 1 week, 2 weeks, 3 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 1 year, 2 years, 5, years, 10 years, or more.

    [0433] In certain embodiments, it may be desirable to administer activated immune effector cells to a subject and then subsequently redraw blood (or have an apheresis performed), activate immune effector cells therefrom, and reinfuse the patient with these activated and expanded immune effector cells. This process can be carried out multiple times every few weeks. In certain embodiments, immune effector cells can be activated from blood draws of from 10 cc to 400 cc. In certain embodiments, immune effector cells are activated from blood draws of 20 cc, 30 cc, 40 cc, 50 cc, 60 cc, 70 cc, 80 cc, 90 cc, 100 cc, 150 cc, 200 cc, 250 cc, 300 cc, 350 cc, or 400 cc or more. Not to be bound by theory, using this multiple blood draw/multiple reinfusion protocol may serve to select out certain populations of immune effector cells.

    [0434] The administration of the compositions contemplated herein may be carried out in any convenient manner, including by aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation. In a preferred embodiment, compositions are administered parenterally. The phrases parenteral administration and administered parenterally as used herein refers to modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravascular, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intratumoral, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal and intrasternal injection and infusion. In one embodiment, the compositions contemplated herein are administered to a subject by direct injection into a tumor, lymph node, or site of infection.

    [0435] In one embodiment, a subject in need thereof is administered an effective amount of a composition to increase a cellular immune response to a B cell related condition in the subject. The immune response may include cellular immune responses mediated by cytotoxic T cells capable of killing infected cells, regulatory T cells, and helper T cell responses. Humoral immune responses, mediated primarily by helper T cells capable of activating B cells thus leading to antibody production, may also be induced. A variety of techniques may be used for analyzing the type of immune responses induced by the compositions, which are well described in the art; e.g., Current Protocols in Immunology, Edited by: John E. Coligan, Ada M. Kruisbeek, David H. Margulies, Ethan M. Shevach, Warren Strober (2001) John Wiley & Sons, NY, N.Y.

    [0436] In one embodiment, a method of treating a subject diagnosed with a cancer is provided comprising removing immune effector cells from the subject, genetically modifying said immune effector cells with a vector comprising a nucleic acid encoding an engineered TCR contemplated herein, thereby producing a population of modified immune effector cells, and administering the population of modified immune effector cells to the same subject. In a preferred embodiment, the immune effector cells comprise T cells.

    [0437] In certain embodiments, methods for stimulating an immune effector cell mediated immune modulator response to a target cell population in a subject are provided comprising the steps of administering to the subject an immune effector cell population expressing a nucleic acid construct encoding an engineered TCR contemplated herein.

    [0438] The methods for administering the cell compositions contemplated in particular embodiments includes any method which is effective to result in reintroduction of ex vivo genetically modified immune effector cells that either directly express an engineered TCR contemplated herein in the subject or on reintroduction of the genetically modified progenitors of immune effector cells that on introduction into a subject differentiate into mature immune effector cells that express the TCR. One method comprises transducing peripheral blood T cells ex vivo with a nucleic acid construct contemplated herein and returning the transduced cells into the subject.

    [0439] All publications, patent applications, and issued patents cited in this specification are herein incorporated by reference as if each individual publication, patent application, or issued patent were specifically and individually indicated to be incorporated by reference.

    [0440] Although the foregoing embodiments have been described in some detail by way of illustration and example for purposes of clarity of understanding, it will be readily apparent to one of ordinary skill in the art in light of the teachings contemplated herein that certain changes and modifications may be made thereto without departing from the spirit or scope of the appended claims. The following examples are provided by way of illustration only and not by way of limitation. Those of skill in the art will readily recognize a variety of noncritical parameters that could be changed or modified to yield essentially similar results.

    TABLE-US-00003 SEQUENCELISTING SEQ ID NO NAME SEQUENCE 1 anti-BCMA.1scFV DIVLTQSPPSLAMSLGKRATISCRASESVTILGSHLIHWYQQKP GQPPTLLIQLASNVQTGVPARFSGSGSRTDFTLTIDPVEEDDVA VYYCLQSRTIPRTFGGGTKLEIKGSTSGSGKPGSGEGSTKGQIQ LVQSGPELKKPGETVKISCKASGYTFTDYSINWVKRAPGKGLKW MGWINTETREPAYAYDFRGRFAFSLETSASTAYLQINNLKYEDT ATYFCALDYSYAMDYWGQGTSVTVSS 2 anti-BCMA.2scFV DIVLTQSPASLAVSLGERATINCRASESVSVIGAHLIHWYQQKP GQPPKLLIYLASNLETGVPARFSGSGSGTDFTLTISSLQAEDAA IYYCLQSRIFPRTFGQGTKLEIKGSTSGSGKPGSGEGSTKGQVQ LVQSGSELKKPGASVKVSCKASGYTFTDYSINWVRQAPGQGLEW MGWINTETREPAYAYDFRGRFVFSLDTSVSTAYLQISSLKAEDT AVYYCARDYSYAMDYWGQGTLVTVSS 3 anti-BCMA.3scFV DIQMTQSPSSLSASVGDRITITCRASQDIRNYLGWYQQKPGKAP KVLIFAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYC LQDYIYPWTFAQGTKVEIKGGGGSGGGGSGGGGSQVQLVESGGG VVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYD GRNKNYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR EGEATYYDILTGPFDYWGQGTLVTVSS 4 anti-CD19scFV DIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTV KLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFC QQGNTLPYTFGGGTKLEITGGGGSGGGGSGGGGSEVKLQESGPG LVAPSQSLSVTCTVSGVSLPDYGVSWIRQPPRKGLEWLGVIWGS ETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAKH YYYGGSYAMDYWGQGTSVTVSS 5 anti-CD20.1scFV EVQLQQSGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGQG LEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTS EDSADYYCARSNYYGSSYWFFDVWGAGTTVTVSSGGGGSGGGGS GGGGSDIVLTQSPAILSASPGEKVTMTCRASSSVNYMDWYQKKP GSSPKPWIYATSNLASGVPARFSGSGSGTSYSLTISRVEAEDAA TYYCQQWSFNPPTFGGGTKLEIK 6 anti-CD20.2scFV QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRG LEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTS EDSAVYYCARSTYYGGDWYFNVWGAGTTVTVSAGGGGGGGGSG GGGSQIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPG SSPKPWIYATSNLASGVPVRFSGSGSGTSYSLTISRVEAEDAAT YYCQQWTSNPPTFGGGTKLEIKR 7 anti-CD20.3scFV QVQLVQSGAEVKKPGSSVKVSCKASGYAFSYSWINWVRQAPGQG LEWMGRIFPGDGDTDYNGKFKGRVTITADKSTSTAYMELSSLRS EDTAVYYCARNVFDGYWLVYWGQGTLVTVSSGGGGSGGGGSGGG GSDIVMTQTPLSLPVTPGEPASISCRSSKSLLHSNGITYLYWYL QKPGQSPQLLIYQMSNLVSGVPDRFSGSGSGTDFTLKISRVEAE DVGVYYCAQNLELPYTFGGGTKVEIKRTV 8 anti-CD22scFV QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPS RGLEWLGRTYYRSKWYNDYAVSVKSRITINPDTSKNQFSLQLNS VTPEDTAVYYCAREVTGDLEDAFDIWGQGTMVTVSSGGGGSDIQ MTQSPSSLSASVGDRVTITCRASQTIWSYLNWYQQRPGKAPNLL IYAASSLQSGVPSRFSGRGSGTDFTLTISSLQAEDFATYYCQQS YSIPQTFGQGTKLEIK 9 anti-CD33scFV EIVLTQSPGSLAVSPGERVTMSCKSSQSVFFSSSQKNYLAWYQQ IPGQSPRLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQPED LAIYYCHQYLSSRTFGQGTKLEIKGGGGSGGGGSGGGGSQVQLQ QPGAEVVKPGASVKMSCKASGYTFTSYYIHWIKQTPGQGLEWVG VIYPGNDDISYNQKFQGKATLTADKSSTTAYMQLSSLTSEDSAV YYCAREVRLRYFDVWGQGTTVTVSS 10 anti-CD79AscFV DVLMTQIPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQK PGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDL GVYYCFQGSHVPFTFGSGTKLEIKRGGGGSGGGGSGGGGSQVQL QQSGPELVKPGASVKISCKASGYTFSTSWMNWVKQRPGQGLEWI GRIYPGDGDTNYNGKFKGKATLTADKSSNTAYMQLSSLTSVDSA VYFCERFYYGNTFAMDYWGQGTSVTVSS 11 anti-CD79B.1 QIQLVQSGPELKKPGETVKISCKASGYTFTDYSMHWVKQAPGEG scFV LKWMGWINTETGEPTYADDFKGRFAFSLETSASTAYLQINNLKN EDTATYFCYYGSYWGQGTLVTVSAGGGGSGGGGSGGGGSDIVLT QSPASLAVSLGQRATISCKASQSVDYDGDGYMDWYQQKPGQPPK LLIFAASNLKSGIPARFSGSGSGTDFTLNIHPVEEEDAATYYCQ QTNEYPWTFGGGTKLEIK 12 anti-CD79B.2 DIQLTQSPSSLSASVGDRVTITCKASQSVDYEGDSFLNWYQQKP scFV GKAPKLLIYAASNLESGVPSRFSGSGSGTDFTLTISSLQPEDFA TYYCQQSNEDPLTFGQGTKVEIKRGGGGSGGGGSGGGGSEVQLV ESGGGLVQPGGSLRLSCAASGYTFSSYWIEWVRQAPGKGLEWIG EILPGGGDTNYNEIFKGRATFSADTSKNTAYLQMNSLRAEDTAV YYCTRRVPIRLDYWGQGTLVTVSS 13 anti-B7H3scFV DIVMTQSHKFMSTSIGARVSITCKASQDVRTAVAWYQQKPGQSP KLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYC QQHYGTPPWTFGGGTKLEIKGGGGSGGGGSGGGGSEVQLVESGG GLVKPGGSLKLSCEASRFTFSSYAMSWVRQTPEKRLEWVAAISG GGRYTYYPDSMKGRFTISRDNAKNFLYLQMSSLRSEDTAMYYCA RHYDGYLDYWGQGTTLTVSSTR 14 anti-Muc16scFV VKLQESGGGFVKPGGSLKVSCAASGFTFSSYAMSWVRLSPEMRL EWVATISSAGGYIFYSDSVQGRFTISRDNAKNTLHLQMGSLRSG DTAMYYCARQGFGNYGDYYAMDYWGQGTTVTVSSGGGGSGGGGS GGGGSDIELTQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNQL AWYQQKPGQSPELLIYWASTRQSGVPDRFTGSGSGTDFTLTISS VQAEDLAVYYCQQSYNLLTFGPGTKLEVKR 15 anti-HER2scFV DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAP KLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYC QQHYTTPPTFGQGTKVEIKGSTSGSGKPGSGEGSGEVQLVESGG GLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYP TNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCS RWGGDGFYAMDVWGQGTLVTVSS 16 anti-EGFRscFV DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSP RLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYC QQNNNWPTTFGAGTKLELKGGGGSGGGGSGGGGSQVQLKQSGPG LVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSG GNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARA LTYYDYEFAYWGQGTLVTVSS 17 anti-FN-EDBscFV EVQLLESGGGLVQPGGSLRLSCAASGFTFSSFSMSWVRQAPGKG LEWVSSISGSSGTTYYADSVKGRFTISRDNSKNTLYLQMNSLRA EDTAVYYCAKPFPYFDYWGQGTLVTVSSGDGSSGGSGGASEIVL TQSPGTLSLSPGERATLSCRASQSVSSSFLAWYQQKPGQAPRLL IYYASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQT GRIPPTFGQGTKVEIK 18 anti-CLDN18.2 QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKG scFV LKWMGWINTNTGEPTYAEEFKGRFAFSLETSASTAYLQINNLKN EDTATYFCARLGFGNAMDYWGQGTSVTVSSGGGGSGGGGSGGGG SDIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQ QKPGQPPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAE DLAVYYCQNDYSYPLTFGAGTKLELK 19 anti-DLL3scFV QVQLQESGPGLVKPSETLSLTCTVSGDSISSYYWTWIRQPPGKG LEWIGYIYYSGTTNYNPSLKSRVTISVDTSKSQFSLKLSSVTAA DTAVYYCASIAVRGFFFDYWGQGTLVTVSSGGGGSGGGGSGGGG SEIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQ APRLLIYGASTRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVY YCQQYGTSPLTFGGGTKVEIK 20 anti-FLT3.1scFV QVTLKESGPVLVKPTETLTLTCTVSGFSLINARMGVSWIRQPPG KALEWLAHIFSNAEKSYRTSLKSRLTISKDTSKSQVVLTMTNMD PVDTATYYCARIPGYGGNGDYHYYGMDVWGQGTTVTVSSGGGGS GGGGSGGGGSDIQMTQSPSSLSASLGDRVTITCRASQGIRNDLG WYQQKPGKAPKRLIYASSTLQSGVPSRFSGSGSGTEFTLTISSL QPEDFATYYCLQHNNFPWTFGQGTKVEIK 21 anti-FLT3.2scFV EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKG LEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRA EDTAVYYCANLAPWAAYWGQGTLVTVSSGGGGSGGGGSGGGGSE IVLTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKP GQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVG VYYCMQALQTPHTFGQGTKLEIK 22 anti-CD33.1VHH EVQLVESGGGEVQPGGSLRLSCAASRSSGIDVMGWYRQAPGKER ELVAEISGVGDTNYAASLADRFTVSRDNAKNTVYLQMSSLRAED TAVYYCNAHSFLDLVGAWGQGTLVTVKP 23 anti-CD33.2VHH EVQLVESGGGEVQPGGSLRLSCAASGRTFSGYIMGWFRQAPGKE RELVARISGNNLSTEYAESVKGRFTISRDNAKNTLYLQMSSLRA EDTAVYYCAAEYDYSSGDFVYWGQGTLVTVKP 24 anti-CD33.3VHH EVQLVESGGGEVQPGGSLRLSCAASGSTLNIDHIGWYRQAPGKE RELVGVISSGAGPNYAESVKGRFTISRDNAKNTVYLQMSSLRAE DTAVYYCNAWIDYGSGLPQNYWGQGTLVTVKP 25 anti-CLL1.1VHH EVQLVESGGGEVQPGGSLRLSCAASGFLFSIYDMNWYRQAPGKE REWVAGITNNGYSTAYAESVKGRFTISRDNAKNTIYLQMSSLRA EDTAVYYCHADLTKAYDVEYAWGQGTLVTVKP 26 anti-CLL1.2VHH EVQLVESGGGEVQPGGSLRLSCAASGLLFSIYDMNWYRQAPGKE REWVAGITNNGYSTAYAESVKGRFTISRDNAKNTVYLQMSSLRA EDTAVYYCHTDEWGREYWGQGTLVTVKP 27 anti-CD123.1VHH EVQLVESGGGEVQPGGSLRLSCTASGRAINMYAMGWFRQAPGKE REFVAAINWNGAYTQYAESVKGRFTISRDNAKNTLYLQMSSLRA EDTAVYYCSADADYNTYVSPNKRVSYWGQGTLVTVKP 28 anti-CD123.2VHH EVQLVESGGGLVQPGGSLRLSCAASGRAINAYNMGWFRQAPGKG REFVSAINWNAARTYYAESVKGRFTISRDNAKNTLYLQMSSLRA EDTAVYYCAASGRWSAAVPSGEDQYNFWGQGTLVTVKP 29 anti-CD20VHH QVQLQESGGGLVQAGGSLRLSCAASGRTFSNYNMGWFRQAPGKE REFVAAIDWSGGSPYYAASVRGRFTISRDNAENTVYLQMNSLKP EDTAVYYCAAPLSYGSTWLADYWGQGTQVTVSS 30 anti-EGFRVHH QVKLEESGGGSVQTGGSLRLTCAASGRTSRSYGMGWFRQAPGKE REFVSGISWRGDSTGYADSVKGRFTISRDNAKNTVDLQMNSLKP EDTAIYYCAAAAGSAWYGTLYEYDYWGQGTQVTVSS 31 anti-BCMA.1VHH QVKLEESGGGLVQAGRSLRLSCAASEHTFSSHVMGWFRQAPGKE RESVAVIGWRDISTSYADSVKGRFTISRDNAKKTLYLQMNSLKP EDTAVYYCAARRIDAADFDSWGQGTQVTVSS 32 anti-BCMA.2VHH EVQLVESGGGLVQAGGSLRLSCAASGRTFTMGWFRQAPGKEREF VAAISLSPTLAYYAESVKGRFTISRDNAKNTVVLQMNSLKPEDT ALYYCAADRKSVMSIRPDYWGQGTQVTVSS 33 yuTCRTinker LEKT (uLNK) 34 uLNK+G4S LEKTGGGGS linker 35 1xG4Slinker GGGGS 36 2xG4Slinker GGGGSGGGGS 37 3xG4slinker GGGGSGGGGSGGGGS 38 4xG4slinker GGGGSGGGGSGGGGSGGGGS 39 5xG4STinker GGGGSGGGGSGGGGSGGGGSGGGGS 40 Tinker DGGGS 41 Tinker TGEKP 42 Tinker GGRR 43 Tinker EGKSSGSGSESKVD 44 Tinker KESGSVSSEQLAQFRSLD 45 Tinker GGRRGGGS 46 Tinker LRQRDGERP 47 Tinker LRQKDGGGSERP 48 Tinker LRQKDGGGSGGGSERP 49 Tinker GSTSGSGKPGSGEGSTKG 50 Tinker GSTSGSGKSSEGSGSTKG 51 Tinker GSTSGSGKSSEGKG 52 Tinker GSTSGSGKPGSGEGS 53 Tinker GGGS 54 NY-ESO-1.1TCR? QEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLT SLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYL CAVRPTSGGSYIPTFGRGTSLIVHPY 55 NY-ESO-1.1TCR? GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLI HYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYF CASSYVGNTGELFFGEGSRLTVLE 56 NY-ESO-1.2TCR? QEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLT SLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYL CAVRPLYGGSYIPTFGRGTSLIVH 57 NY-ESO-1.2TCR? GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLI HYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYF CASSYVGNTGELFFGEGSRLTVLE 58 PRAMETCR? VEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEAL FVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCA LYNNNDMRFGAGTRLTVKPN 59 PRAMETCR? GVIQSPRHEVTEMGQEVTLRCKPISGHNSLFWYRQTMMRGLELL IYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVY FCASSPGSTDTQYFGPGTRLTVLE 60 TP53R175HTCR? QRKEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDCRKE PKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYL CVVQPGGYQKVTFGTGTKLQVIPD 61 TP53R175HTCR? GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLI YYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYF CASSEGLWQVGDEQYFGPGTRLTVTE 62 MAGE-A4TCR? QKITQTQPGMFVQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEM IFLIYQGSYDQQNATEGRYSLNFQKARKSANLVISASQLGDSAM YFCAMSGGYTGGFKTIFGAGTRLFVKAN 63 MAGE-A4TCR? GVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFL IQYYNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYF CASSGGDGDEQFFGPGTRLTVLE 64 WT1TCR? VEQHPSTLSVQEGDSAVIKCTYSDSASNYFPWYKQELGKRPQLI IDIRSNVGEKKDQRIAVTLNKTAKHFSLHITETQPEDSAVYFCA ATEDYQLIWGAGTKLIIKP 65 WT1TCR? GITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLI YYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYL CASSPGALYEQYFGPGTRLTVT 66 MR1.1TCR? GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPT FLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLC AVKDSNYQLIWGAGTKLIIKPD 67 MR1.1TCR? NAGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLR LIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSV YFCASSVWTGEGSGELFFGEGSRLTVLE 68 MR1.2TCR? QTVTQSQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQPPSRQM ILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAM YFCAYRSAVNARLMFGDGTQLVVKPN 69 MR1.2TCR? DIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLI HYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYL CASSEARGLAEFTDTQYFGPGTRLTVLE 70 CD1d+aGalCer QVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGRGPVS TCR? LTIMTFSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYIC VVSDRGSTLGRLYFGRGTQLTVWPD 71 CD1d+aGalCer DIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLI TCR? HYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYL CASSGLRDRGLYEQYFGPGTRLTVTE 72 HPV16E7TCR? MLLEHLLIILWMQLTWVSGQQLNQSPQSMFIQEGEDVSMNCTSS SIFNTWLWYKQDPGEGPVLLIALYKAGELTSNGRLTAQFGITRK DSFLNISASIPSDVGIYFCAGHPSSNSGYALNFGKGTSLLVTPH 73 HPV16E7TCR? MGTSLLCWVVLGFLGTDHTGAGVSQSPRYKVTKRGQDVALRCDP ISGHVSLYWYRQALGQGPEFLTYFNYEAQQDKSGLPNDRFSAER PEGSISTLTIQRTEQRDSAMYRCASSSQTGARTDTQYFGPGTRL TVLE 74 GP100TCR? MVKIRQFLLAILWLQLSCVSAAKNEVEQSPQNLTAQEGEFITIN CSYSVGISALHWLQQHPGGGIVSLFMLSSGKKKHGRLIATINIQ EKHSSLHITASHPRDSAVYICAASLIQGAQKLVFGQGTRLTINP N 75 GP100TCR? MDSWTFCCVSLCILVAKHTDAGVIQSPRHEVTEMGQEVTLRCKP ISGHNSLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKM PNASFSTLKIQPSEPRDSAVYFCASSPGGNEQFFGPGTRLTVLE 76 MART-1TCR? MLLEHLLIILWMQLTWVSGQQLNQSPQSMFIQEGEDVSMNCTSS SIFNTWLWYKQDPGEGPVLLIALYKAGELTSNGRLTAQFGITRK DSFLNISASIPSDVGIYFCAGGTGNQFYFGTGTSLTVIPN 77 MART-1TCR? MGTRLFFYVALCLLWTGHMDAGITQSPRHKVTETGTPVTLRCHQ TENHRYMYWYRQDPGHGLRLIHYSYGVKDTDKGEVSDGYSVSRS KTEDFLLTLESATSSQTSVYFCAISEVGVGQPQHFGDGTRLSIL E 78 allo-HLATCR? MGWALLVLLAFLSPASQKSSNLEGGTKSVTRPTRSSAEITCDLT VINAFYIHWYLHQEGKAPQRLLYYDVSNSKDVLESGLSPGKYYT HTPRRWSWILILRNLIENDSGVYYCATWDRPEIYYKKLFGSGTT LVVT 79 allo-HLATCR? MVFSSLLCVFVAFSYSGSSVAQKVTQAQSSVSMPVRKAVTLNCL YETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFK KAAKSVALTISALQLEDSAKYFCALGDSYGGGPLYTDKLIFGKG TRVTVEPR 80 huTRBC1 DLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSW WVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQN PRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGF TSVSYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDF 81 huTRBC2 DLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSW WVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQN PRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGF TSESYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDS RG 82 huTRAC IQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYIT DKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP SPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLL MTLRLWSS 83 huTRGC1 DKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKI HWQEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEKSLDKEHRC IVRHENNKNGVDQEIIFPPIKTDVITMDPKDNCSKDANDTLLLQ LTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS 84 huTRGC2 DKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDIIKI HWQEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEESLDKEHRC IVRHENNKNGIDQEIIFPPIKTDVTTVDPKYNYSKDANDVITMD PKDNWSKDANDTLLLQLTNTSAYYTYLLLLLKSVVYFAIITCCL LRRTAFCCNGEKS 85 huTRDC SQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFD PAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFEVK TDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGL RMLFAKTVAVNFLLTAKLFFL 86 mmTRBC1 DLNKVFPPEVAVFEPSKAEIAHTQKATLVCLATGFFPDHVELSW WVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQN PRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGI TSASYHQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDF 87 mmTRBC2 DLKNVFPPEVAVFEPSKAEIAHTQKATLVCLATGFYPDHVELSW WVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQN PRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGI TSASYHQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDS RG 88 mmTRAC IQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYIT DKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP SSDVPCDVKLVEKSFETDTNLNFQNLLVIVLRILLLKVAGENLL MTLRLWSS 89 MAGEA4TCR MGFRLLCCVAFCLLGAGPVDSGVTQTPKHLITATGQRVTLRCSP RSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQF PDLHSELNLSSLELGDSALYFCASSGGDGDEQFFGPGTRLTVLE DLKNVFPPEVAVFEPSKAEIAHTQKATLVCLATGFYPDHVELSW WVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQN PRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGI TSASYHQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDS RGRAKRGSGATNFSLLKQAGDVEENPGPMSLSSLLKVVTASLWL GPGIAQKITQTQPGMFVQEKEAVTLDCTYDTSDPSYGLFWYKQP SSGEMIFLIYQGSYDQQNATEGRYSLNFQKARKSANLVISASQL GDSAMYFCAMSGGYTGGFKTIFGAGTRLFVKANIQNPDPAVYQL RDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMD FKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSSDVPCDVKLV EKSFETDTNLNFQNLLVIVLRILLLKVAGFNLLMTLRLWSS 90 CD33DARIC MALPVTALLLPLALLLHAARPGSILWHEMWHEGLEEASRLYFGE RNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWC RKYMKSGNVKDLLQAWDLYYHVFRRISKASAGTGSDIYIWAPLA GTCGVLLLSLVITMHKRGRKKLLYIFKQPFMRPVQTTQEEDGCS CRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREE YDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIG MKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRSGSGATN FSLLKQAGDVEENPGPSMETDTLLLWVLLLWVPGSTGEVQLVES GGGEVQPGGSLRLSCAASRSSGIDVMGWYRQAPGKERELVAEIS GVGDTNYAASLADRFTVSRDNAKNTVYLQMSSLRAEDTAVYYCN AHSFLDLVGAWGQGTLVTVKPGGGGSGVQVETISPGDGRTFPKR GQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEG VAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKL EGGRMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQ 91 CD33.VHH-mLNK- METPAQLLFLLLLWLPDTTGEVQLVESGGGEVQPGGSLRLSCAA TRB-P2A-TRA SRSSGIDVMGWYRQAPGKERELVAEISGVGDTNYAASLADRFTV SRDNAKNTVYLQMSSLRAEDTAVYYCNAHSFLDLVGAWGQGTLV TVKPLEKTDSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQ QSLDQGLQFLIQYYNGEERAKGNILERFSAQQFPDLHSELNLSS LELGDSALYFCASSGGDGDEQFFGPGTRLTVLEDLKNVFPPEVA VFEPSKAEIAHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGV STDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQF YGLSENDEWTQDRAKPVTQIVSAEAWGRADCGITSASYHQGVLS ATILYEILLGKATLYAVLVSALVLMAMVKRKDSRGRAKRGSGAT NFSLLKQAGDVEENPGPMSLSSLLKVVTASLWLGPGIAQKITQT QPGMFVQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMIFLIYQ GSYDQQNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCAMS GGYTGGFKTIFGAGTRLFVKANIQNPDPAVYQLRDSKSSDKSVC LFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSN KSDFACANAFNNSIIPEDTFFPSSDVPCDVKLVEKSFETDTNLN FQNLLVIVLRILLLKVAGFNLLMTLRLWSS 92 CD33.VHH- METPAQLLFLLLLWLPDTTGEVQLVESGGGEVQPGGSLRLSCAA mLNK.1xG4S-TRB- SRSSGIDVMGWYRQAPGKERELVAEISGVGDTNYAASLADRFTV P2A-TRA SRDNAKNTVYLQMSSLRAEDTAVYYCNAHSFLDLVGAWGQGTLV TVKPLEKTGGGGSDSGVTQTPKHLITATGQRVTLRCSPRSGDLS VYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQFPDLHSE LNLSSLELGDSALYFCASSGGDGDEQFFGPGTRLTVLEDLKNVF PPEVAVFEPSKAEIAHTQKATLVCLATGFYPDHVELSWWVNGKE VHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFR CQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGITSASYH QGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRGRAKR GSGATNFSLLKQAGDVEENPGPMSLSSLLKVVTASLWLGPGIAQ KITQTQPGMFVQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMI FLIYQGSYDQQNATEGRYSLNFQKARKSANLVISASQLGDSAMY FCAMSGGYTGGFKTIFGAGTRLFVKANIQNPDPAVYQLRDSKSS DKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSA VAWSNKSDFACANAFNNSIIPEDTFFPSSDVPCDVKLVEKSFET DTNLNFQNLLVIVLRILLLKVAGFNLLMTLRLWSS 93 TRB-P2A- MGFRLLCCVAFCLLGAGPVDSGVTQTPKHLITATGQRVTLRCSP CD33.VHH-mLNK- RSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQF TRA PDLHSELNLSSLELGDSALYFCASSGGDGDEQFFGPGTRLTVLE DLKNVFPPEVAVFEPSKAEIAHTQKATLVCLATGFYPDHVELSW WVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQN PRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGI TSASYHQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDS RGRAKRGSGATNFSLLKQAGDVEENPGPMETPAQLLFLLLLWLP DTTGEVQLVESGGGEVQPGGSLRLSCAASRSSGIDVMGWYRQAP GKERELVAEISGVGDTNYAASLADRFTVSRDNAKNTVYLQMSSL RAEDTAVYYCNAHSFLDLVGAWGQGTLVTVKPLEKTAQKITQTQ PGMFVQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMIFLIYQG SYDQQNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCAMSG GYTGGFKTIFGAGTRLFVKANIQNPDPAVYQLRDSKSSDKSVCL FTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNK SDFACANAFNNSIIPEDTFFPSSDVPCDVKLVEKSFETDTNLNF QNLLVIVLRILLLKVAGFNLLMTLRLWSS 94 TRB-P2A- MGFRLLCCVAFCLLGAGPVDSGVTQTPKHLITATGQRVTLRCSP CD33.VHH- RSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQF mLNK.1xG4S-TRA PDLHSELNLSSLELGDSALYFCASSGGDGDEQFFGPGTRLTVLE DLKNVFPPEVAVFEPSKAEIAHTQKATLVCLATGFYPDHVELSW WVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQN PRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGI TSASYHQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDS RGRAKRGSGATNFSLLKQAGDVEENPGPMETPAQLLFLLLLWLP DTTGEVQLVESGGGEVQPGGSLRLSCAASRSSGIDVMGWYRQAP GKERELVAEISGVGDTNYAASLADRFTVSRDNAKNTVYLQMSSL RAEDTAVYYCNAHSFLDLVGAWGQGTLVTVKPLEKTGGGGSAQK ITQTQPGMFVQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMIF LIYQGSYDQQNATEGRYSLNFQKARKSANLVISASQLGDSAMYF CAMSGGYTGGFKTIFGAGTRLFVKANIQNPDPAVYQLRDSKSSD KSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAV AWSNKSDFACANAFNNSIIPEDTFFPSSDVPCDVKLVEKSFETD TNLNFQNLLVIVLRILLLKVAGFNLLMTLRLWSS 95 TRB-P2A- MGFRLLCCVAFCLLGAGPVDSGVTQTPKHLITATGQRVTLRCSP CD33.VHH-1xG4S- RSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQF TRA PDLHSELNLSSLELGDSALYFCASSGGDGDEQFFGPGTRLTVLE DLKNVFPPEVAVFEPSKAEIAHTQKATLVCLATGFYPDHVELSW WVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQN PRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGI TSASYHQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDS RGRAKRGSGATNFSLLKQAGDVEENPGPMETPAQLLFLLLLWLP DTTGEVQLVESGGGEVQPGGSLRLSCAASRSSGIDVMGWYRQAP GKERELVAEISGVGDTNYAASLADRFTVSRDNAKNTVYLQMSSL RAEDTAVYYCNAHSFLDLVGAWGQGTLVTVKPGGGGSAQKITQT QPGMFVQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMIFLIYQ GSYDQQNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCAMS GGYTGGFKTIFGAGTRLFVKANIQNPDPAVYQLRDSKSSDKSVC LFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSN KSDFACANAFNNSIIPEDTFFPSSDVPCDVKLVEKSFETDTNLN FQNLLVIVLRILLLKVAGFNLLMTLRLWSS 96 TRB-P2A- MGFRLLCCVAFCLLGAGPVDSGVTQTPKHLITATGQRVTLRCSP CD33.VHH-2xG4S- RSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQF TRA PDLHSELNLSSLELGDSALYFCASSGGDGDEQFFGPGTRLTVLE DLKNVFPPEVAVFEPSKAEIAHTQKATLVCLATGFYPDHVELSW WVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQN PRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGI TSASYHQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDS RGRAKRGSGATNFSLLKQAGDVEENPGPMETPAQLLFLLLLWLP DTTGEVQLVESGGGEVQPGGSLRLSCAASRSSGIDVMGWYRQAP GKERELVAEISGVGDTNYAASLADRFTVSRDNAKNTVYLQMSSL RAEDTAVYYCNAHSFLDLVGAWGQGTLVTVKPGGGGSGGGGSAQ KITQTQPGMFVQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMI FLIYQGSYDQQNATEGRYSLNFQKARKSANLVISASQLGDSAMY FCAMSGGYTGGFKTIFGAGTRLFVKANIQNPDPAVYQLRDSKSS DKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSA VAWSNKSDFACANAFNNSIIPEDTFFPSSDVPCDVKLVEKSFET DTNLNFQNLLVIVLRILLLKVAGFNLLMTLRLWSS 97 TRB-P2A-CLL1- MGFRLLCCVAFCLLGAGPVDSGVTQTPKHLITATGQRVTLRCSP CD33.VHH- RSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQF mLNK.1xG4S-TRA PDLHSELNLSSLELGDSALYFCASSGGDGDEQFFGPGTRLTVLE DLKNVFPPEVAVFEPSKAEIAHTQKATLVCLATGFYPDHVELSW WVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQN PRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGI TSASYHQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDS RGRAKRGSGATNFSLLKQAGDVEENPGPMETPAQLLFLLLLWLP DTTGEVQLVESGGGEVQPGGSLRLSCAASGFLFSIYDMNWYRQA PGKEREWVAGITNNGYSTAYAESVKGRFTISRDNAKNTIYLQMS SLRAEDTAVYYCHADLTKAYDVEYAWGQGTLVTVKPGGGGSGGG GSEVQLVESGGGEVQPGGSLRLSCAASRSSGIDVMGWYRQAPGK ERELVAEISGVGDTNYAASLADRFTVSRDNAKNTVYLQMSSLRA EDTAVYYCNAHSFLDLVGAWGQGTLVTVKPLEKTGGGGSAQKIT QTQPGMFVQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMIFLI YQGSYDQQNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCA MSGGYTGGFKTIFGAGTRLFVKANIQNPDPAVYQLRDSKSSDKS VCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAW SNKSDFACANAFNNSIIPEDTFFPSSDVPCDVKLVEKSFETDTN LNFQNLLVIVLRILLLKVAGFNLLMTLRLWSS 98 CLL1DARIC MALPVTALLLPLALLLHAARPGSILWHEMWHEGLEEASRLYFGE RNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWC RKYMKSGNVKDLLQAWDLYYHVFRRISKASAGTGSDIYIWAPLA GTCGVLLLSLVITMHKRGRKKLLYIFKQPFMRPVQTTQEEDGCS CRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREE YDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIG MKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRSGSGATN FSLLKQAGDVEENPGPSMETDTLLLWVLLLWVPGSTGEVQLVES GGGEVQPGGSLRLSCAASGFLFSIYDMNWYRQAPGKEREWVAGI TNNGYSTAYAESVKGRFTISRDNAKNTIYLQMSSLRAEDTAVYY CHADLTKAYDVEYAWGQGTLVTVKPGGGGSGVQVETISPGDGRT FPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRG WEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVEDVE LLKLEGGRMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQ 99 CLL1-CD33tandem MALPVTALLLPLALLLHAARPGSILWHEMWHEGLEEASRLYFGE DARIC RNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWC RKYMKSGNVKDLLQAWDLYYHVFRRISKASAGTGSDIYIWAPLA GTCGVLLLSLVITMHKRGRKKLLYIFKQPFMRPVQTTQEEDGCS CRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREE YDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIG MKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRSGSGATN FSLLKQAGDVEENPGPSMETDTLLLWVLLLWVPGSTGEVQLVES GGGEVQPGGSLRLSCAASGFLFSIYDMNWYRQAPGKEREWVAGI TNNGYSTAYAESVKGRFTISRDNAKNTIYLQMSSLRAEDTAVYY CHADLTKAYDVEYAWGQGTLVTVKPGGGGSGGGGSGGGGSEVQL VESGGGEVQPGGSLRLSCAASRSSGIDVMGWYRQAPGKERELVA EISGVGDTNYAASLADRFTVSRDNAKNTVYLQMSSLRAEDTAVY YCNAHSFLDLVGAWGQGTLVTVKPGGGGSGVQVETISPGDGRTF PKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVEL LKLEGGRMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQ 100 TRB-P2A- MGFRLLCCVAFCLLGAGPVDSGVTQTPKHLITATGQRVTLRCSP BCMA.scFv-2xG4S- RSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQF TRA PDLHSELNLSSLELGDSALYFCASSGGDGDEQFFGPGTRLTVLE DLKNVFPPEVAVFEPSKAEIAHTQKATLVCLATGFYPDHVELSW WVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQN PRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGI TSASYHQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDS RGRAKRGSGATNFSLLKQAGDVEENPGPMETPAQLLFLLLLWLP DTTGDIVLTQSPPSLAMSLGKRATISCRASESVTILGSHLIHWY QQKPGQPPTLLIQLASNVQTGVPARFSGSGSRTDFTLTIDPVEE DDVAVYYCLQSRTIPRTFGGGTKLEIKGSTSGSGKPGSGEGSTK GQIQLVQSGPELKKPGETVKISCKASGYTFTDYSINWVKRAPGK GLKWMGWINTETREPAYAYDFRGRFAFSLETSASTAYLQINNLK YEDTATYFCALDYSYAMDYWGQGTSVTVSSGGGGSGGGGSAQKI TQTQPGMFVQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMIFL IYQGSYDQQNATEGRYSLNFQKARKSANLVISASQLGDSAMYFC AMSGGYTGGFKTIFGAGTRLFVKANIQNPDPAVYQLRDSKSSDK SVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVA WSNKSDFACANAFNNSIIPEDTFFPSSDVPCDVKLVEKSFETDT NLNFQNLLVIVLRILLLKVAGFNLLMTLRLWSS 101 BCMAscFvCAR MALPVTALLLPLALLLHAARPDIVLTQSPPSLAMSLGKRATISC RASESVTILGSHLIHWYQQKPGQPPTLLIQLASNVQTGVPARFS GSGSRTDFTLTIDPVEEDDVAVYYCLQSRTIPRTFGGGTKLEIK GSTSGSGKPGSGEGSTKGQIQLVQSGPELKKPGETVKISCKASG YTFTDYSINWVKRAPGKGLKWMGWINTETREPAYAYDFRGRFAF SLETSASTAYLQINNLKYEDTATYFCALDYSYAMDYWGQGTSVT VSSAAATTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTR GLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQ PFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQ GQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLY NELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDA LHMQALPPR 102 TRB-P2A- MGFRLLCCVAFCLLGAGPVDSGVTQTPKHLITATGQRVTLRCSP CD19.scFv-2xG4S- RSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQF TRA PDLHSELNLSSLELGDSALYFCASSGGDGDEQFFGPGTRLTVLE DLKNVFPPEVAVFEPSKAEIAHTQKATLVCLATGFYPDHVELSW WVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQN PRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGI TSASYHQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDS RGRAKRGSGATNFSLLKQAGDVEENPGPMETPAQLLFLLLLWLP DTTGDIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKP DGTVKLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIA TYFCQQGNTLPYTFGGGTKLEITGGGGSGGGGSGGGGSEVKLQE SGPGLVAPSQSLSVTCTVSGVSLPDYGVSWIRQPPRKGLEWLGV IWGSETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYY CAKHYYYGGSYAMDYWGQGTSVTVSSGGGGSGGGGSAQKITQTQ PGMFVQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMIFLIYQG SYDQQNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCAMSG GYTGGFKTIFGAGTRLFVKANIQNPDPAVYQLRDSKSSDKSVCL FTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNK SDFACANAFNNSIIPEDTFFPSSDVPCDVKLVEKSFETDTNLNF QNLLVIVLRILLLKVAGFNLLMTLRLWSS 103 CD33.VHH-MLNK- EVQLVESGGGEVQPGGSLRLSCAASRSSGIDVMGWYRQAPGKER TRB ELVAEISGVGDTNYAASLADRFTVSRDNAKNTVYLQMSSLRAED TAVYYCNAHSFLDLVGAWGQGTLVTVKPLEKTDSGVTQTPKHLI TATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEERA KGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSGGDGDE QFFGPGTRLTVLEDLKNVFPPEVAVFEPSKAEIAHTQKATLVCL ATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCL SSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQI VSAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVS ALVLMAMVKRKDSRG 104 CD33.VHH- EVQLVESGGGEVQPGGSLRLSCAASRSSGIDVMGWYRQAPGKER mLNK.1xG4S-TRB ELVAEISGVGDTNYAASLADRFTVSRDNAKNTVYLQMSSLRAED TAVYYCNAHSFLDLVGAWGQGTLVTVKPLEKTGGGGSDSGVTQT PKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYN GEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSG GDGDEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSKAEIAHTQKA TLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALND SRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAK PVTQIVSAEAWGRADCGITSASYHQGVLSATILYEILLGKATLY AVLVSALVLMAMVKRKDSRG 105 CD33.VHH-MLNK- EVQLVESGGGEVQPGGSLRLSCAASRSSGIDVMGWYRQAPGKER TRA ELVAEISGVGDTNYAASLADRFTVSRDNAKNTVYLQMSSLRAED TAVYYCNAHSFLDLVGAWGQGTLVTVKPLEKTAQKITQTQPGMF VQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMIFLIYQGSYDQ QNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCAMSGGYTG GFKTIFGAGTRLFVKANIQNPDPAVYQLRDSKSSDKSVCLFTDF DSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFA CANAFNNSIIPEDTFFPSSDVPCDVKLVEKSFETDTNLNFQNLL VIVLRILLLKVAGFNLLMTLRLWSS 106 CD33.VHH- EVQLVESGGGEVQPGGSLRLSCAASRSSGIDVMGWYRQAPGKER mLNK.1xG4S-TRA ELVAEISGVGDTNYAASLADRFTVSRDNAKNTVYLQMSSLRAED TAVYYCNAHSFLDLVGAWGQGTLVTVKPLEKTGGGGSAQKITQT QPGMFVQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMIFLIYQ GSYDQQNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCAMS GGYTGGFKTIFGAGTRLFVKANIQNPDPAVYQLRDSKSSDKSVC LFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSN KSDFACANAFNNSIIPEDTFFPSSDVPCDVKLVEKSFETDTNLN FQNLLVIVLRILLLKVAGFNLLMTLRLWSS 107 CD33. EVQLVESGGGEVQPGGSLRLSCAASRSSGIDVMGWYRQAPGKER VHH-1xG4S- ELVAEISGVGDTNYAASLADRFTVSRDNAKNTVYLQMSSLRAED TRA TAVYYCNAHSFLDLVGAWGQGTLVTVKPGGGGSAQKITQTQPGM FVQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMIFLIYQGSYD QQNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCAMSGGYT GGFKTIFGAGTRLFVKANIQNPDPAVYQLRDSKSSDKSVCLFTD FDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDF ACANAFNNSIIPEDTFFPSSDVPCDVKLVEKSFETDTNLNFQNL LVIVLRILLLKVAGFNLLMTLRLWSS 108 CD33.VHH-2xG4S- EVQLVESGGGEVQPGGSLRLSCAASRSSGIDVMGWYRQAPGKER TRA ELVAEISGVGDTNYAASLADRFTVSRDNAKNTVYLQMSSLRAED TAVYYCNAHSFLDLVGAWGQGTLVTVKPGGGGSGGGGSAQKITQ TQPGMFVQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMIFLIY QGSYDQQNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCAM SGGYTGGFKTIFGAGTRLFVKANIQNPDPAVYQLRDSKSSDKSV CLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWS NKSDFACANAFNNSIIPEDTFFPSSDVPCDVKLVEKSFETDTNL NFQNLLVIVLRILLLKVAGFNLLMTLRLWSS 109 CLL1-CD33.VHH- EVQLVESGGGEVQPGGSLRLSCAASGFLFSIYDMNWYRQAPGKE mLNK.1xG4S-TRA REWVAGITNNGYSTAYAESVKGRFTISRDNAKNTIYLQMSSLRA EDTAVYYCHADLTKAYDVEYAWGQGTLVTVKPGGGGSGGGGSEV QLVESGGGEVQPGGSLRLSCAASRSSGIDVMGWYRQAPGKEREL VAEISGVGDTNYAASLADRFTVSRDNAKNTVYLQMSSLRAEDTA VYYCNAHSFLDLVGAWGQGTLVTVKPLEKTGGGGSAQKITQTQP GMFVQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMIFLIYQGS YDQQNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCAMSGG YTGGFKTIFGAGTRLFVKANIQNPDPAVYQLRDSKSSDKSVCLF TDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKS DFACANAFNNSIIPEDTFFPSSDVPCDVKLVEKSFETDTNLNFQ NLLVIVLRILLLKVAGFNLLMTLRLWSS 110 BCMA.scFv-2xG4S- DIVLTQSPPSLAMSLGKRATISCRASESVTILGSHLIHWYQQKP TRA GQPPTLLIQLASNVQTGVPARFSGSGSRTDFTLTIDPVEEDDVA VYYCLQSRTIPRTFGGGTKLEIKGSTSGSGKPGSGEGSTKGQIQ LVQSGPELKKPGETVKISCKASGYTFTDYSINWVKRAPGKGLKW MGWINTETREPAYAYDFRGRFAFSLETSASTAYLQINNLKYEDT ATYFCALDYSYAMDYWGQGTSVTVSSGGGGSGGGGSAQKITQTQ PGMFVQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMIFLIYQG SYDQQNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCAMSG GYTGGFKTIFGAGTRLFVKANIQNPDPAVYQLRDSKSSDKSVCL FTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNK SDFACANAFNNSIIPEDTFFPSSDVPCDVKLVEKSFETDTNLNF QNLLVIVLRILLLKVAGFNLLMTLRLWSS 111 CD19.scFV-2xG4S- DIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTV TRA KLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFC QQGNTLPYTFGGGTKLEITGGGGSGGGGSGGGGSEVKLQESGPG LVAPSQSLSVTCTVSGVSLPDYGVSWIRQPPRKGLEWLGVIWGS ETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAKH YYYGGSYAMDYWGQGTSVTVSSGGGGSGGGGSAQKITQTQPGMF VQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMIFLIYQGSYDQ QNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCAMSGGYTG GFKTIFGAGTRLFVKANIQNPDPAVYQLRDSKSSDKSVCLFTDF DSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFA CANAFNNSIIPEDTFFPSSDVPCDVKLVEKSFETDTNLNFQNLL VIVLRILLLKVAGFNLLMTLRLWSS 112 Furincleavage RAKR site

    EXAMPLES

    Example 1

    Evaluation of Engineered TCRs

    [0441] A MAGEA4-reactive, HLA-A2-restricted T-cell receptor (TCR) was embedded with a VHH targeting human CD33 to produce an engineered dual-targeting TCR (VHH-TCR) (SEQ ID NO: 93) (FIGS. 1A and 1B). This was evaluated for expression and function compared to a TCR targeting MAGEA4 (SEQ ID NO: 89) and a DARIC (Dimerizing Agent Regulated Immunoreceptor Complex, a controllable and adaptable antigen recognizing system) targeting human CD33 (SEQ ID NO: 90) (the comparators) (FIG. 1A). Dual-targeting TCR T cells were produced in a 10 Day process using G-REX? flasks. Briefly, peripheral blood mononuclear cells (PBMC) were cultured in media containing IL-2 (CellGenix, GmbH) and antibodies specific for CD3 and CD28 (Miltenyi Biotec, Inc.). Lentiviruses encoding the test constructs were added one day after culture initiation. On Day 3, CAR T cells were transferred from a 24-well plate, to a 24 well G-REX flask, where cells were maintained until harvest on Day 10.

    [0442] T cells were interrogated for cell surface VHH expression using flow cytometry. T cells were stained using an iFlour488 labeled anti-Camelid VHH antibody (Genscript). Surface VHH expression was higher in the VHH-TCR compared to CD33 DARIC (FIG. 2A). Additionally, the biological activity of the T cells was assessed for interferon gamma production in co-culture with tumor cell lines positive for CD33 (adherent A549 cell line that was stably transduced with CD33). As shown in FIG. 2B, the interferon gamma production of VHH-TCR is >3-fold greater than the CD33-DARIC, which was activated by including 1 nm Rapamycin during coculture. Live-cell imaging by IncuCyte was used to analyze tumor cell growth of A549.CD33 stably transduced with red reporter. The A549 cells grew normally in the presence of UTD T cells and MAGEA4 TCR-T cells. Co-culture with either VHH-TCR or CD33-DARIC resulted in tumor cell elimination, with VHH-TCR achieving elimination more rapidly than the DARIC (FIG. 2C).

    [0443] Flow cytometry was performed to evaluate MAGEA4 tetramer/HLA-multimer binding which was higher in VHH-TCR compared to the MAGEA4 TCR (FIG. 3A). Additionally, the biological activity of the T cells was assessed for interferon gamma production in co-culture with tumor cell lines positive for MAGEA4 (adherent A549 cell line that was stably transduced with MAGEA4 and HLA-A2). As shown in FIG. 3B, the interferon gamma production of VHH-TCR is ?3-fold greater than the MAGEA4 TCR. Live-cell imaging by IncuCyte was used to analyze tumor cell growth of the adherent A549.MAGEA4.HLA-A cell line that was stably transduced with a red reporter. The A549 cells grew normally in the presence of UTD T cells and CD33-DARIC cells. Co-culture of MAGEA4 TCR resulted in complete elimination of tumor cells, whereas VHH-TCR resulted in complete and more rapid elimination of tumor cells (FIG. 3C).

    [0444] The sensitivity of VHH-TCR was compared to the MAGEA4 TCR by setting up co-cultures with A549 cells, that do not express MAGEA4, pulsed with a range of MAGEA4 peptide concentrations. As shown in FIG. 4A, compared to the MAGEA4 TCR, the VHH-TCR demonstrates similar kinetics but superior interferon gamma release in co-culture with a range of MAGEA4 peptide expression. The sensitivity of VHH-TCR was compared to the CD33 DARIC by setting up co-cultures with A549 cells, that do not express CD33, electroporated with a range of CD33 mRNA concentrations. As shown in FIGS. 4B and 4C, compared to the CD33 DARIC activated with 1 nm Rapamycin, the VHH-TCR demonstrates similar kinetics but superior interferon gamma production in co-culture with a range of CD33 mRNA expression. Additionally, cocultures were set up with cell lines endogenously expressing varying levels of CD33; HL-60 has high CD33 expression, Kasumi1 has moderate CD33 expression and OCI-AML3 has low CD33 expression. As shown in FIGS. 5A-5C, the VHH-TCR demonstrates superior interferon gamma upon coculture, most evident in OCI-AML3 that expresses low level of CD33.

    Example 2

    Evaluation of Engineered TCR Configurations

    [0445] Four configurations were assessed: 1) a VHH was added to the TRB (T cell receptor beta chain) separated by a marsupial mu linker (LEKT) (SEQ ID NO: 91), 2) a VHH was added to the TRB separated by a mu linker+G4S (SEQ ID NO: 92), 3) a VHH was added to the TRA (T cell receptor alpha chain) separated by a mu linker (SEQ ID NO: 93), and 4) a VHH was added to the TRA separated by a mu linker+G4S (SEQ ID NO: 94) (FIG. 6). TCR T cells were produced as described in Example 1.

    [0446] T cells were interrogated for cell surface VHH expression using flow cytometry. T cells were stained using an iFlour488 labeled anti-Camelid VHH antibody (Genscript). Surface VHH expression was higher in the VHH-TCR than the CD33 DARIC (SEQ ID NO: 90) and was comparable in all the orientations tested (FIG. 7A). Additionally, the biological activity of the T cells was assessed for interferon gamma production in co-culture with tumor cell lines positive for CD33 (adherent A549 cell line that was stably transduced with CD33). As shown in FIG. 7B, the interferon gamma production of all VHH-TCRs is >2-fold greater than the CD33-DARIC activated with 1 nm Rapamycin, and the VHH-TCR with VHH added to the TRA separated by a mu linker+G4S outperformed all the constructs assessed. Live-cell imaging by IncuCyte was used to analyze tumor cell growth of A549.CD33 stably transduced with red reporter. The A549 cells grew normally in the presence of UTD T cells and MAGEA4 TCR-T cells. Co-culture with all VHH-TCR or activated CD33-DARIC resulted in tumor cell elimination, with VHH-TCRs achieving elimination more rapidly than the DARIC (FIG. 7C).

    [0447] Flow cytometry was performed to evaluate MAGEA4 tetramer/HLA-multimer binding which was comparable in all VHH TCRs and to the MAGEA4 TCR (FIG. 8A). Additionally, the biological activity of the T cells was assessed for interferon gamma production in co-culture with tumor cell lines positive for MAGEA4 (adherent A549 cell line that was stably transduced with MAGEA4 and HLA-A2). As shown in FIG. 8B, in comparison with the MAGEA4 TCR, the interferon gamma production of VHH-TCR with VHH embedded in TRB is lower, but slightly greater when VHH was added to the TRA separated by a mu linker, and ?3-fold greater when the VHH was added to the TRA separated by a mu linker+G4S. Live-cell imaging by IncuCyte was used to analyze tumor cell growth of the adherent A549.MAGEA4.HLA-A cell line that was stably transduced with a red reporter. The A549 cells grew normally in the presence of UTD T cells and CD33-DARIC cells. Co-culture with TCRs with VHH embedded in TRB had incomplete elimination of tumor cells. Co-culture with MAGEA4 TCR resulted in complete elimination of tumor cells and co-culture with VHH embedded in TRA resulted in complete and more rapid elimination of tumor cells (FIG. 8C).

    Example 3

    Further Evaluation of Linkers in Engineered TCRs

    [0448] The significance of the linkers on the VHH was further assessed by comparing constructs where 1) a VHH was added to the TRA separated by a mu linker (LEKT)+G4S (SEQ ID NO: 94), 2) a VHH was added to the TRA separated by a 1?G4S (SEQ ID NO: 95), and 3) a VHH was added to the TRA separated by a 2?G4S (SEQ ID NO: 96) (FIG. 9). TCR T cells were produced as described in Example 1.

    [0449] T cells were interrogated for cell surface CD33 expression using flow cytometry. T cells were stained using a His labeled CD33-Fc reagent (Acros) and secondary staining was performed with APC labeled streptavidin. Surface CD33 expression was comparable in all the three assessed formats (FIG. 10A). Additionally, the biological activity of the T cells was assessed for interferon gamma production in co-culture with tumor cell lines positive for CD33 (adherent A549 cell line that was stably transduced with CD33). As shown in FIG. 10B, the interferon gamma production of VHH-TCRs with mu linker+1G4S and 1G4S was comparable and was highest in VHH-TCR with 2G4S. Live-cell imaging by IncuCyte was used to analyze tumor cell growth of A549.CD33 stably transduced with red reporter. The A549 cells grew normally in the presence of UTD T cells. Co-culture with all VHH-TCRs resulted in tumor cell elimination (FIG. 10C).

    [0450] Flow cytometry was performed to evaluate MAGEA4 tetramer/HLA-multimer binding which was comparable in all three assessed formats (FIG. 11A). Additionally, the biological activity of the T cells was assessed for interferon gamma production in co-culture with tumor cell lines positive for MAGEA4 (adherent A549 cell line that was stably transduced with MAGEA4 and HLA-A2). As shown in FIG. 11B, the interferon gamma production of VHH-TCRs with mu linker+1G4S and one G4S was comparable and highest in the VHH-TCR with two G4Ss. Live-cell imaging by IncuCyte was used to analyze tumor cell growth of the adherent A549.MAGEA4.HLA-A cell line that was stably transduced with a red reporter. The A549 cells grew normally in the presence of UTD T cells. Co-culture with all VHH-TCRs had complete elimination of tumor cells and it was fastest in VHH-TCR with two G4Ss (FIG. 11C).

    Example 4

    Evaluation of Engineered Multi-Targeting TCR? with Tandem Binders

    [0451] A MAGEA4-reactive, HLA-A2-restricted T-cell receptor (TCR) was embedded with tandem VHHs targeting human CD33 and CLL1 (SEQ ID NO: 97) (FIGS. 12A and 12B). This was evaluated for expression and function compared to a known TCR targeting MAGEA4 and a DARIC (Dimerizing Agent Regulated Immunoreceptor Complex, a controllable and adaptable antigen recognizing system) targeting human CD33 (SEQ ID NO: 90), CLL1 (SEQ ID NO: 98), and both CD33 and CLL1 in tandem (SEQ ID NO: 99) (the comparators) (FIG. 12A). Dual targeting TCR T cells were produced in a 10 Day process using G-REX? flasks using the same protocol as Example 1.

    [0452] T cells were interrogated for cell surface CD33 expression using flow cytometry. T cells were stained using a His labeled CD33-Fc reagent (Acros) and secondary staining with APC labeled streptavidin. Surface CD33 expression was higher in the CD33-CLL1-TCR compared to CD33 DARIC and CD33-CLL1 DARIC (FIG. 13A). Additionally, the biological activity of the T cells was assessed for interferon gamma production in co-culture with tumor cell lines positive for CD33 (adherent A549 cell line that was stably transduced with CD33). As shown in FIG. 13B, the interferon gamma production of the CD33-CLL1-TCR is comparable to CD33-DARIC and CD33-CLL1 DARIC (the latter two were activated by addition of 1 nm Rapamycin).

    [0453] T cells were interrogated for cell surface CLL1 expression using flow cytometry. T cells were stained using a PE labeled CLL1-Fc reagent (Creative Biomart). Surface CLL1 expression was higher in the CD33-CLL1-TCR compared to CLL1 DARIC and CD33-CLL1 DARIC (FIG. 14A). Additionally, the biological activity of the T cells was assessed for interferon gamma production in co-culture with tumor cell lines positive for CLL1 (adherent A549 cell line that was stably transduced with CLL1). As shown in FIG. 14B, the CD33-CLL1 TCR produces robust interferon gamma in co-culture with a CLL1 expressing cell line.

    [0454] Flow cytometry was performed to evaluate MAGEA4 tetramer/HLA-multimer binding which was higher in CD33-CLL1-TCR compared to the MAGEA4 TCR (FIG. 15A). Additionally, the biological activity of the T cells was assessed for interferon gamma production in co-culture with tumor cell lines positive for MAGEA4 (adherent A549 cell line that was stably transduced with MAGEA4 and HLA-A2). As shown in FIG. 15B, the interferon gamma production of CD33-CLL1-TCR is comparable to the MAGEA4 TCR.

    Example 5

    Evaluation of VHH-Based Engineered TCRs

    [0455] Two engineered TCRs were constructed, each with a MAGEA4-reactive, HLA-A2-restricted T-cell receptor (TCR) embedded with one of two anti-BCMA VHH. The same anti-BCMA VHHs were also formatted in a CAR format. These were evaluated for expression and function compared to a TCR targeting MAGEA4 and a known scFv-based CAR targeting BCMA (the comparators). T cells were produced in a 10 Day process using G-REX? flasks using the same protocol as Example 1.

    [0456] T cells were interrogated for cell surface CAR and TCR expression using flow cytometry and evaluated for MAGEA4 tetramer/HLA-multimer binding. T cells were stained using a PE labeled BCMA Fc reagent (AcroBio). Surface BCMA binder expression was detectable on all constructs having a BCMA binder (FIG. 16). Both VHH TCR were detected robustly by the MAGEA4 tetramer, and were comparable to the MAGE-A4 TCR.

    [0457] The biological activity of the T cells was assessed for interferon gamma production in co-culture with tumor cell lines positive for MAGEA4 (adherent A375 cell line that endogenously expresses MAGEA4 and HLA-A2). As shown in FIG. 17, the VHH TCRs expressed a very robust level of interferon gamma, and expression is comparable to the MAGEA4 TCR.

    [0458] The biological activity of the T cells was also assessed for interferon gamma production in co-culture with tumor cell lines positive for BCMA (the Toledo suspension cell line endogenously expresses low levels of BCMA). As shown in FIG. 18A, the VHH TCRs produced interferon gamma comparable to or greater than the respective VHH CAR. The biological activity of the T cells in co-culture with Toledo cells was further assessed for Interleukin 2 (IL2) production, which is a more sensitive assay. As shown in FIG. 18B, none of the VHH CARs produced a detectable amount of IL2, whereas both VHH TCRs produced robust IL2. Antigen independent signaling of the T cells was assessed by interferon gamma production in co-culture without tumor cell lines. As shown in FIG. 19, the VHH CARs had detectable levels of interferon gamma production, but the VHH TCRs had low or no detectable interferon gamma production in the absence of tumor cells.

    Example 6

    Evaluation of SCFV-Based Engineered TCRs

    [0459] A MAGEA4-reactive, HLA-A2-restricted T-cell receptor (TCR) was embedded with an scFv targeting human BCMA (SEQ ID NO: 100) and a 2?G4S linker between the scFv and Va (FIGS. 20A and 20B). This was evaluated for expression and function compared to a TCR targeting MAGEA4 (SEQ ID NO: 89) and an scFv-based CAR targeting human BCMA (SEQ ID NO: 101) (the comparators) (FIG. 20A). Dual targeting TCR T cells were produced in the same manner as Example 1.

    [0460] T cells were interrogated for cell surface CAR expression using flow cytometry. T cells were stained using a PE labeled BCMA Fc reagent (AcroBio). Surface BCMA binder expression was comparable between the scFv-TCR and anti-BCMA CAR (FIG. 21A). Additionally, the biological activity of the T cells was assessed for interferon gamma production in co-culture with tumor cell lines expressing varying levels of BCMA (HT1080 engineered to overexpress high levels of BCMA, RPMI-8226: medium endogenous BCMA expression, Toledo: low endogenous expression). As shown in FIG. 21B, the interferon gamma production of scFv-TCR is comparable to the anti-BCMA CAR in high BCMA expressing cell line, but greater in medium and low expressing cell lines. IL2 secretion of scFv-TCR was greater than anti-BCMA CAR in coculture with medium and low BCMA expressing cell lines (FIG. 21C). Secretion of tumor necrosis factor a, another sensitive assay, was assessed in FIG. 21D, and this was greater in RPMI-8226 and Toledo, medium and low expressing BCMA cell lines. For Live-cell imaging by IncuCyte was used to analyze tumor cell growth of HT1080.BCMA stably transduced with red reporter. The HT1080.BCMA cells grew in the presence of UTD T cells and MAGEA4 TCR-T cells. Co-culture with either scFv-TCR or anti-BCMA CAR resulted in tumor cell elimination, with the scFv-TCR achieving elimination more rapidly than the CAR (FIG. 21E).

    [0461] Flow cytometry was performed to evaluate MAGEA4 tetramer/HLA-multimer binding which was comparable in scFv-TCR and the MAGEA4 TCR (FIG. 22A). Additionally, the biological activity of the T cells was assessed for interferon gamma production, IL2 and tumor necrosis factor a in co-culture with tumor cell lines positive for MAGEA4 (adherent A375 cell line that endogenously expresses MAGEA4 and HLA-A2). As shown in FIG. 22B, the interferon gamma and tumor necrosis factor a production of VHH-TCR is comparable to the MAGEA4 TCR.

    Example 7

    Evaluation of Engineered TCR? in a CD33 Antigen Only Positive Tumor Model

    [0462] A MAGEA4-reactive, HLA-A2-restricted T-cell receptor (TCR) was embedded with a VHH targeting human CD33 to produce an engineered dual-targeting TCR (VHH-TCR) (SEQ ID NO: 93) (FIGS. 1A and 1B). Dual-targeting TCR T cells were produced in the same manner as Example 1. Engineered T cells were evaluated for expression and in vitro function in the same manner as Example 1.

    [0463] The ability of the VHH-TCR to recognize and function in the presence of VHH antigen was assessed in vivo using the systemic luciferase tagged HL-60 tumor model in NSG mice. The HL-60 model expresses CD33 but not MAGEA4, therefore any observed anti-tumor activity would be a result of the VHH-TCR signaling following VHH recognition of CD33. Luciferase tagged HL-60 cells were transplanted intravenously into na?ve female NSG mice and allowed to establish for five days. Mice were randomized into groups of 5 animals with similar means on study day ?1 (D?1). On DO, animals were intravenously dosed with either untransduced T cells, MAGE4 TCR T cells, CD33-DARIC T cells, or VHH-TcR T cells. T cell doses were normalized to 10E6 receptor positive cells/mouse; the untransduced T cell dose was normalized to match the highest total T cell dose. Animals treated with CD33-DARIC T cells were maintained on a Monday/Wednesday/Friday 0.1 mg/kg rapamycin schedule starting on DO. As shown in FIG. 23, tumor growth continues unchecked in animals treated with either untransduced or MAGEA4 TCR T cells. Both the CD33-DARIC and VHH-TCR T cells demonstrate comparable tumor control.

    Example 8

    Evaluation of Engineered TCR? in a TCR Antigen Only Positive Tumor Model

    [0464] A MAGEA4-reactive, HLA-A2-restricted T-cell receptor (TCR) was embedded with a VHH targeting human CD33 to produce an engineered dual-targeting TCR (VHH-TCR) (SEQ ID NO: 93) (FIGS. 1A and 1B). Dual-targeting TCR T cells were produced in the same manner as Example 1. Engineered T cells were evaluated for expression and in vitro function in the same manner as Example 1.

    [0465] The ability of the VHH-TCR to recognize and function in the presence of TCR antigen was assessed in vivo using the subcutaneous NCI-H2023 tumor model in NSG mice. The NCI-H2023 model expresses MAGEA4 but not CD33, therefore any observed anti-tumor activity would be a result of the VHH-TCR signaling following TCR recognition of MAGEA4. NCI-H2023 cells were transplanted subcutaneously into na?ve female NSG mice and allowed to establish for twenty-one days. Mice were randomized into groups of 5 animals with similar means on study day ?1 (D?1). On DO, animals were intravenously dosed with either untransduced T cells, MAGE4 TCR T cells, CD33-DARIC T cells, or VHH-TCR T cells. T cell doses were normalized to 10E6 receptor positive cells/mouse; the untransduced T cell dose was normalized to match the highest total T cell dose. Animals treated with CD33-DARIC T cells were maintained on a Monday/Wednesday/Friday 0.1 mg/kg rapamycin schedule starting on DO. As shown in FIG. 24, tumor growth continues unchecked in animals treated with either untransduced or CD33-DARIC T cells. Both the MAGEA4 TCR and VHH-TCR T cells initially demonstrate comparable tumor control. Loss of tumor control occurs earlier in the animals treated with the VHH-TCR T cells.

    Example 9

    Evaluation of Engineered TCR Constructs Comprising a CD19 scFv

    [0466] A MAGEA4-reactive, HLA-A2-restricted T-cell receptor (TCR) was embedded with an scFv targeting human CD19 (SEQ ID NO: 102). This was evaluated for expression and function compared to a MAGEA4-reactive, HLA-A2-restricted T-cell receptor (TCR) embedded with an scFv targeting human BCMA (SEQ ID NO: 100). Dual-targeting TCR T cells were produced as described in Example 1.

    [0467] T cells were interrogated for cell surface TCR expression using flow cytometry. T cells were stained using a PE-labeled anti-TCR Vb1 antibody (Miltenyi Biotech). Surface expression of the engineered constructs was comparable (FIG. 25A). Additionally, the biological activity of the T cells was assessed by measuring interferon gamma production in co-cultures with suspension tumor cell line RPMI-8226 (endogenous BCMA expression, undetectable CD19 expression), and with suspension tumor cell line K562.CD19 (undetectable BCMA expression, stably transduced with CD19). As shown in FIG. 25B and FIG. 25C, CD19 ScFv TCR T cells produce interferon gamma in response to tumor cell lines positive for surface CD19 at comparable levels to the interferon gamma produced by BCMA ScFv TCR T cells in response to tumor cell lines positive for surface BCMA.

    Example 10

    Illustrative Engineered TCR Constructs

    [0468] As contemplated herein, antigen-binding domains (also referred to herein as binders or antigen binders), polypeptide linkers, and TCRs can be surprisingly combined to produce an engineered TCR having multi-specificity. In other words, the components can be combined without destroying the functionality of either the antigen-binding domain(s) or the TCR(s). Thus, the engineered TCRs contemplated herein surprisingly provide (1) multi-specificity, (2) increased sensitivity to non-MHC presented targets, and (3) the ability to simultaneously target both intracellular and extracellular targets.

    [0469] Engineered TCRs can be constructed in multiple formats, and can be designed and constructed using known components (e.g., antigen-binding domains, polypeptide linkers, and TCR? and TCR? chains) and techniques. For example, one or more antigen-binding domains (e.g., one or more A components) can be linked to one or more TCR components (e.g., one or more C components) with or without one or more polypeptide linkers (e.g., with or without one or more B components) using standard cloning techniques. The A component can be linked to either the TCR? or TCR? polypeptide/chain or both; or the TCR? or TCR? or both; of the C component. Illustrative general engineered TCR formulas are provided below:


    A-C


    A-B-C

    [0470] The engineered TCRs contemplated herein can be designed and constructed using known components (e.g., TCR? and TCR? chains, linkers, and antigen-binding domains) and techniques. Table 3 provides an illustrative list of known antigen-binding domains. Table 4 provides an illustrative list of known polypeptide linkers. Table 5 provides an illustrative list of known TCRs. However, other known antigen-binding domains, linkers, and TCRs can be found throughout the literature, e.g., including but not limited to US20120082661, WO2016014789, WO2022046730, WO2016033570, U.S. Pat. No. 8,147,832B2, WO2014026054, WO2018145649, WO2014065961, WO2020123947, WO2013049254, WO2019241685, WO2019241688, WO2016049214, WO2018236870, WO2020102240, WO2018183888, U.S. Pat. No. 6,217,866B1, WO2008119566, WO2003055917, WO2018073680, WO2014146672, WO2019200007, WO2016016859, WO2018119279, WO2020227072, WO2020227073, WO2020227071, WO2017153402, WO2007042289, WO2018028647, WO2005113595, US20180273602, WO2019067242, WO2020193767, U.S. Ser. No. 10/538,572B2, U.S. Ser. No. 11/078,252B2, WO2019140100, WO2015009606, WO2021195503, WO2007131092, US20190169260 each of which are incorporated by reference herein, in their entirety. Since other known antigen-binding domains, linkers, and TCRs are well known in the literature, the invention is not intended to be limited to the illustrative components disclosed in Tables 3-5.

    TABLE-US-00004 TABLE 3 Illustrative Antigen-Binding Domains (A Components): COMPONENT REFERENCE TARGET BINDER TYPE SEQ ID NOs: A1 BCMA scFv 1, 2, AND/OR 3 A2 CD19 scFv 4 A3 CD20 scFv 5, 6, AND/OR 7 A4 CD22 scFv 8 A5 CD33 scFv 9 A6 CD79A scFv 10 A7 CD79B scFv 11 AND/OR 12 A8 B7H3 scFv 13 A9 Muc16 scFv 14 A10 HER2 scFv 15 A11 EGFR scFv 16 A12 FN-EDB scFv 17 A13 CLDN18.2 scFv 18 A14 DLL3 scFv 19 A15 FLT3 scFv 20 AND/OR 21 A16 CD33 VHH 22, 23, AND/OR 24 A17 CLL1 VHH 25 AND/OR 26 A18 CD123 VHH 27 AND/OR 28 A19 CD20 VHH 29 A20 EGFR VHH 30 A21 BCMA VHH 31 AND/OR 32

    TABLE-US-00005 TABLE4 IllustrativePolypeptideLinkers(BComponents): COMPONENT REFERENCE SEQUENCE SEQIDNO: B1 LEKT 33 B2 LEKTGGGGS 34 B3 GGGGS 35 B4 GGGGSGGGGS 36 B5 GGGGSGGGGSGGGGS 37 B6 GGGGSGGGGSGGGGSGGGGS 38 B7 GGGGSGGGGSGGGGSGGGGSGGGGS 39 B8 DGGGS 40 B9 TGEKP 41 B10 GGRR 42 B11 EGKSSGSGSESKVD 43 B12 KESGSVSSEQLAQFRSLD 44 B13 GGRRGGGS 45 B14 LRQRDGERP 46 B15 LRQKDGGGSERP 47 B16 LRQKDGGGSGGGSERP 48 B17 GSTSGSGKPGSGEGSTKG 49 B18 GSTSGSGKSSEGSGSTKG 50 B19 GSTSGSGKSSEGKG 51 B20 GSTSGSGKPGSGEGS 52 B21 GGGS 53

    TABLE-US-00006 TABLE 5 Illustrative TCRs (C Components): COMPONENT REFERENCE TARGET TCR? CHAIN SEQ ID NO: TCR? CHAIN SEQ ID NO: C1 NY-ESO-1 54 55 C2 NY-ESO-1 56 57 C3 PRAME 58 59 C4 TP53R175H 60 61 C5 MAGE-A4 62 63 C6 WT1 64 65 C7 MR1 66 67 C8 MR1 68 69 C9 CD1d + aGalCer 70 71 C10 HPV16E7 72 73 C11 GP100 74 75 C12 MART-1 76 77 TCR? Chain SEQ ID NO: TCR? Chain SEQ ID NO: C13 allo-HLA 78 79

    [0471] As one example of an engineered TCR contemplated herein, an antigen-binding domain from Table 3 (e.g., an antigen-binding domain selected from Component A1) can be combined with one or more polypeptide linkers from Table 4 (e.g., Component B1) and one or both TCR variable domains of a TCR from Table 5 (e.g., Component C1), to produce a novel engineered TCR construct (e.g., ATOMIC construct #1; see below). Additionally, as further shown and contemplated herein, multiple A components can be combined to produce multi-specific antigen-binding domains/regions (e.g., tandem antigen-binding domains), and multiple polypeptide linkers can be combined to produce functional linkers.

    [0472] Table 6 provides an illustrative, non-limiting list of engineered TCRs (i.e., ATOMIC constructs) based on the antigen-binding domains, linkers, and TCRs provided in Tables 3, 4, and 5. One of skill in the art would understand that other combinations are possible, including combinations using other antigen-binding domains, linkers, and TCRs either known to or newly developed by the skilled artisan.

    TABLE-US-00007 TABLE 6 Illustrative Engineered TCRs (i.e., ATOMICs): ATOMIC CONSTRUCT # A COMPONENT B COMPONENT C COMPONENT 1 A1 none or B1 C1 2 A2 none or B1 C1 3 A3 none or B1 C1 4 A4 none or B1 C1 5 A5 none or B1 C1 6 A6 none or B1 C1 7 A7 none or B1 C1 8 A8 none or B1 C1 9 A9 none or B1 C1 10 A10 none or B1 C1 11 A11 none or B1 C1 12 A12 none or B1 C1 13 A13 none or B1 C1 14 A14 none or B1 C1 15 A15 none or B1 C1 16 A16 none or B1 C1 17 A17 none or B1 C1 18 A18 none or B1 C1 19 A19 none or B1 C1 20 A20 none or B1 C1 21 A21 none or B1 C1 22 A1 B2 C1 23 A2 B2 C1 24 A3 B2 C1 25 A4 B2 C1 26 A5 B2 C1 27 A6 B2 C1 28 A7 B2 C1 29 A8 B2 C1 30 A9 B2 C1 31 A10 B2 C1 32 A11 B2 C1 33 A12 B2 C1 34 A13 B2 C1 35 A14 B2 C1 36 A15 B2 C1 37 A16 B2 C1 38 A17 B2 C1 39 A18 B2 C1 40 A19 B2 C1 41 A20 B2 C1 42 A21 B2 C1 43 A1 B3 C1 44 A2 B3 C1 45 A3 B3 C1 46 A4 B3 C1 47 A5 B3 C1 48 A6 B3 C1 49 A7 B3 C1 50 A8 B3 C1 51 A9 B3 C1 52 A10 B3 C1 53 A11 B3 C1 54 A12 B3 C1 55 A13 B3 C1 56 A14 B3 C1 57 A15 B3 C1 58 A16 B3 C1 59 A17 B3 C1 60 A18 B3 C1 61 A19 B3 C1 62 A20 B3 C1 63 A21 B3 C1 64 A1 B4 C1 65 A2 B4 C1 66 A3 B4 C1 67 A4 B4 C1 68 A5 B4 C1 69 A6 B4 C1 70 A7 B4 C1 71 A8 B4 C1 72 A9 B4 C1 73 A10 B4 C1 74 A11 B4 C1 75 A12 B4 C1 76 A13 B4 C1 77 A14 B4 C1 78 A15 B4 C1 79 A16 B4 C1 80 A17 B4 C1 81 A18 B4 C1 82 A19 B4 C1 83 A20 B4 C1 84 A21 B4 C1 85 A1 Any one of B5 through B21 C1 86 A2 Any one of B5 through B21 C1 87 A3 Any one of B5 through B21 C1 88 A4 Any one of B5 through B21 C1 89 A5 Any one of B5 through B21 C1 90 A6 Any one of B5 through B21 C1 91 A7 Any one of B5 through B21 C1 92 A8 Any one of B5 through B21 C1 93 A9 Any one of B5 through B21 C1 94 A10 Any one of B5 through B21 C1 95 A11 Any one of B5 through B21 C1 96 A12 Any one of B5 through B21 C1 97 A13 Any one of B5 through B21 C1 98 A14 Any one of B5 through B21 C1 99 A15 Any one of B5 through B21 C1 100 A16 Any one of B5 through B21 C1 101 A17 Any one of B5 through B21 C1 102 A18 Any one of B5 through B21 C1 103 A19 Any one of B5 through B21 C1 104 A20 Any one of B5 through B21 C1 105 A21 Any one of B5 through B21 C1 106 A1 none or B1 C2 107 A2 none or B1 C2 108 A3 none or B1 C2 109 A4 none or B1 C2 110 A5 none or B1 C2 111 A6 none or B1 C2 112 A7 none or B1 C2 113 A8 none or B1 C2 114 A9 none or B1 C2 115 A10 none or B1 C2 116 A11 none or B1 C2 117 A12 none or B1 C2 118 A13 none or B1 C2 119 A14 none or B1 C2 120 A15 none or B1 C2 121 A16 none or B1 C2 122 A17 none or B1 C2 123 A18 none or B1 C2 124 A19 none or B1 C2 125 A20 none or B1 C2 126 A21 none or B1 C2 127 A1 B2 C2 128 A2 B2 C2 129 A3 B2 C2 130 A4 B2 C2 131 A5 B2 C2 132 A6 B2 C2 133 A7 B2 C2 134 A8 B2 C2 135 A9 B2 C2 136 A10 B2 C2 137 A11 B2 C2 138 A12 B2 C2 139 A13 B2 C2 140 A14 B2 C2 141 A15 B2 C2 142 A16 B2 C2 143 A17 B2 C2 144 A18 B2 C2 145 A19 B2 C2 146 A20 B2 C2 147 A21 B2 C2 148 A1 B3 C2 149 A2 B3 C2 150 A3 B3 C2 151 A4 B3 C2 152 A5 B3 C2 153 A6 B3 C2 154 A7 B3 C2 155 A8 B3 C2 156 A9 B3 C2 157 A10 B3 C2 158 A11 B3 C2 159 A12 B3 C2 160 A13 B3 C2 161 A14 B3 C2 162 A15 B3 C2 163 A16 B3 C2 164 A17 B3 C2 165 A18 B3 C2 166 A19 B3 C2 167 A20 B3 C2 168 A21 B3 C2 169 A1 B4 C2 170 A2 B4 C2 171 A3 B4 C2 172 A4 B4 C2 173 A5 B4 C2 174 A6 B4 C2 175 A7 B4 C2 176 A8 B4 C2 177 A9 B4 C2 178 A10 B4 C2 179 A11 B4 C2 180 A12 B4 C2 181 A13 B4 C2 182 A14 B4 C2 183 A15 B4 C2 184 A16 B4 C2 185 A17 B4 C2 186 A18 B4 C2 187 A19 B4 C2 188 A20 B4 C2 189 A21 B4 C2 190 A1 Any one of B5 through B21 C2 191 A2 Any one of B5 through B21 C2 192 A3 Any one of B5 through B21 C2 193 A4 Any one of B5 through B21 C2 194 A5 Any one of B5 through B21 C2 195 A6 Any one of B5 through B21 C2 196 A7 Any one of B5 through B21 C2 197 A8 Any one of B5 through B21 C2 198 A9 Any one of B5 through B21 C2 199 A10 Any one of B5 through B21 C2 200 A11 Any one of B5 through B21 C2 201 A12 Any one of B5 through B21 C2 202 A13 Any one of B5 through B21 C2 203 A14 Any one of B5 through B21 C2 204 A15 Any one of B5 through B21 C2 205 A16 Any one of B5 through B21 C2 206 A17 Any one of B5 through B21 C2 207 A18 Any one of B5 through B21 C2 208 A19 Any one of B5 through B21 C2 209 A20 Any one of B5 through B21 C2 210 A21 Any one of B5 through B21 C2 211 A1 none or B1 C3 212 A2 none or B1 C3 213 A3 none or B1 C3 214 A4 none or B1 C3 215 A5 none or B1 C3 216 A6 none or B1 C3 217 A7 none or B1 C3 218 A8 none or B1 C3 219 A9 none or B1 C3 220 A10 none or B1 C3 221 A11 none or B1 C3 222 A12 none or B1 C3 223 A13 none or B1 C3 224 A14 none or B1 C3 225 A15 none or B1 C3 226 A16 none or B1 C3 227 A17 none or B1 C3 228 A18 none or B1 C3 229 A19 none or B1 C3 230 A20 none or B1 C3 231 A21 none or B1 C3 232 A1 B2 C3 233 A2 B2 C3 234 A3 B2 C3 235 A4 B2 C3 236 A5 B2 C3 237 A6 B2 C3 238 A7 B2 C3 239 A8 B2 C3 240 A9 B2 C3 241 A10 B2 C3 242 A11 B2 C3 243 A12 B2 C3 244 A13 B2 C3 245 A14 B2 C3 246 A15 B2 C3 247 A16 B2 C3 248 A17 B2 C3 249 A18 B2 C3 250 A19 B2 C3 251 A20 B2 C3 252 A21 B2 C3 253 A1 B3 C3 254 A2 B3 C3 255 A3 B3 C3 256 A4 B3 C3 257 A5 B3 C3 258 A6 B3 C3 259 A7 B3 C3 260 A8 B3 C3 261 A9 B3 C3 262 A10 B3 C3 263 A11 B3 C3 264 A12 B3 C3 265 A13 B3 C3 266 A14 B3 C3 267 A15 B3 C3 268 A16 B3 C3 269 A17 B3 C3 270 A18 B3 C3 271 A19 B3 C3 272 A20 B3 C3 273 A21 B3 C3 274 A1 B4 C3 275 A2 B4 C3 276 A3 B4 C3 277 A4 B4 C3 278 A5 B4 C3 279 A6 B4 C3 280 A7 B4 C3 281 A8 B4 C3 282 A9 B4 C3 283 A10 B4 C3 284 A11 B4 C3 285 A12 B4 C3 286 A13 B4 C3 287 A14 B4 C3 288 A15 B4 C3 289 A16 B4 C3 290 A17 B4 C3 291 A18 B4 C3 292 A19 B4 C3 293 A20 B4 C3 294 A21 B4 C3 295 A1 Any one of B5 through B21 C3 296 A2 Any one of B5 through B21 C3 297 A3 Any one of B5 through B21 C3 298 A4 Any one of B5 through B21 C3 299 A5 Any one of B5 through B21 C3 300 A6 Any one of B5 through B21 C3 301 A7 Any one of B5 through B21 C3 302 A8 Any one of B5 through B21 C3 303 A9 Any one of B5 through B21 C3 304 A10 Any one of B5 through B21 C3 305 A11 Any one of B5 through B21 C3 306 A12 Any one of B5 through B21 C3 307 A13 Any one of B5 through B21 C3 308 A14 Any one of B5 through B21 C3 309 A15 Any one of B5 through B21 C3 310 A16 Any one of B5 through B21 C3 311 A17 Any one of B5 through B21 C3 312 A18 Any one of B5 through B21 C3 313 A19 Any one of B5 through B21 C3 314 A20 Any one of B5 through B21 C3 315 A21 Any one of B5 through B21 C3 316 A1 none or B1 C4 317 A2 none or B1 C4 318 A3 none or B1 C4 319 A4 none or B1 C4 320 A5 none or B1 C4 321 A6 none or B1 C4 322 A7 none or B1 C4 323 A8 none or B1 C4 324 A9 none or B1 C4 325 A10 none or B1 C4 326 A11 none or B1 C4 327 A12 none or B1 C4 328 A13 none or B1 C4 329 A14 none or B1 C4 330 A15 none or B1 C4 331 A16 none or B1 C4 332 A17 none or B1 C4 333 A18 none or B1 C4 334 A19 none or B1 C4 335 A20 none or B1 C4 336 A21 none or B1 C4 337 A1 B2 C4 338 A2 B2 C4 339 A3 B2 C4 340 A4 B2 C4 341 A5 B2 C4 342 A6 B2 C4 343 A7 B2 C4 344 A8 B2 C4 345 A9 B2 C4 346 A10 B2 C4 347 A11 B2 C4 348 A12 B2 C4 349 A13 B2 C4 350 A14 B2 C4 351 A15 B2 C4 352 A16 B2 C4 353 A17 B2 C4 354 A18 B2 C4 355 A19 B2 C4 356 A20 B2 C4 357 A21 B2 C4 358 A1 B3 C4 359 A2 B3 C4 360 A3 B3 C4 361 A4 B3 C4 362 A5 B3 C4 363 A6 B3 C4 364 A7 B3 C4 365 A8 B3 C4 366 A9 B3 C4 367 A10 B3 C4 368 A11 B3 C4 369 A12 B3 C4 370 A13 B3 C4 371 A14 B3 C4 372 A15 B3 C4 373 A16 B3 C4 374 A17 B3 C4 375 A18 B3 C4 376 A19 B3 C4 377 A20 B3 C4 378 A21 B3 C4 379 A1 B4 C4 380 A2 B4 C4 381 A3 B4 C4 382 A4 B4 C4 383 A5 B4 C4 384 A6 B4 C4 385 A7 B4 C4 386 A8 B4 C4 387 A9 B4 C4 388 A10 B4 C4 389 A11 B4 C4 390 A12 B4 C4 391 A13 B4 C4 392 A14 B4 C4 393 A15 B4 C4 394 A16 B4 C4 395 A17 B4 C4 396 A18 B4 C4 397 A19 B4 C4 398 A20 B4 C4 399 A21 B4 C4 400 A1 Any one of B5 through B21 C4 401 A2 Any one of B5 through B21 C4 402 A3 Any one of B5 through B21 C4 403 A4 Any one of B5 through B21 C4 404 A5 Any one of B5 through B21 C4 405 A6 Any one of B5 through B21 C4 406 A7 Any one of B5 through B21 C4 407 A8 Any one of B5 through B21 C4 408 A9 Any one of B5 through B21 C4 409 A10 Any one of B5 through B21 C4 410 A11 Any one of B5 through B21 C4 411 A12 Any one of B5 through B21 C4 412 A13 Any one of B5 through B21 C4 413 A14 Any one of B5 through B21 C4 414 A15 Any one of B5 through B21 C4 415 A16 Any one of B5 through B21 C4 416 A17 Any one of B5 through B21 C4 417 A18 Any one of B5 through B21 C4 418 A19 Any one of B5 through B21 C4 419 A20 Any one of B5 through B21 C4 420 A21 Any one of B5 through B21 C4 421 A1 none or B1 C5 422 A2 none or B1 C5 423 A3 none or B1 C5 424 A4 none or B1 C5 425 A5 none or B1 C5 426 A6 none or B1 C5 427 A7 none or B1 C5 428 A8 none or B1 C5 429 A9 none or B1 C5 430 A10 none or B1 C5 431 A11 none or B1 C5 432 A12 none or B1 C5 433 A13 none or B1 C5 434 A14 none or B1 C5 435 A15 none or B1 C5 436 A16 none or B1 C5 437 A17 none or B1 C5 438 A18 none or B1 C5 439 A19 none or B1 C5 440 A20 none or B1 C5 441 A21 none or B1 C5 442 A1 B2 C5 443 A2 B2 C5 444 A3 B2 C5 445 A4 B2 C5 446 A5 B2 C5 447 A6 B2 C5 448 A7 B2 C5 449 A8 B2 C5 450 A9 B2 C5 451 A10 B2 C5 452 A11 B2 C5 453 A12 B2 C5 454 A13 B2 C5 455 A14 B2 C5 456 A15 B2 C5 457 A16 B2 C5 458 A17 B2 C5 459 A18 B2 C5 460 A19 B2 C5 461 A20 B2 C5 462 A21 B2 C5 463 A1 B3 C5 464 A2 B3 C5 465 A3 B3 C5 466 A4 B3 C5 467 A5 B3 C5 468 A6 B3 C5 469 A7 B3 C5 470 A8 B3 C5 471 A9 B3 C5 472 A10 B3 C5 473 A11 B3 C5 474 A12 B3 C5 475 A13 B3 C5 476 A14 B3 C5 477 A15 B3 C5 478 A16 B3 C5 479 A17 B3 C5 480 A18 B3 C5 481 A19 B3 C5 482 A20 B3 C5 483 A21 B3 C5 484 A1 B4 C5 485 A2 B4 C5 486 A3 B4 C5 487 A4 B4 C5 488 A5 B4 C5 489 A6 B4 C5 490 A7 B4 C5 491 A8 B4 C5 492 A9 B4 C5 493 A10 B4 C5 494 A11 B4 C5 495 A12 B4 C5 496 A13 B4 C5 497 A14 B4 C5 498 A15 B4 C5 499 A16 B4 C5 500 A17 B4 C5 501 A18 B4 C5 502 A19 B4 C5 503 A20 B4 C5 504 A21 B4 C5 505 A1 Any one of B5 through B21 C5 506 A2 Any one of B5 through B21 C5 507 A3 Any one of B5 through B21 C5 508 A4 Any one of B5 through B21 C5 509 A5 Any one of B5 through B21 C5 510 A6 Any one of B5 through B21 C5 511 A7 Any one of B5 through B21 C5 512 A8 Any one of B5 through B21 C5 513 A9 Any one of B5 through B21 C5 514 A10 Any one of B5 through B21 C5 515 A11 Any one of B5 through B21 C5 516 A12 Any one of B5 through B21 C5 517 A13 Any one of B5 through B21 C5 518 A14 Any one of B5 through B21 C5 519 A15 Any one of B5 through B21 C5 520 A16 Any one of B5 through B21 C5 521 A17 Any one of B5 through B21 C5 522 A18 Any one of B5 through B21 C5 523 A19 Any one of B5 through B21 C5 524 A20 Any one of B5 through B21 C5 525 A21 Any one of B5 through B21 C5 526 A1 none or B1 C6 527 A2 none or B1 C6 528 A3 none or B1 C6 529 A4 none or B1 C6 530 A5 none or B1 C6 531 A6 none or B1 C6 532 A7 none or B1 C6 533 A8 none or B1 C6 534 A9 none or B1 C6 535 A10 none or B1 C6 536 A11 none or B1 C6 537 A12 none or B1 C6 538 A13 none or B1 C6 539 A14 none or B1 C6 540 A15 none or B1 C6 541 A16 none or B1 C6 542 A17 none or B1 C6 543 A18 none or B1 C6 544 A19 none or B1 C6 545 A20 none or B1 C6 546 A21 none or B1 C6 547 A1 B2 C6 548 A2 B2 C6 549 A3 B2 C6 550 A4 B2 C6 551 A5 B2 C6 552 A6 B2 C6 553 A7 B2 C6 554 A8 B2 C6 555 A9 B2 C6 556 A10 B2 C6 557 A11 B2 C6 558 A12 B2 C6 559 A13 B2 C6 560 A14 B2 C6 561 A15 B2 C6 562 A16 B2 C6 563 A17 B2 C6 564 A18 B2 C6 565 A19 B2 C6 566 A20 B2 C6 567 A21 B2 C6 568 A1 B3 C6 569 A2 B3 C6 570 A3 B3 C6 571 A4 B3 C6 572 A5 B3 C6 573 A6 B3 C6 574 A7 B3 C6 575 A8 B3 C6 576 A9 B3 C6 577 A10 B3 C6 578 A11 B3 C6 579 A12 B3 C6 580 A13 B3 C6 581 A14 B3 C6 582 A15 B3 C6 583 A16 B3 C6 584 A17 B3 C6 585 A18 B3 C6 586 A19 B3 C6 587 A20 B3 C6 588 A21 B3 C6 589 A1 B4 C6 590 A2 B4 C6 591 A3 B4 C6 592 A4 B4 C6 593 A5 B4 C6 594 A6 B4 C6 595 A7 B4 C6 596 A8 B4 C6 597 A9 B4 C6 598 A10 B4 C6 599 A11 B4 C6 600 A12 B4 C6 601 A13 B4 C6 602 A14 B4 C6 603 A15 B4 C6 604 A16 B4 C6 605 A17 B4 C6 606 A18 B4 C6 607 A19 B4 C6 608 A20 B4 C6 609 A21 B4 C6 610 A1 Any one of B5 through B21 C6 611 A2 Any one of B5 through B21 C6 612 A3 Any one of B5 through B21 C6 613 A4 Any one of B5 through B21 C6 614 A5 Any one of B5 through B21 C6 615 A6 Any one of B5 through B21 C6 616 A7 Any one of B5 through B21 C6 617 A8 Any one of B5 through B21 C6 618 A9 Any one of B5 through B21 C6 619 A10 Any one of B5 through B21 C6 620 A11 Any one of B5 through B21 C6 621 A12 Any one of B5 through B21 C6 622 A13 Any one of B5 through B21 C6 623 A14 Any one of B5 through B21 C6 624 A15 Any one of B5 through B21 C6 625 A16 Any one of B5 through B21 C6 626 A17 Any one of B5 through B21 C6 627 A18 Any one of B5 through B21 C6 628 A19 Any one of B5 through B21 C6 629 A20 Any one of B5 through B21 C6 630 A21 Any one of B5 through B21 C6 631 A1 none or B1 C7 632 A2 none or B1 C7 633 A3 none or B1 C7 634 A4 none or B1 C7 635 A5 none or B1 C7 636 A6 none or B1 C7 637 A7 none or B1 C7 638 A8 none or B1 C7 639 A9 none or B1 C7 640 A10 none or B1 C7 641 A11 none or B1 C7 642 A12 none or B1 C7 643 A13 none or B1 C7 644 A14 none or B1 C7 645 A15 none or B1 C7 646 A16 none or B1 C7 647 A17 none or B1 C7 648 A18 none or B1 C7 649 A19 none or B1 C7 650 A20 none or B1 C7 651 A21 none or B1 C7 652 A1 B2 C7 653 A2 B2 C7 654 A3 B2 C7 655 A4 B2 C7 656 A5 B2 C7 657 A6 B2 C7 658 A7 B2 C7 659 A8 B2 C7 660 A9 B2 C7 661 A10 B2 C7 662 A11 B2 C7 663 A12 B2 C7 664 A13 B2 C7 665 A14 B2 C7 666 A15 B2 C7 667 A16 B2 C7 668 A17 B2 C7 669 A18 B2 C7 670 A19 B2 C7 671 A20 B2 C7 672 A21 B2 C7 673 A1 B3 C7 674 A2 B3 C7 675 A3 B3 C7 676 A4 B3 C7 677 A5 B3 C7 678 A6 B3 C7 679 A7 B3 C7 680 A8 B3 C7 681 A9 B3 C7 682 A10 B3 C7 683 A11 B3 C7 684 A12 B3 C7 685 A13 B3 C7 686 A14 B3 C7 687 A15 B3 C7 688 A16 B3 C7 689 A17 B3 C7 690 A18 B3 C7 691 A19 B3 C7 692 A20 B3 C7 693 A21 B3 C7 694 A1 B4 C7 695 A2 B4 C7 696 A3 B4 C7 697 A4 B4 C7 698 A5 B4 C7 699 A6 B4 C7 700 A7 B4 C7 701 A8 B4 C7 702 A9 B4 C7 703 A10 B4 C7 704 A11 B4 C7 705 A12 B4 C7 706 A13 B4 C7 707 A14 B4 C7 708 A15 B4 C7 709 A16 B4 C7 710 A17 B4 C7 711 A18 B4 C7 712 A19 B4 C7 713 A20 B4 C7 714 A21 B4 C7 715 A1 Any one of B5 through B21 C7 716 A2 Any one of B5 through B21 C7 717 A3 Any one of B5 through B21 C7 718 A4 Any one of B5 through B21 C7 719 A5 Any one of B5 through B21 C7 720 A6 Any one of B5 through B21 C7 721 A7 Any one of B5 through B21 C7 722 A8 Any one of B5 through B21 C7 723 A9 Any one of B5 through B21 C7 724 A10 Any one of B5 through B21 C7 725 A11 Any one of B5 through B21 C7 726 A12 Any one of B5 through B21 C7 727 A13 Any one of B5 through B21 C7 728 A14 Any one of B5 through B21 C7 729 A15 Any one of B5 through B21 C7 730 A16 Any one of B5 through B21 C7 731 A17 Any one of B5 through B21 C7 732 A18 Any one of B5 through B21 C7 733 A19 Any one of B5 through B21 C7 734 A20 Any one of B5 through B21 C7 735 A21 Any one of B5 through B21 C7 736 A1 none or B1 C8 737 A2 none or B1 C8 738 A3 none or B1 C8 739 A4 none or B1 C8 740 A5 none or B1 C8 741 A6 none or B1 C8 742 A7 none or B1 C8 743 A8 none or B1 C8 744 A9 none or B1 C8 745 A10 none or B1 C8 746 A11 none or B1 C8 747 A12 none or B1 C8 748 A13 none or B1 C8 749 A14 none or B1 C8 750 A15 none or B1 C8 751 A16 none or B1 C8 752 A17 none or B1 C8 753 A18 none or B1 C8 754 A19 none or B1 C8 755 A20 none or B1 C8 756 A21 none or B1 C8 757 A1 B2 C8 758 A2 B2 C8 759 A3 B2 C8 760 A4 B2 C8 761 A5 B2 C8 762 A6 B2 C8 763 A7 B2 C8 764 A8 B2 C8 765 A9 B2 C8 766 A10 B2 C8 767 A11 B2 C8 768 A12 B2 C8 769 A13 B2 C8 770 A14 B2 C8 771 A15 B2 C8 772 A16 B2 C8 773 A17 B2 C8 774 A18 B2 C8 775 A19 B2 C8 776 A20 B2 C8 777 A21 B2 C8 778 A1 B3 C8 779 A2 B3 C8 780 A3 B3 C8 781 A4 B3 C8 782 A5 B3 C8 783 A6 B3 C8 784 A7 B3 C8 785 A8 B3 C8 786 A9 B3 C8 787 A10 B3 C8 788 A11 B3 C8 789 A12 B3 C8 790 A13 B3 C8 791 A14 B3 C8 792 A15 B3 C8 793 A16 B3 C8 794 A17 B3 C8 795 A18 B3 C8 796 A19 B3 C8 797 A20 B3 C8 798 A21 B3 C8 799 A1 B4 C8 800 A2 B4 C8 801 A3 B4 C8 802 A4 B4 C8 803 A5 B4 C8 804 A6 B4 C8 805 A7 B4 C8 806 A8 B4 C8 807 A9 B4 C8 808 A10 B4 C8 809 A11 B4 C8 810 A12 B4 C8 811 A13 B4 C8 812 A14 B4 C8 813 A15 B4 C8 814 A16 B4 C8 815 A17 B4 C8 816 A18 B4 C8 817 A19 B4 C8 818 A20 B4 C8 819 A21 B4 C8 820 A1 Any one of B5 through B21 C8 821 A2 Any one of B5 through B21 C8 822 A3 Any one of B5 through B21 C8 823 A4 Any one of B5 through B21 C8 824 A5 Any one of B5 through B21 C8 825 A6 Any one of B5 through B21 C8 826 A7 Any one of B5 through B21 C8 827 A8 Any one of B5 through B21 C8 828 A9 Any one of B5 through B21 C8 829 A10 Any one of B5 through B21 C8 830 A11 Any one of B5 through B21 C8 831 A12 Any one of B5 through B21 C8 832 A13 Any one of B5 through B21 C8 833 A14 Any one of B5 through B21 C8 834 A15 Any one of B5 through B21 C8 835 A16 Any one of B5 through B21 C8 836 A17 Any one of B5 through B21 C8 837 A18 Any one of B5 through B21 C8 838 A19 Any one of B5 through B21 C8 839 A20 Any one of B5 through B21 C8 840 A21 Any one of B5 through B21 C8 841 A1 none or B1 C9 842 A2 none or B1 C9 843 A3 none or B1 C9 844 A4 none or B1 C9 845 A5 none or B1 C9 846 A6 none or B1 C9 847 A7 none or B1 C9 848 A8 none or B1 C9 849 A9 none or B1 C9 850 A10 none or B1 C9 851 A11 none or B1 C9 852 A12 none or B1 C9 853 A13 none or B1 C9 854 A14 none or B1 C9 855 A15 none or B1 C9 856 A16 none or B1 C9 857 A17 none or B1 C9 858 A18 none or B1 C9 859 A19 none or B1 C9 860 A20 none or B1 C9 861 A21 none or B1 C9 862 A1 B2 C9 863 A2 B2 C9 864 A3 B2 C9 865 A4 B2 C9 866 A5 B2 C9 867 A6 B2 C9 868 A7 B2 C9 869 A8 B2 C9 870 A9 B2 C9 871 A10 B2 C9 872 A11 B2 C9 873 A12 B2 C9 874 A13 B2 C9 875 A14 B2 C9 876 A15 B2 C9 877 A16 B2 C9 878 A17 B2 C9 879 A18 B2 C9 880 A19 B2 C9 881 A20 B2 C9 882 A21 B2 C9 883 A1 B3 C9 884 A2 B3 C9 885 A3 B3 C9 886 A4 B3 C9 887 A5 B3 C9 888 A6 B3 C9 889 A7 B3 C9 890 A8 B3 C9 891 A9 B3 C9 892 A10 B3 C9 893 A11 B3 C9 894 A12 B3 C9 895 A13 B3 C9 896 A14 B3 C9 897 A15 B3 C9 898 A16 B3 C9 899 A17 B3 C9 900 A18 B3 C9 901 A19 B3 C9 902 A20 B3 C9 903 A21 B3 C9 904 A1 B4 C9 905 A2 B4 C9 906 A3 B4 C9 907 A4 B4 C9 908 A5 B4 C9 909 A6 B4 C9 910 A7 B4 C9 911 A8 B4 C9 912 A9 B4 C9 913 A10 B4 C9 914 A11 B4 C9 915 A12 B4 C9 916 A13 B4 C9 917 A14 B4 C9 918 A15 B4 C9 919 A16 B4 C9 920 A17 B4 C9 921 A18 B4 C9 922 A19 B4 C9 923 A20 B4 C9 924 A21 B4 C9 925 A1 Any one of B5 through B21 C9 926 A2 Any one of B5 through B21 C9 927 A3 Any one of B5 through B21 C9 928 A4 Any one of B5 through B21 C9 929 A5 Any one of B5 through B21 C9 930 A6 Any one of B5 through B21 C9 931 A7 Any one of B5 through B21 C9 932 A8 Any one of B5 through B21 C9 933 A9 Any one of B5 through B21 C9 934 A10 Any one of B5 through B21 C9 935 A11 Any one of B5 through B21 C9 936 A12 Any one of B5 through B21 C9 937 A13 Any one of B5 through B21 C9 938 A14 Any one of B5 through B21 C9 939 A15 Any one of B5 through B21 C9 940 A16 Any one of B5 through B21 C9 941 A17 Any one of B5 through B21 C9 942 A18 Any one of B5 through B21 C9 943 A19 Any one of B5 through B21 C9 944 A20 Any one of B5 through B21 C9 945 A21 Any one of B5 through B21 C9 946 A1 none or B1 C10 947 A2 none or B1 C10 948 A3 none or B1 C10 949 A4 none or B1 C10 950 A5 none or B1 C10 951 A6 none or B1 C10 952 A7 none or B1 C10 953 A8 none or B1 C10 954 A9 none or B1 C10 955 A10 none or B1 C10 956 A11 none or B1 C10 957 A12 none or B1 C10 958 A13 none or B1 C10 959 A14 none or B1 C10 960 A15 none or B1 C10 961 A16 none or B1 C10 962 A17 none or B1 C10 963 A18 none or B1 C10 964 A19 none or B1 C10 965 A20 none or B1 C10 966 A21 none or B1 C10 967 A1 B2 C10 968 A2 B2 C10 969 A3 B2 C10 970 A4 B2 C10 971 A5 B2 C10 972 A6 B2 C10 973 A7 B2 C10 974 A8 B2 C10 975 A9 B2 C10 976 A10 B2 C10 977 A11 B2 C10 978 A12 B2 C10 979 A13 B2 C10 980 A14 B2 C10 981 A15 B2 C10 982 A16 B2 C10 983 A17 B2 C10 984 A18 B2 C10 985 A19 B2 C10 986 A20 B2 C10 987 A21 B2 C10 988 A1 B3 C10 989 A2 B3 C10 990 A3 B3 C10 991 A4 B3 C10 992 A5 B3 C10 993 A6 B3 C10 994 A7 B3 C10 995 A8 B3 C10 996 A9 B3 C10 997 A10 B3 C10 998 A11 B3 C10 999 A12 B3 C10 1000 A13 B3 C10 1001 A14 B3 C10 1002 A15 B3 C10 1003 A16 B3 C10 1004 A17 B3 C10 1005 A18 B3 C10 1006 A19 B3 C10 1007 A20 B3 C10 1008 A21 B3 C10 1009 A1 B4 C10 1010 A2 B4 C10 1011 A3 B4 C10 1012 A4 B4 C10 1013 A5 B4 C10 1014 A6 B4 C10 1015 A7 B4 C10 1016 A8 B4 C10 1017 A9 B4 C10 1018 A10 B4 C10 1019 A11 B4 C10 1020 A12 B4 C10 1021 A13 B4 C10 1022 A14 B4 C10 1023 A15 B4 C10 1024 A16 B4 C10 1025 A17 B4 C10 1026 A18 B4 C10 1027 A19 B4 C10 1028 A20 B4 C10 1029 A21 B4 C10 1030 A1 Any one of B5 through B21 C10 1031 A2 Any one of B5 through B21 C10 1032 A3 Any one of B5 through B21 C10 1033 A4 Any one of B5 through B21 C10 1034 A5 Any one of B5 through B21 C10 1035 A6 Any one of B5 through B21 C10 1036 A7 Any one of B5 through B21 C10 1037 A8 Any one of B5 through B21 C10 1038 A9 Any one of B5 through B21 C10 1039 A10 Any one of B5 through B21 C10 1040 A11 Any one of B5 through B21 C10 1041 A12 Any one of B5 through B21 C10 1042 A13 Any one of B5 through B21 C10 1043 A14 Any one of B5 through B21 C10 1044 A15 Any one of B5 through B21 C10 1045 A16 Any one of B5 through B21 C10 1046 A17 Any one of B5 through B21 C10 1047 A18 Any one of B5 through B21 C10 1048 A19 Any one of B5 through B21 C10 1049 A20 Any one of B5 through B21 C10 1050 A21 Any one of B5 through B21 C10 1051 A1 none or B1 C11 1052 A2 none or B1 C11 1053 A3 none or B1 C11 1054 A4 none or B1 C11 1055 A5 none or B1 C11 1056 A6 none or B1 C11 1057 A7 none or B1 C11 1058 A8 none or B1 C11 1059 A9 none or B1 C11 1060 A10 none or B1 C11 1061 A11 none or B1 C11 1062 A12 none or B1 C11 1063 A13 none or B1 C11 1064 A14 none or B1 C11 1065 A15 none or B1 C11 1066 A16 none or B1 C11 1067 A17 none or B1 C11 1068 A18 none or B1 C11 1069 A19 none or B1 C11 1070 A20 none or B1 C11 1071 A21 none or B1 C11 1072 A1 B2 C11 1073 A2 B2 C11 1074 A3 B2 C11 1075 A4 B2 C11 1076 A5 B2 C11 1077 A6 B2 C11 1078 A7 B2 C11 1079 A8 B2 C11 1080 A9 B2 C11 1081 A10 B2 C11 1082 A11 B2 C11 1083 A12 B2 C11 1084 A13 B2 C11 1085 A14 B2 C11 1086 A15 B2 C11 1087 A16 B2 C11 1088 A17 B2 C11 1089 A18 B2 C11 1090 A19 B2 C11 1091 A20 B2 C11 1092 A21 B2 C11 1093 A1 B3 C11 1094 A2 B3 C11 1095 A3 B3 C11 1096 A4 B3 C11 1097 A5 B3 C11 1098 A6 B3 C11 1099 A7 B3 C11 1100 A8 B3 C11 1101 A9 B3 C11 1102 A10 B3 C11 1103 A11 B3 C11 1104 A12 B3 C11 1105 A13 B3 C11 1106 A14 B3 C11 1107 A15 B3 C11 1108 A16 B3 C11 1109 A17 B3 C11 1110 A18 B3 C11 1111 A19 B3 C11 1112 A20 B3 C11 1113 A21 B3 C11 1114 A1 B4 C11 1115 A2 B4 C11 1116 A3 B4 C11 1117 A4 B4 C11 1118 A5 B4 C11 1119 A6 B4 C11 1120 A7 B4 C11 1121 A8 B4 C11 1122 A9 B4 C11 1123 A10 B4 C11 1124 A11 B4 C11 1125 A12 B4 C11 1126 A13 B4 C11 1127 A14 B4 C11 1128 A15 B4 C11 1129 A16 B4 C11 1130 A17 B4 C11 1131 A18 B4 C11 1132 A19 B4 C11 1133 A20 B4 C11 1134 A21 B4 C11 1135 A1 Any one of B5 through B21 C11 1136 A2 Any one of B5 through B21 C11 1137 A3 Any one of B5 through B21 C11 1138 A4 Any one of B5 through B21 C11 1139 A5 Any one of B5 through B21 C11 1140 A6 Any one of B5 through B21 C11 1141 A7 Any one of B5 through B21 C11 1142 A8 Any one of B5 through B21 C11 1143 A9 Any one of B5 through B21 C11 1144 A10 Any one of B5 through B21 C11 1145 A11 Any one of B5 through B21 C11 1146 A12 Any one of B5 through B21 C11 1147 A13 Any one of B5 through B21 C11 1148 A14 Any one of B5 through B21 C11 1149 A15 Any one of B5 through B21 C11 1150 A16 Any one of B5 through B21 C11 1151 A17 Any one of B5 through B21 C11 1152 A18 Any one of B5 through B21 C11 1153 A19 Any one of B5 through B21 C11 1154 A20 Any one of B5 through B21 C11 1155 A21 Any one of B5 through B21 C11 1156 A1 none or B1 C12 1157 A2 none or B1 C12 1158 A3 none or B1 C12 1159 A4 none or B1 C12 1160 A5 none or B1 C12 1161 A6 none or B1 C12 1162 A7 none or B1 C12 1163 A8 none or B1 C12 1164 A9 none or B1 C12 1165 A10 none or B1 C12 1166 A11 none or B1 C12 1167 A12 none or B1 C12 1168 A13 none or B1 C12 1169 A14 none or B1 C12 1170 A15 none or B1 C12 1171 A16 none or B1 C12 1172 A17 none or B1 C12 1173 A18 none or B1 C12 1174 A19 none or B1 C12 1175 A20 none or B1 C12 1176 A21 none or B1 C12 1177 A1 B2 C12 1178 A2 B2 C12 1179 A3 B2 C12 1180 A4 B2 C12 1181 A5 B2 C12 1182 A6 B2 C12 1183 A7 B2 C12 1184 A8 B2 C12 1185 A9 B2 C12 1186 A10 B2 C12 1187 A11 B2 C12 1188 A12 B2 C12 1189 A13 B2 C12 1190 A14 B2 C12 1191 A15 B2 C12 1192 A16 B2 C12 1193 A17 B2 C12 1194 A18 B2 C12 1195 A19 B2 C12 1196 A20 B2 C12 1197 A21 B2 C12 1198 A1 B3 C12 1199 A2 B3 C12 1200 A3 B3 C12 1201 A4 B3 C12 1202 A5 B3 C12 1203 A6 B3 C12 1204 A7 B3 C12 1205 A8 B3 C12 1206 A9 B3 C12 1207 A10 B3 C12 1208 A11 B3 C12 1209 A12 B3 C12 1210 A13 B3 C12 1211 A14 B3 C12 1212 A15 B3 C12 1213 A16 B3 C12 1214 A17 B3 C12 1215 A18 B3 C12 1216 A19 B3 C12 1217 A20 B3 C12 1218 A21 B3 C12 1219 A1 B4 C12 1220 A2 B4 C12 1221 A3 B4 C12 1222 A4 B4 C12 1223 A5 B4 C12 1224 A6 B4 C12 1225 A7 B4 C12 1226 A8 B4 C12 1227 A9 B4 C12 1228 A10 B4 C12 1229 A11 B4 C12 1230 A12 B4 C12 1231 A13 B4 C12 1232 A14 B4 C12 1233 A15 B4 C12 1234 A16 B4 C12 1235 A17 B4 C12 1236 A18 B4 C12 1237 A19 B4 C12 1238 A20 B4 C12 1239 A21 B4 C12 1240 A1 Any one of B5 through B21 C12 1241 A2 Any one of B5 through B21 C12 1242 A3 Any one of B5 through B21 C12 1243 A4 Any one of B5 through B21 C12 1244 A5 Any one of B5 through B21 C12 1245 A6 Any one of B5 through B21 C12 1246 A7 Any one of B5 through B21 C12 1247 A8 Any one of B5 through B21 C12 1248 A9 Any one of B5 through B21 C12 1249 A10 Any one of B5 through B21 C12 1250 A11 Any one of B5 through B21 C12 1251 A12 Any one of B5 through B21 C12 1252 A13 Any one of B5 through B21 C12 1253 A14 Any one of B5 through B21 C12 1254 A15 Any one of B5 through B21 C12 1255 A16 Any one of B5 through B21 C12 1256 A17 Any one of B5 through B21 C12 1257 A18 Any one of B5 through B21 C12 1258 A19 Any one of B5 through B21 C12 1259 A20 Any one of B5 through B21 C12 1260 A21 Any one of B5 through B21 C12 1261 A1 none or B1 C13 1262 A2 none or B1 C13 1263 A3 none or B1 C13 1264 A4 none or B1 C13 1265 A5 none or B1 C13 1266 A6 none or B1 C13 1267 A7 none or B1 C13 1268 A8 none or B1 C13 1269 A9 none or B1 C13 1270 A10 none or B1 C13 1271 A11 none or B1 C13 1272 A12 none or B1 C13 1273 A13 none or B1 C13 1274 A14 none or B1 C13 1275 A15 none or B1 C13 1276 A16 none or B1 C13 1277 A17 none or B1 C13 1278 A18 none or B1 C13 1279 A19 none or B1 C13 1280 A20 none or B1 C13 1281 A21 none or B1 C13 1282 A1 B2 C13 1283 A2 B2 C13 1284 A3 B2 C13 1285 A4 B2 C13 1286 A5 B2 C13 1287 A6 B2 C13 1288 A7 B2 C13 1289 A8 B2 C13 1290 A9 B2 C13 1291 A10 B2 C13 1292 A11 B2 C13 1293 A12 B2 C13 1294 A13 B2 C13 1295 A14 B2 C13 1296 A15 B2 C13 1297 A16 B2 C13 1298 A17 B2 C13 1299 A18 B2 C13 1300 A19 B2 C13 1301 A20 B2 C13 1302 A21 B2 C13 1303 A1 B3 C13 1304 A2 B3 C13 1305 A3 B3 C13 1306 A4 B3 C13 1307 A5 B3 C13 1308 A6 B3 C13 1309 A7 B3 C13 1310 A8 B3 C13 1311 A9 B3 C13 1312 A10 B3 C13 1313 A11 B3 C13 1314 A12 B3 C13 1315 A13 B3 C13 1316 A14 B3 C13 1317 A15 B3 C13 1318 A16 B3 C13 1319 A17 B3 C13 1320 A18 B3 C13 1321 A19 B3 C13 1322 A20 B3 C13 1323 A21 B3 C13 1324 A1 B4 C13 1325 A2 B4 C13 1326 A3 B4 C13 1327 A4 B4 C13 1328 A5 B4 C13 1329 A6 B4 C13 1330 A7 B4 C13 1331 A8 B4 C13 1332 A9 B4 C13 1333 A10 B4 C13 1334 A11 B4 C13 1335 A12 B4 C13 1336 A13 B4 C13 1337 A14 B4 C13 1338 A15 B4 C13 1339 A16 B4 C13 1340 A17 B4 C13 1341 A18 B4 C13 1342 A19 B4 C13 1343 A20 B4 C13 1344 A21 B4 C13 1345 A1 Any one of B5 through B21 C13 1346 A2 Any one of B5 through B21 C13 1347 A3 Any one of B5 through B21 C13 1348 A4 Any one of B5 through B21 C13 1349 A5 Any one of B5 through B21 C13 1350 A6 Any one of B5 through B21 C13 1351 A7 Any one of B5 through B21 C13 1352 A8 Any one of B5 through B21 C13 1353 A9 Any one of B5 through B21 C13 1354 A10 Any one of B5 through B21 C13 1355 A11 Any one of B5 through B21 C13 1356 A12 Any one of B5 through B21 C13 1357 A13 Any one of B5 through B21 C13 1358 A14 Any one of B5 through B21 C13 1359 A15 Any one of B5 through B21 C13 1360 A16 Any one of B5 through B21 C13 1361 A17 Any one of B5 through B21 C13 1362 A18 Any one of B5 through B21 C13 1363 A19 Any one of B5 through B21 C13 1364 A20 Any one of B5 through B21 C13 1365 A21 Any one of B5 through B21 C13

    [0473] As would be apparent to one skilled in the art, certain engineered TCR constructs (ATOMICs) comprising multiple A and B components are contemplated, and are surprisingly effective (see Examples 2-9).

    [0474] Additionally, the engineered TCRs (ATOMICs) contemplated herein may also include a native or engineered TCR constant domain. For example, the constant domain can be a native or engineered TCR?, TCR?, TCR?, or TCR? constant domain. Moreover, any TCR variable domain can be combined with any TCR constant domain. For example, a TCR? variable domain can be combined with any one of the TCR?, TCR?, TCR?, or TCR? constant domains; a TCR? variable domain can be combined with any one of the TCR?, TCR?, TCR?, or TCR? constant domains; a TCR? variable domain can be combined with any one of the TCR?, TCR?, TCR?, or TCR? constant domains; and a TCR? variable domain can be combined with any one of the TCR?, TCR?, TCR?, or TCR? constant domains. Illustrative native and pairing enhanced TCR constant domains are provided in Table 7 below. For other examples of TCR constant domains, see also WO2021195503A1, which is incorporated by reference herein, in its entirety.

    TABLE-US-00008 TABLE 7 TCR constant domains: NAME SEQ ID NO: human beta constant 1 (huTRBC1) 80 human beta constant 2 (huTRBC2) 81 human alpha constant (huTRAC) 82 human gamma constant 1 (huTRGC1) 83 human gamma constant 2 (huTRGC2) 84 human delta constant (huTRDC) 85 pairing enhanced beta constant 1 (mmTRBC1) 86 pairing enhanced beta constant 2 (mmTRBC2) 87 pairing enhanced alpha constant (mmTRAC) 88

    [0475] In general, in the following claims, the terms used should not be construed to limit the claims to the specific embodiments disclosed in the specification and the claims, but should be construed to include all possible embodiments along with the full scope of equivalents to which such claims are entitled. Accordingly, the claims are not limited by the disclosure.